CLUSTAL format seed alignment for MF_00848

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

UUP_CAUVC             MASPARAPVLALKDVRLADGAKPLFDGVDLALEPRVRACLVGRNGAGKSTLLKILAGQGV
A0A2E2VQ33_9GAMM      ------MALINLTDISLSFSGNHLFSNVSASIHKQEKIAIVGRNGSGKSTLLQLIQGK-L
A0A3A1YQ40_9PAST      ------MSIVRLTDASLSFGDHVILDQINLSIEPHERLCIVGRNGSGKSTLLKVLRGT-E
UUP_BUCAI             ------MSLINIHNASLSFSNLQILEKSTFHINKNERVCLIGKNGAGKSTLLKIINKK-Q
R5EZ17_9GAMM          ------MSLVSIIDAYLNNGADKLLEGANLSIEENERICLVGRNGTGKSTLLSLIQGK-R
A0A316FQY6_9GAMM      ------MAIVRGDKLSLSFGTHVLLDQASFSLSAGEKVAIVGRNGAGKSSLLKLVAQI-N
A0A2E6LWH3_9GAMM      ------MNLIEFDDVSLKFGTQQILNHVDLAIRPEERVCLIGRNGAGKSTLFRLILQQ-Q
A0A1Z9UKG1_9GAMM      ------MSILTFXDVNLXFGDQIIFRNAXFSLEPNERVCVIGRNGAGKSTLFRLILQQ-Q
A0A2E3YKV6_9GAMM      ------MSLLRFKDVSLSFGDQPILRDANMKIEAGERLCLIGRNGAGKSSTLKLLTGD-I
A0A2E9D7P8_9GAMM      ------MPLVRLDEVSLEFGEQVLLRDASMSIEAGERVCLIGRNGAGKTSLLRLITGE-L
A0A4Z0WFB0_9BACT      ------MLTLSLQSLHHAYGSAPVLEGVDWQQSTDERLCLVGRNGEGKSTLMRLLAGV-E
A0A0Q9YA56_9COXI      ------MPILTLKNIYFSVGQFPLLDKVNLDIHPKERIALIGRNGEGKSTLLRMLSGK-I
A0A1Z8RH18_9GAMM      ------MSIVTCTNLHVSFGEDVILDHIDLAIEKNERLCVTGRNGSGKSTLLRLLAGE-A
A0A1G0H206_9GAMM      ------MQILNLKDLSAGFGVKPLFQNINLQVNIGECIALVGRNGVGKSSLLKIIAGE-Y
C6YXE5_9GAMM          ------MQLISLKNVSLNFGTQIVLDKVNLEVTKGQRICLIGRNGTGKSSLLKIIEGN-V
A0A2H0DA36_9GAMM      ---------------------MPLLDNANFSLKSKERLCLIGRNGAGKSSLLAVLEGT-L
A0A2E9ZAS5_9COXI      ------MALIQLKNIHLSFAEAPLFNDLSLQVSRKQRIALIGRNGTGKSTLLKVIQKI-V
A0A1W6LNA1_9BACT      ------MSIIVAKDLDAGYGGPLLVNKAGFAIEKGERLALMGRNGCGKTTLLNVLRGE-L
A0A1Z8QGI1_9PROT      ------MSLITLKSIELSFGNPSLLNDISFSIDXNERICLVGRNGAGKTSLLKIIEGN-L
A0A0W0VWK2_9GAMM      ------MSIVSLHNVLLNLAGNCLLDQVDWQIQPRDRVALVGRNGAGKSTLLRLLQGE-L
F2B9M7_9NEIS          ------MNILQAENLCFAVGHVALLDKASFQLDAGERVGLIGRNGAGKSSLLKILAGV-Q
N6YE33_9RHOO          ------MPLLSVENACLAFGHVDLLDKVAFQLDAGERVALIGRNGSGKSSLLRAVAGQ-A
A0A1Q2MIS2_9BACT      ------MAQITISDMTFGFGEPPLFDGVNFNIESRRRICLLGRNGSGKTTLLKLIEGE-L
A0A2A4UL14_9GAMM      ------MAIVQVRDLKLGYGAENLFDGAELQIDPRERVCLVGRNGAGKSTFLKLLAGQ-I
B5JQK7_9BACT          ------MPVLSVTELTISFSGPAVLENASLHIDRGERVCVLGRNGAGKSTLLKVISGE-Y
UUP_ECOLI             ------MSLISMHGAWLSFSDAPLLDNAELHIEDNERVCLVGRNGAGKSTLMKILNRE-Q
A0A1U6GNG6_9GAMM      ------MALIHLKDIHLAFGVAPVLDGIDFAIDAGERVCLIGRNGEGKSTLFKLINGT-L
Q7UGS0_RHOBA          --------MISLDDLTIGFRGPALLDGVSARIERGQRIGLLGRNGAGKTTLLKMLSGD-V
A0A1F7F2Y7_9BACT      ------MSLVTLHNIRIAFGGPAVLDDISLTIQKGQRICLLGRNGEGKSTLLKIISRE-L
R4YLW5_OLEAN          ------MVLVRLKGVSLAFGNQVLLNKVDLDVNAGERVCVLGRNGEGKSTLLKILNKE-V
A0A1C9W9F0_9GAMM      --------MLQLDNVGLRYGAQVLAEAVTARVEKGDRICLVGRNGEGKSSLLRLIAGE-I
A0A2N1TGV2_9SPIR      ------MALMNLQNITLAFGGPVLFDGIGIQIQAGEKICLLGRNGSGKSTLMKIISGT-L
A0A2E2HCR1_9GAMM      ------MLLFRLTDIHLAYGPQVLLDKVSLTIHKGERIGLLGRNGAGKSTFLKLLSSK-I
F3LGW8_9GAMM          ------MELIKFDQCSLHYGEQVLMDSIDLSIHKGQKICLVGRNGTGKSTLLKMMMGD-V
H8W713_MARHS          --------------------MHPLLDEASLTIEPGERVCLLGRNGEGKSTLLKIVSGE-V
M1WYT7_PSEP2          ------MAVVSLRDISINFTGTLLLDSVSMQIEPGERACLLGRNGEGKSTLLGIIDGS-V
A0A3A4SF11_9DELT      ------MALISIRNMSMGFGGHLLFDQVSLHIEPGERACLVGRNGEGKTTLLHILQGG-V
A0A090AI32_9GAMM      --MTSAMALISLNNVSIAFGHVALLDKVALRLDRGERVCLIGRNGEGKSTLLTLISGE-I
A0A1A8TSW9_9GAMM      ------MSLLSLEQVSVAFGHNPLLSKISFSAEAGERVAIIGRNGAGKSTFLKVVAGE-Q
A0A1E2VA67_9GAMM      ------MTLIRFENLHLAYGPTPLLKEADLVIEEGEKLALLGRNGAGKSSLLKLVAGE-I
G8PYZ1_PSEF3          ------MTLLKFSDVSLAFGAMPLLDKVSWQIARGERVCIIGRNGTGKSSMMKLVKGD-Q
L0E228_THIND          ------MALVTLRGIRLAYGLAALLDGIDLALNPGERVCIVGRNGEGKSTLLKILAGR-I
A0A1V5D8U4_9DELT      ------MGFIWINDVSINFGGLSLLNGVSFQIEPGERIGLLGRNGSGKSTLMKLLAGQ-T
A0A1S7LIS0_MAGMO      ------MALLDLKNIRVGHGGPPILDGIDFNIEAGERVCLVGRNGSGKTTLLRVIQGE-L
B5JVV0_9GAMM          ------MPLLRIKQLQLAYGPHTLLDRVDMQLDAGERVCLIGRNGTGKSTLMKIIAGE-I
Q74EP9_GEOSL          ------MALITLRNITLAFGGPPLFDGINLQIGEGERLCLMGRNGTGKSTLLKLIAGE-I
A0A2U8E0M9_9BACT      ------MALVNLLDINLAFGGPAVLENVNFQIDPGERVCLVGRNGSGKTTLMRVIAGE-M
A0A496ZBP1_9DELT      ------MALIGMRDVCWGFVDPPLLENITFQIEKGERVCLVGRNGVGQSTLLKLLGGQ-M
A0A2U3K0D5_9DELT      ------MALIGMHDVCIGFGGPLLLDHVNFHMERRERVCLLGRNGTGKSTLMRLLNGD-L
                                             :               : *.** *::: :  :     

UUP_CAUVC             EADSGERAVQPGAKVVYVSQEPEI------------------TGETLLDYA---------
A0A2E2VQ33_9GAMM      EPDDGQIKKAQLISIAEVEQKLPDDPE-I-RCGEYILSGLGKLGVVIREYFALLEEPEAD
A0A3A1YQ40_9PAST      DLDAGSKILENNVQIAYLRQDPPERLD-L-TTYEYVSQGAQKAVDTLAAHQAALEAYAKN
UUP_BUCAI             DLDEGQIIYKKNTTTAYLEQNNPKNLN-I-SIYDFIALGLKEHEKNKKKHTNEIV-----
R5EZ17_9GAMM          ELDSGRIIIQSGLKIATLCQDPPSYEH-G-TAYSLAASGVPVVGESLSKFSLS-------
A0A316FQY6_9GAMM      KPDSGELQQQKALRVRYLAQSLPESLD-I-SVFDYVSKGVEDIKLALDKYQHLLETG---
A0A2E6LWH3_9GAMM      SHDSGEIRYKNHLRISMLQQQMPDTEKDM-LVIDVVRQGLADLQALLDKFKEISEQPN--
A0A1Z9UKG1_9GAMM      EXDSGEIRISDNIKIAQLDQSLPQTAE-M-TVKXFVTSGLNNSQRLIAKYQALASEEVNH
A0A2E3YKV6_9GAMM      LPDEGKIDVHPNLQISTLDQSLAEGST-R-LVRDIVEEGMSEQMTRISAYKELSASRGSR
A0A2E9D7P8_9GAMM      EPDHGELHYRGDIGISKLDQTLPVELD-M-TVREVVGQGLAAVRTLSEEYERRSKLDLDK
A0A4Z0WFB0_9BACT      TPDQGRVGWSEDAVIGYVPQELPKPSG-E-TLYEFIMAGAGEAGRKLLDYQAALRQD---
A0A0Q9YA56_9COXI      SPESGEILKPSYVRISRLAQELPEVGD-M-TVYEAVSDGLSDLRDLLLQYHHLTAQLEGH
A0A1Z8RH18_9GAMM      EPDDGTIWYQEGLRVSALPQTLPERSQ-K-TIFDVVAEAFAETGSLLQQYHQLATSPD--
A0A1G0H206_9GAMM      SPDSGSVQFSKNTTISMLSQTVPLKLT-G-SVYDVIATGLSEIGALLQSYQVVLKKLETD
C6YXE5_9GAMM          IPDGGEVIVHNNAIVASMIQEVPSDIK-G-SIAEVILQGLGELGEHLIAYQQTLMSD---
A0A2H0DA36_9GAMM      LLDGGTIRKRSGLVIASLSQTLPKSED-I-SLYDFIASGLSKIGEALVQYHRLSLKLADA
A0A2E9ZAS5_9COXI      QPDTGLVEGQAH-TITALQQNVPDNLS-G-NVHDFLATSLGD------------------
A0A1W6LNA1_9BACT      EPLGGELNFQKGLNISSLEQEVPASLE-G-SIFDVILKGAGPEGEKLSRFLHLSASTEHN
A0A1Z8QGI1_9PROT      LPDSGEVILKSGLRITRLEQEVPKNLN-G-NIFDVVSQGLGDIGSLTNDYQKAIKKLELN
A0A0W0VWK2_9GAMM      VPDSGQINQMSGLRIAGLTQEVPLDANDE-TVYHFLVKSLGEVGEVLSQFQQLSNS----
F2B9M7_9NEIS          KADDGQIVLQNGLKTVYVPQENFFDPK-S-TVFDAVSEGLGGLRDVLRRYHAVLSELERQ
N6YE33_9RHOO          ALDDGTVWREAGMVTAYVPQEPDFDLG-R-DVFATVADGLGNAAQLLVDYHAAMLAVAEQ
A0A1Q2MIS2_9BACT      EPLAGSIIKSPQLKIERLHQQVPPETSFGKTVYEMIIDGHGEAGRLIGEYHRTAVAAAQN
A0A2A4UL14_9GAMM      SQDSGEILFAGDSRIAMLSQTVPPGVV-G-TVNEVITLGYGEVGEKLNRYQTLLTDLETD
B5JQK7_9BACT          GANSGSITFPEGGIATALPQEIPQDLD-A-TVREIVTSGFGAEGEALAALHADLP-----
UUP_ECOLI             GLDDGRIIYEQDLIVARLQQDPPRNVE-G-SVYDFVAEGIEEQAEYLKRYHDISRLVMND
A0A1U6GNG6_9GAMM      LPDSGEVIINNSVRVAMLEQDVPETS--G-KILDIVMGGSKRTAELLINYNAQTDLCANG
Q7UGS0_RHOBA          TPDNGQVILDPNVRLARLTQDVPQNVK-G-TVQDIMTLPAEQFSKMGTTA----------
A0A1F7F2Y7_9BACT      TPDSGEVITAQGITVAYLPQEVPMGLQ-G-SAFELTACGAGKLGESLAAYHRLFQDH---
