CLUSTAL format seed alignment for MF_00861

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

EUTB_ECOLI            ----------------------------------------------------MKLKTTLF
EUTB_SALTY            ----------------------------------------------------MKLKTTLF
A0A0C5WP75_9GAMM      ----------------------------------------------------MKLKTHLF
A0A347WLZ2_9LACT      ----------------------------------------------------MILKTKLF
G9YS01_FLAPL          ----------------------------------------------------MKLKTTLN
A0A1I5D6B1_9CLOT      ----------------------------------------------------MKLKTIVN
A0A415DX42_9FIRM      ----------------------------------------------------MLLKAKLF
A0A0U9HJC1_9FIRM      ----------------------------------------------------MPWSTRLF
G2SZ36_ROSHA          ----------------------------------------------------MILKTRML
A0A1G9WAS2_9FIRM      ----------------------------------------MFNDSGGTGEKRMKLKTKLF
A0A172TFU4_9BACL      ----------------------------------------------------MNLITVIG
K4LD86_THEPS          --------------------------------------------------MAKRYSARVR
A0A1L6L3D0_9DELT      ----------------------------------------------------MQLHATIR
A0A1S1QHB2_9ACTN      ----------------------------------------------------MTFRATVR
Q0REB7_FRAAA          --------------------------MHRRATCVRGRSASASGSRLGREVAAVAYRMTVR
A0A3D9TPJ5_9NOCA      -----------------------------------------------------MYRALVG
A0A2I2KSF5_9ACTN      ----------------------------------------------------MKGSARVG
F0KH72_ACICP          ------------------------------------------------------------
C5BM48_TERTT          MYNLGIKPEFRKNFMSTAQSLLMWKIQNDAYWHFLCISSLINSFKALPLVCNMRYSYTLG
A0A378QVL5_MOROS      ----------------------------------------------------MRFSTTIA
A0A1I5JPZ8_9RHIZ      ----------------------------------------------------MSYSSTIG
A9H4V4_GLUDA          ---------------MPLSARDKLLSGNQSHSLQISERASLFGRQKRRIIPTVPYRIILD
A0A1H6BNL4_9BACT      ----------------------------------------------------MPYDITLR
F0JDT3_DESDE          -------------MVGEPRRAVPWPGTGLERFSHGIESFVPEAIPCNPEPQAAMYAVTLD
K7S741_ACIA4          -----------------------------------------------------MHAATVG
                                                                                  