R4YLW5_OLEAN          TPDEGMVQHSDTIRIAALQQELPVTDP-Q-TVYEVVASGLGDLGKTISAYHEEILRGAE-
A0A1C9W9F0_9GAMM      DADEGEVVRSAGSRLATLEQELPADCR-D-SVYQYVAAGLGDVGRYLAAYREQPD-----
A0A2N1TGV2_9SPIR      EPDSGRVIRDDHVTTAFLSQEVPDDIR-G-SVYDCIASGYLPHHDG--------------
A0A2E2HCR1_9GAMM      KADGGELWQQSDLKVAYLNQELPPATE-Q-TVADYVLEGLAEAGHLLMEFNRLSQAEPNR
F3LGW8_9GAMM          KPDGGSIWRRQGLRIAYLEQDLPSADE-L-TVYDVVASAFENLGECLTAYRQLSMTASDT
H8W713_MARHS          TPDGGVVRLEDGSVLSVLPQSLPSDDT-R-TAYDVVASAFPETGDLLAEFHRLSQRADE-
M1WYT7_PSEP2          SPDGGSVDYARGARVALLPQEVPHDLG-G-TVYDVTAQGLGEIGKNLSTYHSAARSLSLE
A0A3A4SF11_9DELT      VPDHGEIFRQPGIRIASLPQEIPSDLH-G-TIHEIVVSGLENNGLTALAAGHEAGD----
A0A090AI32_9GAMM      NPDQGQIERQPHCKIARLSQHPELNSN-D-TIFQAVAGCLGEVGKQVQEYHDLAQCLAQS
A0A1A8TSW9_9GAMM      IPDEGVVRIEGGMKIAQLPQELPDANE-K-TVREVVSEGAGQAHHLMKRYFSLLEDFEN-
A0A1E2VA67_9GAMM      HSDDGHIWRKPELKIGTLPQVLPAADE-R-TVYQVVAEGLAEAGALLEEFHRLTHQAEH-
G8PYZ1_PSEF3          KPDDGSVWRAPGLKIGELPQELPVADE-R-TVFDVVAEGLDGVGALLAEYHHLSQNIVTD
L0E228_THIND          HPDSGESTRTDGLVTAYLTQELPEDVH-G-SVFDVVADGLGENGRLLERYHHLSLEAAQG
A0A1V5D8U4_9DELT      FPDTGKIVRHGDVRTAILPQDIPQGLT-G-RVYDVVASGGLEHAELLREYHELTLRVAGR
A0A1S7LIS0_MAGMO      TPDEGEIATSKGLQIAHMVQEVPGALD-G-TVFDVVAGGLGESGLLLADYHRAVVQ----
B5JVV0_9GAMM          QADDGEIEHAPTLKVARLVQDVPTDVE-G-SLFDVVAQGLGDMGEWLKQHAHAVQRLSAG
Q74EP9_GEOSL          PPEGGEIMRQQGVRVALVSQEVPRDLE-G-TVFDVVAQGMGEATALLAEYHRVSHLLAVE
A0A2U8E0M9_9BACT      QSDTGVVSRQPGARFARLTQEIPADVR-G-IIHDIVSSGLAEVAH---------------
A0A496ZBP1_9DELT      IPDSGDVWRQQGVSVAALEQDVPAEFD-G-TIFDVVAEGLGKTGRALVEHNRICRQTETR
A0A2U3K0D5_9DELT      APDDGEIVYQQGLRVSFLPQEVPQEMT-G-TVLGIVVAGLGGPQTAL-------------
                          *            : *                                        

UUP_CAUVC             ----------------------------TAGGAQDYEAQAALADFGLDPDKSAKGLSGGE
A0A2E2VQ33_9GAMM      S-------D---SWAERLGKLQSEIEH-QDGWDLVNRIQQIFNSFNVNENTLVNELSGGQ
A0A3A1YQ40_9PAST      H-------SP--ELAARISQLEAEIST-HDYWSVESKIIAVMEQLGIPVDAKLSSFSGGW
UUP_BUCAI             ------------------------------------KIEKIIELIKLNKNTLLSHLSGGL
R5EZ17_9GAMM          ------------EAPHEQLELSAFIES-HDGWVKDAVVRKILNRIGLAPELELKSLSGGN
A0A316FQY6_9GAMM      ------------GSESEINQLHDLLDR-TNGWQWQQKVDKVLTRLNLDGDVLLSTLSGGW
A0A2E6LWH3_9GAMM      ------------PDPIEMTKVQQAIEA-QDGWDIDVKIQRVMTQLSLPAQEKLGDLSGGW
A0A1Z9UKG1_9GAMM      ------------XRXAEMEXLQXDIET-HGGWDLETQVESIISNLELPGSKMLSELSGGW
A0A2E3YKV6_9GAMM      G-----------GSAQELEKLEAAIEV-SGGWSVDVQINSIISRLQLPADKPMCELSGGW
A0A2E9D7P8_9GAMM      ------------HGLRELEQLQRQIDA-RGGWNIDQQVEKVLSELGLPANEKLAFLSGGW
A0A4Z0WFB0_9BACT      ------------PESKAVERLQQWLDD-HMAWNLEQRAESALTQFELQADTRLSELSGGW
A0A0Q9YA56_9COXI      DE----------AWMNQVHDLQKKIEH-LDGWQIQLRIEKVIQALSLPADAKMSALSGGW
A0A1Z8RH18_9GAMM      ------------PDMNLMDRLQQQIER-DDGWNIDHRIMATIDRLGLIPSETLMHLSGGW
A0A1G0H206_9GAMM      V-------SE--KLLAEQATLAQKIDA-CDGWSFDQKIQTVLSKLDLKGHDEITALSGGL
C6YXE5_9GAMM          ------------PESNELEKLHSYIDE-NHGWSYLNDVEVLASKLNLDSQAYFKDLSGGM
A0A2H0DA36_9GAMM      T-------Q---SELNQFEELQHIIEQ-NDGWTLSNRINQTLQLFQMEAETLLSALSGGW
A0A2E9ZAS5_9COXI      ----------------------------EAAWQSTHTVDRIIQELQLNPQSQLSDLSGGE
A0A1W6LNA1_9BACT      E-----------EETEVLHRLTEEIDS-AGGWKIQTQAEAAASKLELPLQSSFSSLSAGM
A0A1Z8QGI1_9PROT      QSH---------EEYIQLEKTQQKLES-LGGWTTKQRVEKILSRLKLNFTADFSSLSGGI
A0A0W0VWK2_9GAMM      ------------SDTSALAHCQQQMDH-LHAWDLLPRVEMMASRLGVDTQAKMSKLSGGM
F2B9M7_9NEIS          PATEGSPFGKNSELAAEMNALQNQIEA-QNGWQFDAAVRQTIGELGLPENETIANLSGGQ
N6YE33_9RHOO          A-------TP--EALARLDVLQHQVEV-AEGWRLNQRVEHMLARLGLDPAASVSSLSGGG
A0A1Q2MIS2_9BACT      --------HDEPGHLEKLEKLAARIEA-CGGWSLEKKVEATVSKMRLEAEALFDSLSAGL
A0A2A4UL14_9GAMM      --------ALNQSLLDELEVLQKHIED-NGGWEIGQKVDAALSRFDLDGNAMFASLSGGL
B5JQK7_9BACT          ---------------------HDHLDP-ERQWQMEARIEQTLKDLQLDPDARFPTLSGGL
UUP_ECOLI             PSE---------KNLNELAKVQEQLDH-HNLWQLENRINEVLAQLGLDPNVALSSLSGGW
A0A1U6GNG6_9GAMM      DM----------DACERMADLQHDIDA-VHGWDLEREATRLITTMGLDPEDDLSSLSGGR
Q7UGS0_RHOBA          ------------GLGTALGPTDHGT---WEPWEIEQKIEETLSRMNLDPATAFESLSSGM
A0A1F7F2Y7_9BACT      ------------SDPAMFQELQHELDT-HDGWQIQTRVERVLDQVQVKPDLEFSALSGGL
R4YLW5_OLEAN          ------------VDLVKLERLQHVIEA-NDGWLWQQKVDSILDRLDLPGDAAFDSMSGGW
A0A1C9W9F0_9GAMM      ------------------EDLQERIEA-AHGWDLLPRIDSIIDRLGLDESAVVADLSGGW
A0A2N1TGV2_9SPIR      ---------------------DDHLDT-HQEKHKHTQTDRILSLLSLDPEPRFETLSAGM
A0A2E2HCR1_9GAMM      ------------QNLDRLADLQKRIET-ANAWNLQQKVDSVLSKLDISGDTLMSSLSGGW
F3LGW8_9GAMM          ------------ASLNELARLQQIIET-QDGWVLQQTIESTLSRFSLDPDVTMGSLSGGW
H8W713_MARHS          ------------SSLERLMKVQERLES-LDGWRLDQKVTTILGQYGVGPDRVLNTLSGGW
M1WYT7_PSEP2          K-------GDHEALLTQMEKAQHALEE-SGGWPHHQTIETVLSHLKLDGEEIFDSLSGGT
A0A3A4SF11_9DELT      ----------------------------EDAWKRLAHVDKTLTQLNLSPGLKFETLSAGM
A0A090AI32_9GAMM      HDE---------PLLKQLENVQHRLEA-NDGWRLEQRVETVLSKLNLPTEQSVADLSGGW
A0A1A8TSW9_9GAMM      ------------DHSHELGEIQAELDK-IQGWDLEQRVNHMVQRLRLPAEKLMSELSGGW
A0A1E2VA67_9GAMM      ------------VDLKRLEQLQHQLEA-IDGWNLQKRVEQMLKRLQLDANTLMASLSGGW
G8PYZ1_PSEF3          ------------ADLDKLMHVQHDLEA-RDGWRLQQLVDSTLSRLQLPADKTLAELSGGW
L0E228_THIND          GT----------AALEAMGRVQAELEA-IDGWALQNRVETTLSRLELPPDQPFAELSGGL
A0A1V5D8U4_9DELT      AHDA--------DLLGKLERVQHQIEA-SGAWHYHQRVKKALARTELDENAEFEVLSAGL
A0A1S7LIS0_MAGMO      ------------GDADNMASLHEKIEATEDGWSAQQRIEEALSRLKMDGEQPFAHLSGGL
B5JVV0_9GAMM          DD----------SAMKDLERAQSHIEA-GDGWQVNQHVETVLSRLSLDPEQNFEALSGGM
Q74EP9_GEOSL          G-------GE--GLLAQLATLQKRLEE-TGGWHLHQEVERVLNRLSLDADAPFSSLSGGT
A0A2U8E0M9_9BACT      ----------------------------EESWERELRLEKLLERMSINPRADFAALSGGL
A0A496ZBP1_9DELT      V-------TP--QLAKRRDELQHMLDV-GNGWELLTGVENILSRTRLNPENLFADLSAGL
A0A2U3K0D5_9DELT      ----------------------------SGARTRLNLAERTISRMELEPGERFETLSTGL
                                                                    :        :* * 

UUP_CAUVC             TRRAALARAFAEQPDVLLLDEPTNHLDIFAIQTLEDELAASKC-AALIVSHDRAFLNRVT
A0A2E2VQ33_9GAMM      IRRMAILKALARQPDILVLDEPTNHLDIDSIEWLEKQIADYQG-TVIFISHDRAFTAKLA
A0A3A1YQ40_9PAST      LRRIELAKAFVANPNVLLLDEPTNHLDISSIQWLEQVLQGFPG-AVVFISHDRSFVDNMA
UUP_BUCAI             LRKVALGRVLVREPDILLLDEPTNHLDMKTIKWLETFLKKFSG-SILFVSHDRNFIQNVS
R5EZ17_9GAMM          RRKVALAAALASEPQLLLLDEPTNHLDIESIAWFEQELKNFNG-TLVFVTHDRFFANNCA
A0A316FQY6_9GAMM      RRRVSLAECLAAEPDLLLLDEPTNHLDLDTIEWLEESLKQYKG-ALLLISHDRQFIDAVV
A0A2E6LWH3_9GAMM      QRRVLLGKALVSNPHLLLLDEPTNHLDIATIEWLEGHIMSCGA-SIVFITHDRSFLRKLA
A0A1Z9UKG1_9GAMM      RRRVGLARTXVSKPDVLLLDEPTNHLDLQAIQWLEQRILGYGG-SVIFITHDRAFLKSXA
A0A2E3YKV6_9GAMM      RRRVAVARALVAKPGLLLLDEPTNHLDINTIEWLENEVRKFDG-AVLFVTHDRGFVESLA
A0A2E9D7P8_9GAMM      RRRVALGRALVSQPDLLLLDEPTNHLDLATIRWLEDRIYAWPG-AVVFITHDRAFLQKLA
A0A4Z0WFB0_9BACT      RRKALVARALILDPNVLLLDEPTNHLDIKSIEGLENWLRDFRG-LVIFISHDRQFIDAVA
A0A0Q9YA56_9COXI      RRRVALGAALVQEPDILLLDEPTNHLDLAAIQWLEGLLLNYPK-TIIFITHDRALLRKIA
A0A1Z8RH18_9GAMM      LRRVAIARSLAADPDLWLLDEPTNHLDIPAIQWLEGVISDFQG-TAMVISHDRRLLDRVA
A0A1G0H206_9GAMM      KRRVLLARALVNDPDILLLDEPTNHLDIDAVLWLESFLKKYTK-TIILITHDRNFMSNLA
C6YXE5_9GAMM          KRRVILARALIKKPDLLLLDEPTNHLDIDSISWLEEFLSGFAG-AILFITHDRKFLNNVA
A0A2H0DA36_9GAMM      KRRAALAKAVITNPDVLLLDEPTNHLDVESIEWLESFVKDFNG-TVVLITHDRHFMDKVA
A0A2E9ZAS5_9COXI      IRRCLLAQALIQEPDVLLLDEPTNHMDMPTIQWLENYLIQSQL-TCILITHDRSFLQQVA
A0A1W6LNA1_9BACT      KRKVLLARALAGSPDLLLLDEPTNHLDIDSIRKVEELLLSSQA-ALLFITHDRAFLRRLA
A0A1Z8QGI1_9PROT      KKRVLXARALVLEPDILLLDEPTNHLDXDSIEWLEQFLKTNKA-SMVFITHXRSFLKSLA
A0A0W0VWK2_9GAMM      KRRALLAAALIVSPDLLLLDEPTNHLDVNAIEWLESYLKTYSG-SVLVVTHDREFLSQVA
F2B9M7_9NEIS          KKRVALAQAWVQKPDILLLDEPTNHLDIDAILWLENLLRGFSG-SLIVITHDRRFLDNVA
N6YE33_9RHOO          VKRVALARALVAEPDLLLLDEPTNHLDLDGILWLEGLIREFRG-AVIVITHDRVFLDNVA
A0A1Q2MIS2_9BACT      KRRVFLARAIINDPDVLLLDEPTNHLDVESVEYLEKFLLASTQ-TIIFVTHDRAFLRKIA
A0A2A4UL14_9GAMM      KRRVLLAQVCVTEPALLLLDEPTNHLDIRAIEWLEEFLLNYKQ-SILFVTHDRAFLQNVT
B5JQK7_9BACT          KRRALLGKALVCEPSVLILDEPTNHLDIDSILWLEDFLIGSKL-TLLFVTHDRSFLKRLA
UUP_ECOLI             LRKAALGRALVSNPRVLLLDEPTNHLDIETIDWLEGFLKTFNG-TIIFISHDRSFIRNMA
A0A1U6GNG6_9GAMM      KRRVLLARSLVTKPDVLLLDEPTNHLDVDSIEWLERFLLDWQGLTLLFVTHDRAFVNKLS
Q7UGS0_RHOBA          RRRVLLARAIASEPDMLLLDEPTNHLDIQSIIWLEDFLSRWSG-TLMFITHDRSFLQSLA
A0A1F7F2Y7_9BACT      RRRVFLARALVREPDLLLLDEPTNHLDLDSIAWLESFILNSGL-TVLFVTHDRRLLKRLS
R4YLW5_OLEAN          QRRVMLAQALVSEPDLLILDEPTNHMDIATIRWLEEQLVQFKG-TLLFISHDRAFVQALS
A0A1C9W9F0_9GAMM      QRRAALARALVTEPDLLILDEPTNHLDITAVEWLEGFLAGFTG-ALLFVTHDRALAQRLA
A0A2N1TGV2_9SPIR      KRRVLLGRTLVNDPHILLLDEPTNHLDMDSIEWLETFLSRYEK-TVFFVTHDRMFLQKIA
A0A2E2HCR1_9GAMM      LRRVSLAKAFVSEPDVLLLDEPTNHLDIPTIEYLEKQLAQFKG-AIILITHDRVFLQKIA
F3LGW8_9GAMM          RRRVLLAKALVIDPELLLLDEPTNHLDIHSIEWLEQQLATFTG-ALVVISHDRHLLQQLG
H8W713_MARHS          QRRVLLARALVADPDILLLDEPTNHLDVPAIAWLEEALSQFRG-AMLFVSHDRAFIRRMA
M1WYT7_PSEP2          KRRTLLARALVSNPDLLILDEPTNHLDIESITWLEDFLLRQNA-ALLFVTHDRAFLKRIA
A0A3A4SF11_9DELT      KRRVLLARALAGAPDMLLLDEPTNHMDIPSIDLMESILTKFAG-TLVFVTHDRAFLEKIA
A0A090AI32_9GAMM      QRRVALAQALVIEPDLLLLDEPTNHLDIDAITWLEEVLLEWLG-GLLFVSHDRQFMQRIA
A0A1A8TSW9_9GAMM      RRRVILAQALISNPDILLLDEPTNHLDVPTIEWMEQQLQQFRG-LILFITHDRRFLEKLA
A0A1E2VA67_9GAMM      RRRVALAKALVSEPDLLLLDEPTNHLDIDTIQWLEEQIKQFPG-AVMLITHDRAFMQAVA
G8PYZ1_PSEF3          RRRVLLAQALVSEPDLLLLDEPTNHLDIGAIAWLEEALKDFQG-AVLFITHDRSFLQNLA
L0E228_THIND          RRRVWLARELVRNPDLLLLDEPTNHLDIAAIAWLENMLAGTAM-TMVFITHDRGFMERLA
A0A1V5D8U4_9DELT      KRRVFLARALVSEPDLLLLDEPTNHLDINTIIWLEDFLLRYEK-TLMFVTHDRAFLQRLA
A0A1S7LIS0_MAGMO      KRRALMARAVVSQPDLLLLDEPTNHLDIPSIEWLEGFLKSYRG-TLLFITHDRRFLRALA
B5JVV0_9GAMM          KRRVLLAQALVTQPDILLLDEPTNHLDIDSIRWLEDFLAQYEG-TLVFITHDRAFLRRLA
Q74EP9_GEOSL          KRRALLARALVSAPDILLLDEPTNHLDIDTILWLEEFLAKNVT-TLLFVTHDRAFARRLA
A0A2U8E0M9_9BACT      KRRVLLARALASQPDLLLLDEPTNHLDLESILWLENFLLNEKI-SLFFVTHDRAFLRRLA
A0A496ZBP1_9DELT      KRRTLFARSLAGKPDILLLDEPTNHLDIDTIIWMEDFILRHVK-TLLFITHDRTFLKKIA
A0A2U3K0D5_9DELT      KRRTMLARGLVSEPDVLLLDEPTNHLDIDAIAWMEEFLLRFEG-TLLFVTHDRRFLKKLA
                       ..          * : :*******:*   :  .*  :        ..::* * :     

UUP_CAUVC             ERCFWLEHRKIRRLD-----KGFSEFEAWAESIMAADAEEARRLDKVLERENAWLARGVQ
A0A2E2VQ33_9GAMM      TKVWDLDRTVLTVYD-----CGFNDYLQRKQEALEREEVEQEKFNKLLAQEEAWIRQGVK
A0A3A1YQ40_9PAST      TRIVELDRGHIYEHP-----GNFAAYLKNRDKRLEDERNQNALFAKELAKEEAWIRRGIE
UUP_BUCAI             TRIIDLDRGKLVSWP-----GDYENFIKLKNESYRIEKIQKQLFDKNLEKEEQWIRKGIK
R5EZ17_9GAMM          TRIVELDRGKLYSYP-----GSFKRYIELRDERLRKEELANAEFDKILAQEEAWIRRGVK
A0A316FQY6_9GAMM      SKVWEIDRGIISVFP-----APYDAYVESKEKQLSDETKTNSEFDKKLANEEKWIRQGIK
A0A2E6LWH3_9GAMM      TRIIELDRGRIWSWE-----GNYDQFVIAKEQALHNEKVENKEFDKKLAKEEVWIRQGVK
A0A1Z9UKG1_9GAMM      TRIVDIDRGQLKSWP-----GDYGHYLKKKDEVLTEEERKNSLFDKKLASEEKWIRQGIK
A0A2E3YKV6_9GAMM      TRIIEIDRTQLRSWP-----GGYKDYLKQKAKANQEEDRKNKLFDKKLAEEEVWIRQGIK
A0A2E9D7P8_9GAMM      TRILELDRTKLNSWE-----CDYETYLRRKEKALLDEREGNTRFDKKLAEEEAWIRQGIK
A0A4Z0WFB0_9BACT      DHIIELDRSTLHRYP-----APYETFLAAREDRLRIEAEQNAEFDRRLKAEEVWIRQGIK
A0A0Q9YA56_9COXI      TRIVELDRGKLTSFP-----PEYDVYLQRKEQMMMEEERHNALFDKKLSDEEQWIRQGVK
A0A1Z8RH18_9GAMM      SAVVDIDRGRVTRWD-----VGYQRFLERRTHELEVEERNAKLEDARLAQEEAWIREGVK
A0A1G0H206_9GAMM      TRIIEIDYQNLFSWP-----GNYAHYCQLKEELIVAQEREQALFDKRLSDEEVWIRQGVK
C6YXE5_9GAMM          KSIIELDRGHLYSFD-----GNYTKFLEKKEQILDAQDKANSEFDKKLAQEEAWIRQGIK
A0A2H0DA36_9GAMM      TRILELDRGILTSFP-----GNFSEYTKRKEQMLHAEEQANALFDKRLAQEEVWIRQGIK
A0A2E9ZAS5_9COXI      THIAELDRGELTTWT-----GDYQSFLVHKSQQLEAEERANALFDKRLAQEERWIRQGIK
A0A1W6LNA1_9BACT      TRILELDRGILRSYE-----CSYDEYLARKKQLLDAEQIHQKQFDKKLAEEEAWIRRGIQ
A0A1Z8QGI1_9PROT      TKIIEIDRGTLFIYE-----GNYDGYIASRDKRWGDEQTHXTLFNKKLAQEEIWIRQGIK
A0A0W0VWK2_9GAMM      NRIVEIDRGKLYSYE-----CDYETYLDRREAMRLSEQKQNELFDKRLAEEEAWIRTGIK
F2B9M7_9NEIS          TRIVELDRGTLRSYP-----GSFARYSEKKAEELAVEAEHNRLFDKFHAQEEAWIRKGIE
N6YE33_9RHOO          TRIIELDRGRLASYP-----GRFSDYLRRKAEELEAEDKAAARFDKFLAQEEVWIRKGVE
A0A1Q2MIS2_9BACT      TQIVEIDRGRLISYE-----CNYDEYLRRRDAAIEAELANNQRFDKLLAQEEAWIRRGIQ
A0A2A4UL14_9GAMM      TRIVELDRGVFSSWP-----GDYENYLQIKAHRLETELVQNAKFDKKLAEEEKWIRQGIQ
B5JQK7_9BACT          TRIVEVDLAQLNSYR-----CDYETYLTRKEELLEIEAKNRAAFEKKLSQEEAWLRKGIK
UUP_ECOLI             TRIVDLDRGKLVTYP-----GNYDQYLLEKEEALRVEELQNAEFDRKLAQEEVWIRQGIK
A0A1U6GNG6_9GAMM      TRIIELDRGQLTSYDVTQGEGGYARYQELKELQLLAEEKNNANFDKKLAQEEVWIRQGIK
Q7UGS0_RHOBA          NRIWEIDRGRLFDWT-----CDYQTFLQRKAAALDAEEKQNALFDKRLAEEEVWIRQGIK
A0A1F7F2Y7_9BACT      THIIELERGRAISWP-----CDYPTFLTRKQAVLDIEEKEWARFDKKLAQEEVWIRRGVK
R4YLW5_OLEAN          TRIIELDRGSIYSWK-----GTYQGFLEHQEHRLAAEEVQNALFDKRLAEEEVWIRQGVK
A0A1C9W9F0_9GAMM      TTVWDLDRGHLRVFN-----CSFDRYQQEKEKLLEEEARHEALFDKKLAQEEAWIRQGIK
A0A2N1TGV2_9SPIR      NRIIELDRGKLYDWK-----CDYKTFLQRKEAWLESEETQNALFDKKLAAEEIWIRKGIK
A0A2E2HCR1_9GAMM      NKIMILDRGEISAWE-----CSYQRFLELREQQLAAEDKANSEFDKRLAQEEVWIRQGIK
F3LGW8_9GAMM          NRIAELDRGYIWFYN-----GSYHDFLEGKEKRLEEEARHHALFDKRLAEEEVWIRQGIK
H8W713_MARHS          TRVVELDRGQLVSFA-----ASYDRYLELKEKALEEEERQNALFDKRLKQEEAWIRQGIK
M1WYT7_PSEP2          TRIIELDRSRLFNWD-----CDYATYLKRKEADLEAEAKQNHNFDRKLAEEETWIRQGIK
A0A3A4SF11_9DELT      NRIIEIDTGRMTSWD-----CGYAAYLERKAELVGVEAEHNHQFDKKLAIEEAWIRQGVK
A0A090AI32_9GAMM      TRIIELDRGQLTSYP-----GDYATYLERKQAALSAEITQAAKFDKHLAQEEVWIRQGIK
A0A1A8TSW9_9GAMM      NRIVELDRGNLISFT-----GNIHEFLVFKEKLLEEEERANALFDKRLAEEEVWIRQGIK
A0A1E2VA67_9GAMM      TRMIELDLGQITSWE-----GRYLEFLDWKQHQLEIEARHQAEFDRRLAQEETWIRQGIK
G8PYZ1_PSEF3          TRILELDRGGLIDWN-----GDYASFLVHKEAALAAEETANALFDKKLAQEEVWIRQGIK
L0E228_THIND          TRIVELDRGQLYEHP-----PSLEALRQRQAERLETEVRQNAEFDKKLAQEEAWIRQGIK
A0A1V5D8U4_9DELT      TRIVEIDRGRLASFP-----SDYRTYLDRRQVLLDAEERRWNEFDKKLDKEEIWIRKGIR
A0A1S7LIS0_MAGMO      TRIIELDRGNLTSWP-----GNYDTYLRDKAAWLEAEEKQNALFDKKLAQEEAWIRQGIK
B5JVV0_9GAMM          TRIIELDRGQLTSWP-----GSYDKYLAGKQAALDAEEKANAEFDKKLAKEEAWIRQGIK
Q74EP9_GEOSL          NRVAELDRGRIYAFA-----CGYDEFVERREALLEAEITRQALFDKKLAQEEAWIRQGIK
A0A2U8E0M9_9BACT      TRIVELDRGIITNWD-----CPYDTYLARRQERLEAEERQMAAADKKLAQEEEWARRKPS
A0A496ZBP1_9DELT      GRILELDRGRLVSYG-----VDYATYLKGKQAALEVEDVQNGVFDKKLSQEEAWIRKGIK
A0A2U3K0D5_9DELT      TRTVELDRGRLIDWS-----CDYETFLMRRQAALATEAVHRERFDDKLAREEVWVRQGIK
                           ::                             :             *: *      

UUP_CAUVC             GRRARNEGRRRALLALRAEKKDRQSELRGTMTMAVESAGT-SGKRVVEAKGVTKRFG---
A0A2E2VQ33_9GAMM      ARRTRDMGRVGRLLEMRKQKAQFI-KQLGSAKFDIKQGEI-SGKLVYELKNIDFFLG---
A0A3A1YQ40_9PAST      ARRTRNEGRVRALKAMRVEAQNMR-KLTDFGEVKVTTSRS--GKLVFELDNVGLTLG---
UUP_BUCAI             ARSTRNEGRVKKLKILQKEQKDYK-KIEKINNIEINQSKNYLGKIIFKLDNIDFLVN---
R5EZ17_9GAMM          ARLARNEGRVKDLEERRKIRASRR-DRMGNVIMEANSAQR-SGNLVFEIKDLNISFG---
A0A316FQY6_9GAMM      ARRTRNEGRVRALKKMRQQHAERR-TRQSTAQLNVKSGGQ-SGKLVAVLENATLTRG---
A0A2E6LWH3_9GAMM      ARGTRNQGRVKDLMELREVAAARV-KPQGKVKLHIEESEP-SGKTVIELKRVSHQFESAH
A0A1Z9UKG1_9GAMM      ARRTRNEGRVRSLKKMRSEYEQRI-KPDGKARIHLQDSDK-SSRRVIQGKNLSYDYG---
A0A2E3YKV6_9GAMM      ARESRNEGRVRSLELLREERSKRV-ARGRSARIHINESQQLSGKKVIEVRGVTHGYD---
A0A2E9D7P8_9GAMM      ARRTRNEGRVRALETMRKEAATRL-KREPGAHISIDEADQ-SGRKVIRMRNVSYSYD---
A0A4Z0WFB0_9BACT      ARRTRNEGRVRRLQALRQQRAERR-EVGGSARMSLAEAER-SGRLVFELKDLSFSYP---
A0A0Q9YA56_9COXI      ARRTRNEGRVRALIALREERSQRR-TIKEKPKFEINEAIT-SGKTVIQAENVFFGYP---
A0A1Z8RH18_9GAMM      ARRTRNEGRVRALMEMREERKKRR-ERE-TLNMEIDAARK-SGRIVKELEHISKSFD---
A0A1G0H206_9GAMM      ARRTRNEGRVRRLEALRKEKSEQF-KQQGKSKIHIQSDTQ-SGKVVFNIEDLSFAYA---
C6YXE5_9GAMM          ARRTRNEGRVRALEQMRRDRQQRR-ENVGKADIKVAEAGK-SSRKVIQANNIGFEYD---
A0A2H0DA36_9GAMM      ARRTRNEGRVRSLEAMRLERSKRR-NQQGKASFKIEDAQK-SGRLVLDFENVSFAWE---
A0A2E9ZAS5_9COXI      ARRTRNEGRVRALKQMRYERAQRR-EQRGQVNLNTQQQAH-SGKQVCVADNISIQLD---
A0A1W6LNA1_9BACT      GRRTRNEGRVRELQKMREERRERT-SPEGSAKLNLQQAEA-SGMLVSDLKNVSFSYD---
A0A1Z8QGI1_9PROT      ARRTRNEGRVRDLVKLRREYQDKR-NHQGKVKMVISDADK-SGKIIVEVENLGVNLS---
A0A0W0VWK2_9GAMM      ARRTRNEGRVRALKAMREQYKARR-EQLGKMQGLTLDVTR-SGEIVLEAKHLNYQIS---
F2B9M7_9NEIS          ARRTRNEGRVRRLEELRRQRAARR-ERQGQVSFRLDAGEK-SGKIIAELEHASFDYG---
N6YE33_9RHOO          ARRTRNEGRVRRLESLRRERAERR-DRLGDVSLAVDRGEK-SGQMVAELTQVTKRYG---
A0A1Q2MIS2_9BACT      GRRTRNEGRVRNLIELRNQRSQRR-NIQGKAKISIQDSQQ-SGQLVAQFTDVSFRYP---
A0A2A4UL14_9GAMM      ARRTRNEGRVRALKRLREERRVRR-NVKGNVSLNFQTEEK-SGKLVVDAKAVGYSYQ---
B5JQK7_9BACT          ARRTRNEGRVLALKKMRDERKSWR-TRSGAASFSLQQSNT-SGAKVITALQATVSYG---
UUP_ECOLI             ARRTRNEGRVRALKAMRRERGERR-EVMGTAKMQVEEASR-SGKIVFEMEDVCYQVN---
A0A1U6GNG6_9GAMM      ARRTRNEGRVRDLKALREERGERR-EQVGNVNITMGQGEK-SGKLVCKVKNLHLQYD---
Q7UGS0_RHOBA          ARRTRNEGRVRALKAMRNEANQRR-SLEGKAKLNLQVAER-GGALVTKLDNVSFTYP---
A0A1F7F2Y7_9BACT      ARRARNEGRARALYSMREERRKRR-ERVGSVSMTISEANR-SGVRVLEAKHISFAYQ---
R4YLW5_OLEAN          ARRTRNEGRVERLKEMRNQRSDRR-ERQGSVSLSMNSTES-SGKNVFELENVSFGFD---
A0A1C9W9F0_9GAMM      ARRTRNEGRVRALQALRRQREARR-NRQGTARMALDAGEL-SGKLVAELKHVSFGYP---
A0A2N1TGV2_9SPIR      ARRTRNEGRVRELEKMRRDRSLRR-EQQGSVKMEIQQTER-SGKLVIEAENISFGYG---
A0A2E2HCR1_9GAMM      ARRTRNEGRVRALEAMRKEFSQRR-KSQGKAKLNLNEAEQ-SGKLVIEAENIRHSFD---
F3LGW8_9GAMM          ARRTRNEGRVRELEKMRNERQQRR-EVQGKSSFVIDKGES-SGKLVFEVDNLRFRWQ---
H8W713_MARHS          ARRTRNMGRVRALKAMREEHRQRR-VRGGTASFAVEQADI-SGKLVAEASNAGFSYV---
M1WYT7_PSEP2          ARRTRNMGRVRDLIKMREEHTARR-ERTGSVKMVIQDAER-TGKLVVEASHICFGYE---
A0A3A4SF11_9DELT      ARRTRNEGRVRALMQLRQERQNRR-TRAGSAKMELQEAER-TGKLVLEAAEVSFAWD---
A0A090AI32_9GAMM      ARRTRNEGRVRSLKKLREERAQRR-EQQDKVRLNLDKGEL-SGRIVIVADDISKNYG---
A0A1A8TSW9_9GAMM      ARRTRNEGRVRALKALRQERSERI-NRQGNAKMAIETKDK-SGKLVAEFTQVGHAFE---
A0A1E2VA67_9GAMM      ARRTRNEGRVRALKAMRQERAARL-KRQGKAEIQIESADR-SGKLVAELTDVSVDYG---
G8PYZ1_PSEF3          ARRTRNEGRVRALKALRMERSERR-ERTGKANIQLDTADK-SGKQVMVLENVSFAHP---
L0E228_THIND          ARRTRNEGRVRALERLRQQRAERH-ERQGQVRLALKPEQR-SGRRVIEAERASFGYD---
A0A1V5D8U4_9DELT      ARRTRNEGRVRALLKMREERARRR-EQAGVARLAIQEAER-SGRMVVDAETISFAWD---
A0A1S7LIS0_MAGMO      ARRTRNEGRVRALKQLRVERTQRR-EKAGNVKMLISEASR-SGRLVVEAEGVNYAYH---
B5JVV0_9GAMM          ARRTRNEGRVRALKQLRQERLQRR-ERSGTASLKMSQADL-SGKIVIEAEDIHYAWN---
Q74EP9_GEOSL          ARRTRNEGRVRALKKLREERRQRR-ERQGTATIRLQEAER-SGALVVEAENASVGYG---
A0A2U8E0M9_9BACT      AQRKRSGARLEALAAMRAERLARR-ERTGNASMRLAEADR-SGVKVVEAEEMSFAYP---
A0A496ZBP1_9DELT      ARRTRNQGRVRSLQKMRAAHQARR-RKTGNVRLQVQDAER-TGKLVLDARKVSFSYG---
A0A2U3K0D5_9DELT      ARRTRNEGRVRELEKLREARRARR-ELIGSVRLKTQDTAN-SGKLVIEAEGVSYGYS---
                      ..  *. .*   *   .                         .  :              

UUP_CAUVC             -----------ERTIVENFSTRILRGDRVALVGPNGAGKTTLVKLLLGELERD---AGTV
A0A2E2VQ33_9GAMM      -----------ENCIAKDFSALVTRGDRIGLVGPNGVGKTSIIRCLTESLPID---SGKR
A0A3A1YQ40_9PAST      -----------NKEIFKDFTYRVAAKNRIAIVGDNGCGKSSLIKVLLQELPAT---TGHV
UUP_BUCAI             -----------NKIIIKNFSSIIQHGDKLALIGDNGCGKSTLIKIIIGENKPQ---KGKI
R5EZ17_9GAMM          E----------KS-VIKDFCATVMRGDRIGITGPNAAGKTTLIKALLGQIKPT---SGKV
A0A316FQY6_9GAMM      D----------KI-LFQNYSTSVIKGDKIGVLGPNGCGKSSLIKMILGELEPD---SGTV
A0A2E6LWH3_9GAMM      G----------QK-LLDNFSLKIRRGERIGIIGNNGVGKTTLLRILLGQLDPN---DGIV
A0A1Z9UKG1_9GAMM      E----------NI-IIQSLSIKIMRGDRIGLIGNNGVGKSTLIKLLLGTLTPK---SGTI
A0A2E3YKV6_9GAMM      G----------EN-LLKDFSLKVVRGERIGIIGNNGIGKSTLLRILLGELEPN---LGSV
A0A2E9D7P8_9GAMM      D----------AS-IVKNLTLTVMRGNRIGLVGNNGVGKSTLLRLMLGELKPA---TGTV
A0A4Z0WFB0_9BACT      E----------RP-IVSHFSTEVMRGDTVALLGPNGVGKTTLVRLLLGQLEPD---SGQV
A0A0Q9YA56_9COXI      G----------RKALIKDFSFTIQRGDKIAIVGQNGTGKTTLVKLLMGLLEPT---AGTI
A0A1Z8RH18_9GAMM      D----------QR-ILNDLDLVIQRGDRIGLMGPNGTGKTTLIRTILGEEVPD---DGHV
A0A1G0H206_9GAMM      D--------KNNKKIIRHFSSIIGRGDCVGIVGQNGAGKSTLIKLLLGDLSPT---SGTI
C6YXE5_9GAMM          G----------KF-LFKDFSTEIQKGDKIAIIGQNGCGKTTLLNSLLGLDKPT---QGNV
A0A2H0DA36_9GAMM      K----------NKPIIQNFTNLFMRGDKIALIGANGCGKSTLIKLILDEIQPT---AGCI
A0A2E9ZAS5_9COXI      G----------KT-IIKNFSCIIQRKDKVGIIGHSGCGKTTLIRCLLGQLQPD---QGIV
A0A1W6LNA1_9BACT      G----------KTNIVTDFTAKFFRGDRIGIAGENGVGKSTLLKLILGELEPS---SGRV
A0A1Z8QGI1_9PROT      G----------KI-LFKNFSCVIQRGDKIGIIGANGVGKTTLIKVLXGQIKPN---NGSI
A0A0W0VWK2_9GAMM      G----------KT-LINDFSLLLTRGDKIGIIGPNGCGKTTLIRLLLGELKPD---SGTL
F2B9M7_9NEIS          G----------KP-IMRDFSAVIQRGDKIGLIGPNGIGKTTFLKLILGELAPT---SGKI
N6YE33_9RHOO          E----------RV-VVRDFSARIMRGDRIGFIGPNGAGKTTLLKLILGEIEAD---EGSV
A0A1Q2MIS2_9BACT      E---------TEDNIIEKFTTLVLRGDKIGVIGPNGCGKTTLLRLILGQLNPT---EGGL
A0A2A4UL14_9GAMM      D-------KGIEKTIVXDFSVRVMRSDKIGVIGRNGIGKTTLIRLLVGELAPQ---QGTV
B5JQK7_9BACT          D----------TQ-ILQPFDATIMRGDRIGVIGPNGSGKTTLLKLLLGKLAPT---TGTV
UUP_ECOLI             G----------KQ-LVKDFSAQVLRGDKIALIGPNGCGKTTLLKLMLGQLQAD---SGRI
A0A1U6GNG6_9GAMM      -----------DHVLVDNFSTTIMRGDKIGIVGPNGAGKTTLIKALLDMSDDDVIKTGSV
Q7UGS0_RHOBA          G---------TDRVIIRDFSSLIMRGDKIGIIGPNGAGKSTLLKLILGKLEPT---SGSV
A0A1F7F2Y7_9BACT      E----------TP-IIRDFSFTLMRKDRVGIIGPNGSGKTTLLNLLLGTLTPV---KGSI
R4YLW5_OLEAN          I------ANGLRKEIVRDFTSVVMRGDRIGLVGPNGAGKSTVMKLLLEKIKPE---AGTI
A0A1C9W9F0_9GAMM      QADQQGPDLAETQYLIRDLSYTLMRGDKVGLIGPNGVGKSTLIRLLLGDLEPQ---SGSI
A0A2N1TGV2_9SPIR      -----------EQDIITSFSTTILRGDRIGIIGPNGCGKSTLIRILLQDLAQR---TGTV
A0A2E2HCR1_9GAMM      -----------DKLVINDFSTRIMRGDKIGFIGANGAGKTTLLKILLGELKPD---SGKV
F3LGW8_9GAMM          E---------DKPWIIDDFSTRILRGDRIGVIGNNGTGKSTLLQLMLQQLTPT---EGKA
H8W713_MARHS          D----------GEPVVRNMDLTVLRGDKIGLVGENGTGKTTLVRLLLGELTPT---EGSI
M1WYT7_PSEP2          D----------KI-LIDNFSASIMRGDKVGLIGPNGVGKTTLLNILLGSITPH---SGSI
A0A3A4SF11_9DELT      G----------KP-VMRDFNVMVMRGDRVGIIGPNGSGKTTLLGLILKQLAPD---AGSV
A0A090AI32_9GAMM      -----------DTPLIHHFSTEIMRGDRIGLIGPNGVGKTTLLKLLLGELTPD---SGQV
A0A1A8TSW9_9GAMM      -----------DKVILNPMDFIVNRGDRIGLIGPNGCGKSTFLKILLGDLKPK---SGTV
A0A1E2VA67_9GAMM      E----------KP-IIQHLNMSVMRGDRIGLLGRNGAGKTTLLKLLLGELSPT---NGQV
G8PYZ1_PSEF3          G----------GPFLIKDFSMVLQRGDRIGLLGANGTGKTTLLKLMLGGLVPT---NGKV
L0E228_THIND          G----------VP-VIRGLDLLLQRGDRLGIVGPNGAGKTTLLRGLLGALAPI---SGSV
A0A1V5D8U4_9DELT      D----------RR-IVDGFSTTIIRGDKVGIMGRNGCGKTTLLKILLGDLKPQ---QGRL
A0A1S7LIS0_MAGMO      E----------IT-YVKNLTTTLIRGDKVGIIGPNGCGKTTLLNLLLGKLEPQ---SGEL
B5JVV0_9GAMM          D----------QA-IVQNFSTRIMRGDRIGIVGPNGSGKSTLLRLLLDKLPPD---SGTL
Q74EP9_GEOSL          D----------RA-VIANLTTTVMRGDRVGIIGPNGSGKTTLLRLLLGELEPQ---QGTV
A0A2U8E0M9_9BACT      N----------GKCIIRDLTTTITRGDKIGIIGPNGSGKTTLIKLLLGELAPT---AGTI
A0A496ZBP1_9DELT      -----------QTPIVEDFSTVIMRGDKVGIIGPNGVGKTTLLKILLKTVNPA---TGSV
A0A2U3K0D5_9DELT      G----------QKPIIDDFSTVIMRSDKTGIIGPNGSGKTTLLRVLLGDLSPE---RGVL
                                            .   :  .. * .. **::.:  :           *  

UUP_CAUVC             QLGTNLEVSYIDQARMALSDKITVWDFLTPGGGDSIIVRGHPKHVAGYAKEFLFTDAQLR
A0A2E2VQ33_9GAMM      KTGTNIIPAYYRQHAFFEDENKTPSDIVADGQ-QELDVDGRKKHVISYLGEFLFSPQRCR
A0A3A1YQ40_9PAST      HIGTNLQVAYFDQLRAELDLDKTAIDNVFDGK-VEAYVHGHVRHAIGYLGDFMFTAEKAR
UUP_BUCAI             YIGKGLKISYFDQNRSFLNPNKSIIENIDYGK-EKILLNSREQHIIRYLKNFLFKPNQLK
R5EZ17_9GAMM          RTGVNVEIQYFDQYHEGLDLEKSVADNVADGH-TEVCINGKNKHVISYLANFLFSGRRAR
A0A316FQY6_9GAMM      ELGTQLDIAYFDQMRSTVNPDLSIFDNVGEGR-DFLEVNGEKKHVISYLADYGFGPERMR
A0A2E6LWH3_9GAMM      KMGTNLHPAFFDQMRETLEMEKNVAYNVGDGK-DYIRLHGKDVHVIGYLKNFLFSPDQSR
A0A1Z9UKG1_9GAMM      KKGENLEIGYFDQLREELDPTRTVADIVGEGK-EYISINGKDRHVVGYLKGFLFSPKRSL
A0A2E3YKV6_9GAMM      KLGTHLETAYFDQLRRELDTTKTVAEIVGEGR-DYISINGTKKHVIGYLTDFLFSAKRAM
A0A2E9D7P8_9GAMM      KRGTNLEVAYFDQLRRDLDPNKSVAEIVGDGR-DYIFINGKERHVVGYLRGFLFSAKRAM
A0A4Z0WFB0_9BACT      RAGTGLEVAYFDQGRHQLDPERTVMDTVSEGR-DFIDINGQRVHIISWLERFLFSPAQAR
A0A0Q9YA56_9COXI      KHSPKNQVAFFDQNREHLVPEATVMENVAEGD-DQIEIQGRTKHVIGYLGDFLFSPAKCR
A0A1Z8RH18_9GAMM      KTGTKLEVAYFDQSREQLDPEASVIDCVAEGR-AFITINGRPVHIITYLSNFMFSKDKAR
A0A1G0H206_9GAMM      TRGTNLEIAYFDQYRLELDETQTVQDNVGLGR-EKITINGKEKHVISYLQDFLFSPERAR
C6YXE5_9GAMM          TLADNIKIAYFDQLRDQLDESLSIIDNVKEGS-DFINIDGKETHVITYLQKFLFTPERLH
A0A2H0DA36_9GAMM      KKGTNLDIVYFDQHRQSIDLEKSVQDNVAEGR-TEITLGTNRKHVVSFLQDFLFTPERIR
A0A2E9ZAS5_9COXI      TLGTQLDIAYFDQHRHSLDIDATPMDVVAEGR-SHITINGQSKHIMSYLQDFLFSPLQAR
A0A1W6LNA1_9BACT      RRGTNQKVAYFDQLHNKLDYGKTLVENVADGF-MNINFGGTSRNAVGYLKDFLFPSYRAK
A0A1Z8QGI1_9PROT      RIGTRLEIAYFDQLRNSLNENLTVLDNLSDGR-EFIQXGNSKKHVMSYLQDFLFTPERAR
A0A0W0VWK2_9GAMM      KHGTSLEVAYFDQLRRRLDEQQTVMANVAEGA-DHVTINGKQKHVASYLREFLFPPERFN
F2B9M7_9NEIS          RLGSKQETAYFDQFRSALNENDTVFYTLGQGN-DYVEIGGRKRHVMGYLEDFLFSPARAQ
N6YE33_9RHOO          RRGTRQTVAYFDQLRAQLDPELPLTEVISPGS-DYVEIGGERKHVIGYLGDFLFAPQRAR
A0A1Q2MIS2_9BACT      KTGKRLETVYFDQLHAQLEEDKSVLENVADGY-QTIIFNGKTRSVIGYLQDFLFDPKRAR
A0A2A4UL14_9GAMM      ELGTNLQVAYFDQMRSQLNQDESILDNVCEGS-DYIDVNGSQRHGLGYLQDFLFSPQQAR
B5JQK7_9BACT          EHGTKLAIAYFDQMRDQLDYEKTVFENVADGN-ETVLVNGKQRHVMTYLQDFLFTPDRAR
UUP_ECOLI             HVGTKLEVAYFDQHRAELDPDKTVMDNLAEGK-QEVMVNGKPRHVLGYLQDFLFHPKRAM
A0A1U6GNG6_9GAMM      ELGTNLKIAFFDQLRDQLDLEASVAHNVSEGS-DFVEVGGRKTHIMSYLQDFLFAPERAR
Q7UGS0_RHOBA          RLGTNLKIAYFDQLRDTLDPELTVQENVGEGS-DKIQVGNATKHIMGYLQDYLFTPERAR
A0A1F7F2Y7_9BACT      EQGSNVAPLYFDQLREAIDPEKSVWENVAGNQGSTITVNGIARHIISYLQDFLFTSERAS
R4YLW5_OLEAN          KVGTKLDVAYFDQSRSLLDLEKSVAENVGDGK-DEVEVDGRSRHILGYLGDFLFEPARAR
A0A1C9W9F0_9GAMM      RLGTKQQIAYFDQRRDQLNPELTVVDNIAEGR-DSVTIGGKSRHIMSYLSDFLFSGVKAR
A0A2N1TGV2_9SPIR      KHGARLETAYFDQLRNRLDENKTVRENVTDGN-EIIDFNGGKKHIIGYLQDFLFTPDRIN
A0A2E2HCR1_9GAMM      KTGSKLEFAYFDQLRKQLDSSQNVYDIIAEGS-DFVEINGKSLHVMSYLRNFLFTPDRAR
F3LGW8_9GAMM          KQGTKLSVAYFDQQRNQLELDKSAIDNIAGGR-EYISINGRDIHIISYLKDFMFTGERAR
H8W713_MARHS          RLGTNLQVAYFDQLRGELDLQRNALDNLAEGR-EFIDINGQSKHVLGYLQEFLFTPERAR
M1WYT7_PSEP2          RQGVNLQISYFDQLREQLDETKSARHNIADGN-DFVDINGHRRHVMSHLKDFLFTPDRAK
A0A3A4SF11_9DELT      RHGVNLQVAYFDQNREQLDEEKTVQDNISNGN-EFLEINGRRRHVIGYLKDFLFSPDRAR
A0A090AI32_9GAMM      QHGTQLQIAYFDQLRAQLNPEETVIDAVAQGR-EMITVNGQKKHVMSYLSDFLFMPARAF
A0A1A8TSW9_9GAMM      RQGTKLNVAYFDQLREQLDPEQTVAENVGEGK-DTIEINGQSKHVIGYLGDFLFPPERAR
A0A1E2VA67_9GAMM      KIGTKLEVAYFDQLRAGLDPDKNVLDNLAEGR-TSVTINGQQKHVMGYLQDFLFTPERAR
G8PYZ1_PSEF3          EEGTKIDVAYFDQLRHQLDLEKTVIDNVAEGR-DFIDIDGQSRHVLSYLGDFLFSPQRAR
L0E228_THIND          TLGTQLEIAYFDQTRAQLDEDATVQDTVGQGR-DRITVNGVTRHVLSYLEDFLFPPARSR
A0A1V5D8U4_9DELT      RLGTGIKIAYFDQLRAQLDERKTLRENVADGN-DTIIMGNATRHIVGYLQDFLFSPEQTM
A0A1S7LIS0_MAGMO      KLGTRLEIAYFDQYRDQLDHEATVADSVANGR-EQLDVDGKPRHIMSYLQDFLFSPERAR
B5JVV0_9GAMM          KLGTKLEIAYFDQLRDALDLNKSVTDNIGEGR-DMLPLPDGPRHVMSYLQDFLFSAERAR
Q74EP9_GEOSL          RLGTRREVLYFDQMREQLDLDRTVQENVGEGN-DTVIINGRSRHVIGYLQDFLFPPERAR
A0A2U8E0M9_9BACT      KHGTNLEVVYFDQFRAQIDDDKTVADNIADGN-TTVTIDGRQRHVITYLQDFLFSSQRAR
A0A496ZBP1_9DELT      RHGTNLQVIYFDQLRAQLDEQKTVRENIVAGN-DFIVFNGRKRHVIGYLQDFLFSPERCR
A0A2U3K0D5_9DELT      KHGVNLEPAYFDQLRAQLDENKSVAENVGDGN-DTILFDGKPRHIIGYLNDFLFSPEQAR
                        .      :  *              :  .                    : *   .  

UUP_CAUVC             QPVTSLSGGERNRLLLARALANPTNLMVLDEPTNDLDMDTLDLLEDLLADFDGTLILVSH
A0A2E2VQ33_9GAMM      TPVRLLSGGERNRLQLARVFLKPSNLLILDEPTNDLDVETLEVLEDKLSQYGGTVLVVSH
A0A3A1YQ40_9PAST      AKVSSLSGGERNRLLLAKILAKTSNLLVLDEPTNDLDIETLELLEDLVSNYDGTIIIVSH
UUP_BUCAI             SLVKTLSGGECNRLLLAQLFLKPSNVLILDEPTNDLDLDTLQLLEKIIIAYKGTVIIVSH
R5EZ17_9GAMM          SPVKVLSGGEKNRLLLARLFAKSSNVLIMDEPTNDLDLETLDLLEDLVSTYNGTVIIISH
A0A316FQY6_9GAMM      TPASALSGGEVSRLVLAKLFTRSANLLILDEPTNDLDIETLELLESQLVAFKGTVVVISH
A0A2E6LWH3_9GAMM      TPMKALSGGEVNRVLLAKICSRPSNLMMLDEPTNDLDLELLEVLEDAVKKYTGTLIVVSH
A0A1Z9UKG1_9GAMM      TPIGFLSGGECNRVILARLLSRPSNLLILDEPTNDLDVETLEVLEEQLIDYKGTLIVVSH
A0A2E3YKV6_9GAMM      TRVSALSGGERNRVILAKLFTRSANLLVLDEPTNDLDVETLEALESRLIQYDGTLLIVSH
A0A2E9D7P8_9GAMM      TPVRVLSGGERNRVILARLFTRSSNLLVLDEPTNDLDVETLEVLEARLCEYNGTLIVVSH
A0A4Z0WFB0_9BACT      SPVKTLSGGEANRLLLARLFSQPANLLVLDEPSNDLDIDTLELLEELITEFSGTVILISH
A0A0Q9YA56_9COXI      MLAKTLSGGEQNRLMLAKLFSKTANLLVLDEPTNDLDIESLDVLETLLLNYQGTVIIISH
A0A1Z8RH18_9GAMM      SAVRVLSGGEQNRLLLAKLFMKSSNFMVLDEPTNDLDIETLEMLEELLHTYDGTVLVITH
A0A1G0H206_9GAMM      IKVSGLSGGEKNRLLLAKLFSRPSNLIVMDEPTNDLDIETLELLEEKLSDFPGTLLIVSH
C6YXE5_9GAMM          SPITHLSGGEKNRLLLAKILSKPSNVIILDEPTNDLDIETLEILEEMLINYQGTVIIVSH
A0A2H0DA36_9GAMM      TPAKALSGGELNRLVLAKLFSKPSNLMILDEPTNDLDIETLELLEELVNDYQGTVILVSH
A0A2E9ZAS5_9COXI      SQIRTLSGGERNRLLLAKLFSQPANCLVLDEPTNDLDIETLELLEQYLVEFDGTVIVVSH
A0A1W6LNA1_9BACT      SLVSALSGGERTRLLLAKLFAKPSNILVLDEPTNNLDIETIELLEEQLAQYQGTIFIVSH
A0A1Z8QGI1_9PROT      TPIKAXSGGEKNRXLLAKLFTKKTNVLVLDEPTNDLDIETLELLEEKLQSYQGTLLLVSH
A0A0W0VWK2_9GAMM      QAVSTLSGGERNRLLLAKLFAKPVNLLVMDEPTNDLDIETLELLENRLMEYRGTLLLISH
F2B9M7_9NEIS          SPVSSLSGGERNRLLLAKLFTRPANILVLDEPTNDLDIDTQELLEDLLRDYAGTVFLVSH
N6YE33_9RHOO          SPVKSLSGGERNRLLLARLFARPANVMVLDEPTNDLDIETLDLLEELLAGYDGTLFLVSH
A0A1Q2MIS2_9BACT      GPVSSLSGGERNRLLLAKMFAKPSNMLVLDEPTNDLDMETLELLEELIADYPGTVLIVSH
A0A2A4UL14_9GAMM      TPVSALSGGEQNRVLLAKLFVRPANFLILDEPTNDLDVETLELLEELLVNYQGTLIVISH
B5JQK7_9BACT          ASIKTLSGGERNRLLLARLFTQPANLLVLDEPTNDLDAETLELLEERILEFDGTLLLVSH
UUP_ECOLI             TPVRALSGGERNRLLLARLFLKPSNLLILDEPTNDLDVETLELLEELIDSYQGTVLLVSH
A0A1U6GNG6_9GAMM      TPVKALSGGERNRVLLAKQLLKPANILVLDEPTNDLDMATLELLEESVASFGGTILLISH
Q7UGS0_RHOBA          TQVKFLSGGERNRALLAKLMTQPANVIVLDEPTNDLDAETLELLEEQLVGFDGTLLMVSH
A0A1F7F2Y7_9BACT      TPARNLSGGERHRLMLARLFTQPSNVLIFDEPTNDLDTETLELLEEVIMEYPGTILVVSH
R4YLW5_OLEAN          TPVKSLSGGERNRVLLAKLFLKPCNLLIMDEPTNDLDVETLELLEEKLVEYDATLLLVSH
A0A1C9W9F0_9GAMM      TAVGALSGGERNRALLAKLFSQPANILVLDEPTNDLDVETLELLEQLLLDYSGTVLLVSH
A0A2N1TGV2_9SPIR      MPVKALSGGEKNRLLLAKLFTRPANLLILDEPTNDLDLETVELLEELLLDFNGTLILVSH
A0A2E2HCR1_9GAMM      QKVRSLSGGEQNRLILACLFSKPANVLVMDEPTNDLDMETLELLEELLIDFTGTVLLVSH
F3LGW8_9GAMM          TPVKTLSGGERNRILLAKLFSQPSNLLVLDEPTNDLDVETLELLEERLLQYDGTILMVSH
H8W713_MARHS          SPVRVFSGGERARLLLAKLFSKPANILVLDEPTNDLDVETLELLEEQLSEFKGTVIVISH
M1WYT7_PSEP2          VPVSVLSGGERNRLLLARLFTRPSNVLVMDEPTNDLDVETLDLLEELLMDYPGTLLLVSH
A0A3A4SF11_9DELT      SPLKTLSGGERNRLLLARLFTRPSNVLVMDEPTNDLDVQTLELLEELLLEYAGTLLLVSH
A0A090AI32_9GAMM      SPVKSLSGGERNRLLLARLLIQPANLLVLDEPTNDLDVETLELLEELLANYSGTLLLVSH
A0A1A8TSW9_9GAMM      TPVKALSGGERNRVLLAKLFTKPANLLIMDEPTNDLDVETLELLEELLMNYDGTLLLVSH
A0A1E2VA67_9GAMM      QPVRALSGGEQNRLLLARLFAQPSNLLVMDEPTNDLDLETLELLEERLAEYPGTLLLVSH
G8PYZ1_PSEF3          TPVKALSGGERARLLLAKLFSKPANLLVLDEPTNDLDVETLELLEEVLLTFNGTVLMVSH
L0E228_THIND          QPVSALSGGERNRLLLAQLFLRPANLLVLDEPTNDLDVETLELLETLLIEYTGTVIVVSH
A0A1V5D8U4_9DELT      APVSSLSGGERNRLLLAKLFAIPSNVLVLDEPTNDLDAETLELLEEQLLEYSGTVLLVSH
A0A1S7LIS0_MAGMO      SPISVLSGGERNRLLLAKLFAQPANMLVLDEPTNDLDAETLELLEERIVAFPGTVLVVSH
B5JVV0_9GAMM          QPVRSLSGGERNRLLLAKLFTKAFNLLVLDEPTNDLDAETLELLEDRLMSYQGTLLLVSH
Q74EP9_GEOSL          TPVRILSGGERNRLLLAKLFTKPSNVLVMDEPTNDLDAETLDLLEDLLLEYSGTLLLVSH
A0A2U8E0M9_9BACT      TPARVLSGGERNRLLLARLFTKPANVLVLDEPTNDLDAETLDLLENLLVEYQGTLLLVSH
A0A496ZBP1_9DELT      TPVYVLSGGEKNRLMLAKLFTQPANVLVLDEPTNDLDAETLELLEELIFEYQGTLLLVSH
A0A2U3K0D5_9DELT      SPVSTLSGGERNRLLLARLFTKPSNLLVLDEPTNDLDMETLELLENLLLDYQGTLLLVSH
                            ****  *  **       * :::***:*:**    : **  :  : .*:.:::*

UUP_CAUVC             DRDFIDRLASSTIAL----DGK---------------------GGVVETPGGWTDLMDQN
A0A2E2VQ33_9GAMM      DREFLDNVVTSVWFF----QGE---------------------GNIIQCVGGYSDLKDQL
A0A3A1YQ40_9PAST      DRSFIDNVAVETWFM----ENQ----------------------QIYPYVGGYSDNVQRH
UUP_BUCAI             DKTFIKNTAKKCWFF----EKN---------------------GFINTHFSQYDSLKKEK
R5EZ17_9GAMM          DRAFIDKVATETWVF----DGK---------------------GHIESVIGGWSDVLAYY
A0A316FQY6_9GAMM      DRRFLDNVVASLLVF----ETDDIDSARSGANLGAIQDQSKKAGHIVEIEGGYNDYRRYR
A0A2E6LWH3_9GAMM      DRQFLDSVVDSILVF----EDD---------------------GKIHHYKGGYSQWVAQN
A0A1Z9UKG1_9GAMM      DRAFLDNVVTSTLVF----ESS---------------------GELVAYPGGYTDWSRKG
A0A2E3YKV6_9GAMM      DRYFLDKVVTSTLVF----EGE---------------------GTIKRYEGGYSDWARYK
A0A2E9D7P8_9GAMM      DRRFLDNVVTSVLVF----EDD---------------------DRIHEYVGGFSDWLARG
A0A4Z0WFB0_9BACT      DRYFIDNVATRVWGL----PGG---------------------GEVVPLVGGYREWQEWL
A0A0Q9YA56_9COXI      DREFIDNIATHCIAF----EKG---------------------GQISINVGGYTDWLERR
A0A1Z8RH18_9GAMM      DRAFLDNVVGSMLVF----EGD---------------------GVITEHVGGYTDWEARG
A0A1G0H206_9GAMM      DRAFLNNVVTQLWVM----GSD---------------------GHIQEHVGGHFDWENLM
C6YXE5_9GAMM          DREFINNIATSTIVF----EN----------------------GNLQEYIGGYDSWIAQR
A0A2H0DA36_9GAMM      DRSFVDHTVTSSFVF----REN---------------------EPLLEIVGGYTDWVHYK
A0A2E9ZAS5_9COXI      DRTFIENVVTQTYRF----DEH---------------------GHITEHMDHFIDT----
A0A1W6LNA1_9BACT      DRAFLNNVVTSTLVF----EGG---------------------GKVREYVGGYDDYIREK
A0A1Z8QGI1_9PROT      DRSFLNAVVTCCFVF----ESS---------------------G-LNHYIGGXDDWLRQK
A0A0W0VWK2_9GAMM      DRAFINQVVTSVLVY----EED---------------------GKFNEYVGGYEDYRAQK
F2B9M7_9NEIS          DRAFLDNVVTQSIVF----EGE---------------------GRLKEYIGGYQDYLDAK
N6YE33_9RHOO          DRAFLDNVVTQVIAA----EGD---------------------GCWGEYAGGYADWQRVK
A0A1Q2MIS2_9BACT      DREFLNNTVTCVYSF----EGD---------------------AKVKEYAGGYDDYKYHS
A0A2A4UL14_9GAMM      DRAFLNNVVSSTLVF----ESE---------------N-----GRVQEYVGGYDDWISQR
B5JQK7_9BACT          DREFLENTITTLFVL----ETG---------------------GQVTEHPGGYNDWQKHR
UUP_ECOLI             DRQFVDNTVTECWIF----EGG---------------------GKIGRYVGGYHDARGQQ
A0A1U6GNG6_9GAMM      DRSFMDNVVTSTWVFGEDEDGK---------------------GTVSEYVGGYQEYLVQK
Q7UGS0_RHOBA          DRTFLNNVVTSTLVF----DDD---------------SDP---GIVNEYVGGYDDWEAVA
A0A1F7F2Y7_9BACT      DREFLNNVVTSALIF----EGE---------------------GAVREYVGGYDDWERQL
R4YLW5_OLEAN          DRAFLDNVVTQLWVF----DGN---------------------GNIDEQVGGYSEWETRN
A0A1C9W9F0_9GAMM      DRAFLDNVVDSCLAF----EGN---------------------GLVREYVGGYSDFIRQG
A0A2N1TGV2_9SPIR      DRAFLNNVVTSTLAF----EEN---------------------GAIRECVGGYDDYKSRN
A0A2E2HCR1_9GAMM      DRRFLDNVVSSSIVF----ESG---------------GESESAGRVEQYVGGYQDWIRQG
F3LGW8_9GAMM          DRAFLDNVVTNIIAF----EEE---------------------GHVASYVGGYTYWHEQF
H8W713_MARHS          DREFLDNVVTDTIFL----DGS---------------------GAVMEYVGGYTDWRRQG
M1WYT7_PSEP2          DRAFLNNVVTSTIAF----EGN---------------------GHAAEYVGGYDDWLRQR
A0A3A4SF11_9DELT      DRAFLNNVVTSTLVF----EGN---------------------GAVREYIGGYDDWLRQR
A0A090AI32_9GAMM      DRRFLDNVVTSTIVF----EGK---------------------GQIKEYVGGYQDWLRQR
A0A1A8TSW9_9GAMM      DRSFLDNVVTSVIAF----EGE---------------------GNVKEYVGGYQDWIRQG
A0A1E2VA67_9GAMM      DRAFLDNVVTSIVAF----EGQ---------------------GKIREYVGGYEDWIRQG
G8PYZ1_PSEF3          DRAFLDNVVTSTLVF----EGE---------------------GLVREYVGGYQDWLRQG
L0E228_THIND          DRAFLDNVVTSTLVL----DGQ---------------------GGCEEFVGGWSDLPERV
A0A1V5D8U4_9DELT      DREFLNNVVTSTIVF----EGE---------------------GLLEEYIGGYDDWLRQR
A0A1S7LIS0_MAGMO      DREFLNNVVTSTLVF----ETG---------------------GEVMDYPGGYDDWLIQR
B5JVV0_9GAMM          DREFLDNVVTSTLVF----END----------------------TINEYIGGYSDWLRQR
Q74EP9_GEOSL          DREFLNNVVTSTLVL----SGD---------------------GQVREYVGGYDDWLRQA
A0A2U8E0M9_9BACT      DRDFLDNVVTSTMVM----EGD---------------------GRVAEYVGGYADYIRQR
A0A496ZBP1_9DELT      DRDFLNNVVTSTIVF----EGN---------------------GQVVEYVGGYDDWLRQR
A0A2U3K0D5_9DELT      DRTFLNNVVTSTLVL----EGE---------------------GKVGEYVGGYDDWVRQS
                      *. *:.                                            .         

UUP_CAUVC             PDFFKASKGGTAFAP--------------VSKAATK------PAPAAPA-----------
A0A2E2VQ33_9GAMM      AESLEATSS--------------------IQAAAMP------EPVAKKG-----------
A0A3A1YQ40_9PAST      AQIVAEQQAQALAKEQRAQAKLAAANGNAGSTNTNTAVNGAAGTSASTSGATALQNAANQ
UUP_BUCAI             NNFHKE------------------------------------KIQKNKS-----------
R5EZ17_9GAMM          ERISKNVECQTKDNSQKDIK---------NSEQPSR------TGTEKTD-----------
A0A316FQY6_9GAMM      AQKEQSQLRNKKPSAGSDSSDNHSSEKHSSHKQQGQQQGNALSSDKSVA-----------
A0A2E6LWH3_9GAMM      KALAIKDTPVVSKQE--------------KIEQSKA------AQPQATA-----------
A0A1Z9UKG1_9GAMM      RELAGSDAL--------------------PAYAKNI------TRTXDVK-----------
A0A2E3YKV6_9GAMM      HKLATAES---------------------DSSDKAN------ASKPYKG-----------
A0A2E9D7P8_9GAMM      HSLAEAETIV-------------------HGGDSQT------NSSAANS-----------
A0A4Z0WFB0_9BACT      QRQRVTGHKTTQNTIV-------------GSRQSRS------EGSNHAR-----------
A0A0Q9YA56_9COXI      EQFEKNQAKASQ-----------------QTKNHKT------TKPVETN-----------
A0A1Z8RH18_9GAMM      GRFRDTSQ---------------------ATSQAEP------KAVNKPQ-----------
A0A1G0H206_9GAMM      PQK--------------------------STPFSDE------KKEKVDV-----------
C6YXE5_9GAMM          KQPVQ-------------------------------------PAKETNK-----------
A0A2H0DA36_9GAMM      NNHLNAVKEN-------------------KADVNAI------SSTTPVK-----------
A0A2E9ZAS5_9COXI      -----------------------------PKTASSA------NEKTTTK-----------
A0A1W6LNA1_9BACT      LNAIK------------------------SPKPANN------HPKQQKK-----------
A0A1Z8QGI1_9PROT      PKE--------------------------INIDKDV------HLTKKNK-----------
A0A0W0VWK2_9GAMM      -----------------------------KQQREQA------VSPKPAK-----------
F2B9M7_9NEIS          NREQAFQAAPP------------------AKSAAED------TPAKSKP-----------
N6YE33_9RHOO          LARAGEQAERETTKR--------------VAAPADR------PRPAEPR-----------
A0A1Q2MIS2_9BACT      KPKKP------------------------ESPAQKK------TDNTKTK-----------
A0A2A4UL14_9GAMM      PQSFKDAFGGSSSAADDQA----------VLERDTT------DAVSLEL-----------
B5JQK7_9BACT          SLQDA------------------------KPAAQAP------SKPSRNS-----------
UUP_ECOLI             EQYVALKQPA-------------------VKKTEEA------AAAKAET-----------
A0A1U6GNG6_9GAMM      NREEAAKTAKSSGNNT-------------TNSKSTN------KSAAAAK-----------
Q7UGS0_RHOBA          KRRRAESGSGKVSGKK-------------ATSNPDA------KNNATSK-----------
A0A1F7F2Y7_9BACT      KKPSIPLP---------------------PKAAVPQ------KAAPVPA-----------
R4YLW5_OLEAN          KETKAKLDASVKSGAKKAKAP--------SQSKSAK------AKPAVVE-----------
A0A1C9W9F0_9GAMM      GHFATEEEASKKDSTPEKDAG--------AAGDAGS------RDTRAEE-----------
A0A2N1TGV2_9SPIR      T----------------------------SPEIKKP------GKNTREK-----------
A0A2E2HCR1_9GAMM      GGFDKEQSEI-------------------KSASTAA------SNTGRDA-----------
F3LGW8_9GAMM          SKSKASSRKRGNMKENVV-----------SDKPVEK------AAVAKAE-----------
H8W713_MARHS          GRFPSETSGSRLDKQDKRDKPDSS-----GKKPGQD------GGTVGQS-----------
M1WYT7_PSEP2          PDKPSP-----------------------SSRTCKP------LMEERKE-----------
A0A3A4SF11_9DELT      KPMEIP-----------------------KKPPEKP------KEKSKTA-----------
A0A090AI32_9GAMM      NLTVQPPI---------------------TPKKPLT------SSKTNVS-----------
A0A1A8TSW9_9GAMM      GKFPAESTSQTDDVPTKKEQAKAEAKKV-AEATQQA------TSKAAAS-----------
A0A1E2VA67_9GAMM      GRFPALSAPQSD-----------------TVSATSS------HQAKAAE-----------
G8PYZ1_PSEF3          GSPRLLGVTESKSGKADLNSA--------VVKAEPA------PVAAAAA-----------
L0E228_THIND          TAPLLETRIQASGPTVGAPALS-------TPQTPAP------PDRSPAP-----------
A0A1V5D8U4_9DELT      KAPAESS----------------------KSPASVE------KKEKRKK-----------
A0A1S7LIS0_MAGMO      PAPEE------------------------ETPKPEK------KVVKKSK-----------
B5JVV0_9GAMM          EPLDGESSKAAQNSLKKAPSN--------AAKPNSG------TAEKSPS-----------
Q74EP9_GEOSL          AAETPAAKPQ-------------------SAKAPAD------TSTKTRD-----------
A0A2U8E0M9_9BACT      AALDSAAALRAQQ----------------ASPALGK------KTSSTPA-----------
A0A496ZBP1_9DELT      PQRGAKS----------------------RPEKNIR------KKPPPKP-----------
A0A2U3K0D5_9DELT      GSDKPVKTGKAP-----------------DLAEKAE------KAEKQRP-----------
                                                                                  

UUP_CAUVC             ------------APKKSAKLSYKDQRRLE-------ECEALIAKSPAIIAKLEEALADPN
A0A2E2VQ33_9GAMM      ------------EKKGSTKLSYKLQRELD-------AMPEQLNEAENAIERLESIIGQAD
A0A3A1YQ40_9PAST      GSSSAEENKGGWVKNRTERLSYKEKQDLK-------TLPTIIDELQSEIEALHAKLAEMY
UUP_BUCAI             ------------KINLAIKIKNNFKKELN-------AILYEIETIELDIKTLQKKVNEPD
R5EZ17_9GAMM          ------------NSKKKKGLTFTQKHELK-------ELPDKVEKLEADIALLDEQLSDPA
A0A316FQY6_9GAMM      ------------NKPKPAKLSYKFQRELD-------AIPEQLEQIENDIDAIEQQTQTSE
A0A2E6LWH3_9GAMM      ------------EEAKPKKVSYKIQREYD-------LLPEEISSLEEKLEDLEKVMSDES
A0A1Z9UKG1_9GAMM      ------------IXNKRTKLTFNLXRELE-------LLPDTIERLXQEIXEVEKQIGXXX
A0A2E3YKV6_9GAMM      ------------SPSPTKKLSYKLQRELN-------KLPDQIANLEKEIDVLQNKVNSRD
A0A2E9D7P8_9GAMM      ------------SNDQPKKLSYNEQRELD-------LLPSQVERLELEIKELEQDISRPD
A0A4Z0WFB0_9BACT      ------------KGKRPGKLSYKIQREYD-------QLPAHIEQLEQLIAEQEQVVADPA
A0A0Q9YA56_9COXI      ------------KATAKSKLSFNEQRELS-------TLLSSIEKLEATIKQLENRMCDAG
A0A1Z8RH18_9GAMM      ------------RRKGSSNRERERAQELT-------NLPSRIEELETNIATLHEQMADPD
A0A1G0H206_9GAMM      ------------VKIKTQKITRPERRELN-------ALPKKITALENEIVQLQHVMLDSG
C6YXE5_9GAMM          ------------APQTKNKLTYEQKKQLR-------NLPSQIEKLEANITLIQQQMGELD
A0A2H0DA36_9GAMM      ------------TASKTQKLTYKDKLELE-------RLPDEIASLENQIEILQKQINDGA
A0A2E9ZAS5_9COXI      ------------TNTKKSTLTHEERKELN-------KLPAKIEKLEAKIAQAQATLNQPD
A0A1W6LNA1_9BACT      ------------PAGNQRKLSYHEKKELE-------KLPEEIETLEDNLSSIHKDLADPD
A0A1Z8QGI1_9PROT      ------------SNTSNKKLSYXEKRLLE-------MLPDKISKIEXRQNQLNNELANPT
A0A0W0VWK2_9GAMM      ------------RASSSTKLSFNEQRELS-------QLPKKIEALEEKISALQLKMAEPE
F2B9M7_9NEIS          ------------KPNRTVKLSYKEQRELD-------ALPDQIAALEAEQAALAAQLSNPD
N6YE33_9RHOO          ------------AANRPAKMSFNDKRELE-------ALPDRIAALEDEQAALHARMADPA
A0A1Q2MIS2_9BACT      ------------PKTEQKKLSYNEQREFD-------AIPDKIEELESQIAKIHADMADPE
A0A2A4UL14_9GAMM      ------------VSPKKRKLSYKDQRELD-------ALPKKIEQLEISIEGIHKEMADPD
B5JQK7_9BACT          ------------WKDKKPKFTNKLRNELE-------AIPQLIDDLEKRKEAIIEQLADPA
UUP_ECOLI             ------------VKRSSSKLSYKLQRELE-------QLPQLLEDLEAKLEALQTQVADAS
A0A1U6GNG6_9GAMM      ------------PNNAAKKLNFNDQRELD-------ALPKEIATLEAEQSELEDKLADGS
Q7UGS0_RHOBA          ------------PAAKAVKLSYNDQRELK-------LLPGKIEKLEAEIAAIHEEMAAPE
A0A1F7F2Y7_9BACT      ------------EASGPRKLTFKERLELE-------ALPALIEKMEQESHILCSQMADPA
R4YLW5_OLEAN          ------------AKAPAKKLSYKLQLELD-------ELPKKIEALEAKQAELGTETGSAD
A0A1C9W9F0_9GAMM      ------------KPVKKKKLSYKLQRELD-------SLPGLIEALEGEIETLESEVSDPA
A0A2N1TGV2_9SPIR      ------------KNSSKTKLTFKEKEELE-------SLPRILEEKESRREELFRIMSDPS
A0A2E2HCR1_9GAMM      ------------RPKQQNKLSFKLKHELE-------ALPGKIEKTELRIAGLEEQISQPA
F3LGW8_9GAMM          ------------PATLQKKRSYQDQRELD-------KLPAKIAKQEKVVSEINDQIADAS
H8W713_MARHS          ------------AKSKPVKLSYKLKLELE-------QLPGKIEQLEQQVAKLQDKISEPD
M1WYT7_PSEP2          ------------PDQRPKKLSYKEKYELEKKRDQLKKMPARIESLEQDIQSIQDKMSSPD
A0A3A4SF11_9DELT      ------------AAAGGGKMGYMEKRELA-------ALPQQIEAMEQELAGLFEQMSAPD
A0A090AI32_9GAMM      ------------PKPKSPKLSYKEQRELA-------ELPIQIENLETELTQLQEKVSCSD
A0A1A8TSW9_9GAMM      ------------TPKPKTKLSYKLQREFD-------AMPETIAKLEEEIAALQATTSSPD
A0A1E2VA67_9GAMM      ------------TAPSRKKLSYKYQRELD-------QLPAQIEQQEAEIAAQEAIVGDPG
G8PYZ1_PSEF3          ------------PAPAKKKLSYKLQRELE-------ALPGDIDAKEQQIAAVEAEMADAG
L0E228_THIND          ------------PKPAARKLSYRDARELE-------QLPGRIEQLESEREALAGQLSDPE
A0A1V5D8U4_9DELT      ------------PPNEKRKLTFKETRELE-------GLPQVIGAMEDEKACLMATLNSPE
A0A1S7LIS0_MAGMO      ------------PISGKKKLSYKEQRALE-------ALPGEIEALEEEQGELEALLADPA
B5JVV0_9GAMM          ------------KSATKKKLSYKDQRELE-------SLPAKIETLESELSQLQETLADPS
Q74EP9_GEOSL          ------------RGEKPRKLSFKEERELE-------ALPERIHQLEEEQECLHATLADPE
A0A2U8E0M9_9BACT      ------------KSARPRKLTNKENRELD-------ELPAKIEALEAEQAGLTAKLSDPD
A0A496ZBP1_9DELT      ------------GASQSRKLGYMQNREMQ-------NLPQKIEALESAQKELFAILSDPL
A0A2U3K0D5_9DELT      ------------KREGRQTISFKELRELE-------DIPGIIELLEAERNELYRSMSEPA
                                                               :                  

UUP_CAUVC             LYTRDP-ATFDKTMKALDKARADLEQAEMEWLELEEKKENLAG-----------
A0A2E2VQ33_9GAMM      FYTQDN-DEVQRVLSGLETAEQHLEQLMARWEELEMLKEQSASC----------
A0A3A1YQ40_9PAST      LNPEDY-NAISEVSALVVKKEEQMDELQTRWLELEDKRERLGEVID--------
UUP_BUCAI             FFKKTL-EEKLPTLKMLAQKERKLGKKILFWEKLEKNIINTKI-----------
R5EZ17_9GAMM          LFADGP-EKSIEVTNKRNKAQEELDKLYARWEELELINGE--------------
A0A316FQY6_9GAMM      FQAKTP-DEMQQVFQQLADLQQKMEQKMERWEELEAMK----------------
A0A2E6LWH3_9GAMM      FYTQDF-DVVQPYLDEQAALKEKLDQAMERWLELEEMING--------------
A0A1Z9UKG1_9GAMM      FYNAPY-DTIEPIXTSXTXLKSELESKTKRWLELEETN----------------
A0A2E3YKV6_9GAMM      FYNQPH-NIVQETLAELKELQLQTDVFIERWTELEDKSQALKR-----------
A0A2E9D7P8_9GAMM      FYGLPH-DQTKPVLGRLTQCKAELESKTERWLLLEEIQQRYQDFRSRSQR----
A0A4Z0WFB0_9BACT      FYQGDP-DQVHSVLEQLSEYQAQLDAAMERWLELEEQVSG--------------
A0A0Q9YA56_9COXI      FYQLPQ-EEIHSVTQQLEKLKAELSVAYVRWEELDARA----------------
A0A1Z8RH18_9GAMM      FYSQSK-EYQQSTQDHLKILESDLSALFERWEELETDREP--------------
A0A1G0H206_9GAMM      FYQQSK-EQISAHNQKLSAAESALAKCYERWQKLEDKI----------------
C6YXE5_9GAMM          FYQKSQ-SQQNEIQQKLNSLNEDLEKKYVLWEELLELE----------------
A0A2H0DA36_9GAMM      FFSLPV-EETQPILKQFQQFETALETKFERWEILDKMSQSIN------------
A0A2E9ZAS5_9COXI      FYQQSQ-DVTQPQIDRFESLQQEHDQLYQRWEVLLEKDI---------------
A0A1W6LNA1_9BACT      FYKKNP-EQIAKTNAQLKDVENQLNEKYARWETLEQIKEGKA------------
A0A1Z8QGI1_9PROT      LYKXNP-ERVKSIQKKMVTLNVELSSAFEEWEALENKLTESKD-----------
A0A0W0VWK2_9GAMM      FYQQEA-QIISECNRQLLQDEEELAKLYARWEALEERG----------------
F2B9M7_9NEIS          IFRDY--EKAATLQQRAEEIETELLEKLERWEELEAKQGGEAV-----------
N6YE33_9RHOO          LYQQAG-QEVAQVKSRLEALETEIEAAMLRWEELESRAASA-------------
A0A1Q2MIS2_9BACT      FFKSQG-DKIAEKTKLLEELETQLENLYNRWQQLEEKYT---------------
A0A2A4UL14_9GAMM      TYQKDP-QHVAKIQDKLAKFETELQQAYQQWEALED------------------
B5JQK7_9BACT          TYQEAD-NKVGDLKSEMSEIEAKLETSFERWEELEALKESLTDTNT--------
UUP_ECOLI             FFSQPH-EQTQKVLADMAAAEQELEQAFERWEYLEALKNGG-------------
A0A1U6GNG6_9GAMM      WFNQDF-DAATAASERLLTIEDEMMNKLERWNTLEG------------------
Q7UGS0_RHOBA          FYQSGG-DVIAKKSEELKVKEEELAQSYERWEALEAH-----------------
A0A1F7F2Y7_9BACT      FFQKTG--FVRETTIRIKELEKAVLSAYERWQALESRSGIKS------------
R4YLW5_OLEAN          FYQKDN-DYVTAKLDELQAIEKQLEGLEERWLELEEMAG---------------
A0A1C9W9F0_9GAMM      FYEQDP-ALVEERLKLLADRQAELDSAFERWAELDSEG----------------
A0A2N1TGV2_9SPIR      FYQKSG-DMVTVIKEELRELEDELESLFVRWEELDRMEQQFSKK----------
A0A2E2HCR1_9GAMM      FYEQDH-NKTKKVLDELAEAQQALETYYQRWAEIENQQQQQQ------------
F3LGW8_9GAMM          FYQSDS-KHVESVLANLSQQQADLDALYSRWEELEG------------------
H8W713_MARHS          FYSGPP-EDVSATLEQLAETESRLESVIERWMELEEQANQ--------------
M1WYT7_PSEP2          YFKHSS-EEMATDQGRLEELERELETAYSTWEDLEEALATTSLD----------
A0A3A4SF11_9DELT      FYKTDA-QTVSRMVARQKELEDKLEFAYARWEELEAREA---------------
A0A090AI32_9GAMM      FYRGST-AEINQTLAQIKHLETELQTRYARWEELETKG----------------
A0A1A8TSW9_9GAMM      FYTSDA-QNIEQTLAKMADKEQELETMMERWLELETMQNG--------------
A0A1E2VA67_9GAMM      FYSRPT-EEVTVELAKLTDLQNALETLMERWLELEAMTEGS-------------
G8PYZ1_PSEF3          FYQRPA-AETAKVIAQLEQLQAELDALVERWAELDA------------------
L0E228_THIND          LFRNAP-DRVPELQTTLQRLEEELAAAYARWEALESADS---------------
A0A1V5D8U4_9DELT      FYAGHDMAKITAANERLKVLETGLDEAYNRWEELENLAAKLSAGSAKDAGGTDL
A0A1S7LIS0_MAGMO      THTKENADKARQASERLHTVEATLEEKYAQWEELEEKSA---------------
B5JVV0_9GAMM          FYQSDN-DTISQAQNQLQQLESDLEHCFERWEALEG------------------
Q74EP9_GEOSL          FYRGAG-AEVAVFNCRLEELEGELEAAYARWEELEGLKG---------------
A0A2U8E0M9_9BACT      FYKSDS-AAAPVVHARLEELESTLATAYARWEELETIRNAT-------------
A0A496ZBP1_9DELT      FYKKGK-DEMIRAKLDLHRVEREIETAYRRWEELETMTPPGDTP----------
A0A2U3K0D5_9DELT      FYRKDG-AEIATAKVRLTTIEQELDQAYQRWDVLDMKARDVATVL---------
                                                    *  :