EUTB_ECOLI            GNVYQFKDVKEVLAKANELRSGDVLAGVAAASSQERVAAKQVLSEMTVADIRNNPVIAYE
EUTB_SALTY            GNVYQFKDVKEVLAKANELRSGDVLAGVAAASSQERVAAKQVLSEMTVADIRNNPVIAYE
A0A0C5WP75_9GAMM      GQTYQFRDVKDVLAKASDLRSGDILAGVAAQTAQERVAAKHVLSEMTLKDLRENPVVSYE
A0A347WLZ2_9LACT      GRVYEFNNIYEVMGKANELRSGDELAGVAAESAEERVAAKTVVANLQLKDFFENPAVPYE
G9YS01_FLAPL          GQTFAFRDIRDVLAKANEPKAADRLQGVAAETVTERVAAKVVLSELTVGELTENPTVPYE
A0A1I5D6B1_9CLOT      GKVYQFKDVKDVLAKANEPKAGDRLQKIAASDETERVAAKVVLSEMLVEDLVENPTVPYE
A0A415DX42_9FIRM      GKVYQFDSVKEVLAKAGDLKSGEVLCGIAAESEQERLAAKIVLSDLLVSDLRNNPVVSYE
A0A0U9HJC1_9FIRM      GKNYTFFSIKEILAKASEEKSGDIFAGIAAENNAERVAAKRVLAELTLKDLRENPVIPYE
G2SZ36_ROSHA          GQTYEFKDVKDVLAKASEKKSGDELAGVGAESALERIAAKEVLAQLTVADLTEHPVVPYE
A0A1G9WAS2_9FIRM      GSVYQFKDVKEVLAKANEEKSGDSLAGIGAATTAERVAAKVVLSEMTLADLRNNPVIPYE
A0A172TFU4_9BACL      GQAYRFHSVKEVLAKANEARSGDRLAGIAAADERERVAAKYVLAELNLSVLRNEPVLDPD
K4LD86_THEPS          GETFGFSSLKEVFAKSNEEKSGDLLAGVAASSAAERIAAKRVLSETTLEEIYNNPLISPD
A0A1L6L3D0_9DELT      GSTYRFGSVKEVLAKANPPKSGDDLAGVSARDPVERVAARAVLSELTLRDLRENPVVPYD
A0A1S1QHB2_9ACTN      GTSYVFPDLAALLASANEEKSGDQLAGIAAGSATERVAAKLALADVRLGDILATPLLD--
Q0REB7_FRAAA          GERHVFADLAELFAKANEEKSGDQLAGIAAGSARQRVAAKLALADVTLGEIVAAPLID--
A0A3D9TPJ5_9NOCA      GERFRFDSLTEVLAKANEVKSGDGLAGIAARSDRERVAAKIALSEETLGRIHDRPVVE--
A0A2I2KSF5_9ACTN      GEHFTFGALAEILAKANEPKSGDVLAGIAAASGAERMAAKLVLADVRLSEIVDEPLVD--
F0KH72_ACICP          ------------MAKATPLRSGDELAGVAAKDATEHVAAQMTLADVPLKTFLNDVVVDYE
C5BM48_TERTT          STRYHFTNLAELMAKATPARAGDRLAGVIAHTAQERVIAQMALADVPLKNFLNEALVPYE
A0A378QVL5_MOROS      NHVWQFDSLKEVMAKASPLRSGDVLAGVAATTNIERMAARFVLADLPLRIFLDEPLLDDS
A0A1I5JPZ8_9RHIZ      KTRYSFESLKDLLAKATPERSGDELAGIAAEGPVERLAAQVALADLPLQSFLDTDILGVE
A9H4V4_GLUDA          SERYNFAHLRHVLACASPARSGDELAGLAAADPVERMAARHVLADIPLRDFLNDVPVPYE
A0A1H6BNL4_9BACT      GVRHTFANLRELLAKASPLRSGDQLAGLAAESSEARAIAQHALADVPLAAFLEDLLIPYE
F0JDT3_DESDE          SVTHEYADLRSLLAAASAPKSGDELAGIGARSAHERAVARLCLAEVPLSAFLEDLVVPYE
K7S741_ACIA4          GHRYTFDSLATLLGVASPERSGDQLAGCAAHSDAERAAAQRALSEVPLTRFLTEDVVDRD
                                  :. :   ::.: :    *     :  *:  :::  :  :     :   

EUTB_ECOLI            DDCVTRLIQDDV----NETAYNQ--IKNWSISELREYVLSDETS---VDDIAFTRKGLTS
EUTB_SALTY            EDCVTRLIQDDV----NETAYNR--IKNWSISELREYVLSDETS---VDDIAFTRKGLTS
A0A0C5WP75_9GAMM      SDMITRINQDSL----NRTMFEK--IQNWSVSELREYVLSDDIS---NEDMQRLRKGLTA
A0A347WLZ2_9LACT      KDEVTRIIIDNV----NMRVYEE--IKEWTVSELREYILDSNIT---NYDIRRISSGLTS
G9YS01_FLAPL          KDEVTRVNLDGL----NQPTYQR--FKGMTIGELREWILDHKTT---GDDLVRSCRAFTG
A0A1I5D6B1_9CLOT      KDEVTRVNLDGM----NKKTYER--IRRMSIGNLRELILDHKTT---NDDLKRISRGISG
A0A415DX42_9FIRM      EDEVTRVIQDDL----NEQIYDS--IKNWTISELREYILSDKTS---ENDLKRLMRGLTS
A0A0U9HJC1_9FIRM      EDEVTRVIDDGL----SQGIYKS--ICSMTVAELREWILSHDTT---CEDIHRVSAGLTA
G2SZ36_ROSHA          EDAVTRIIQDDI----DETVYGT--IKDRTIQEMREWILCDATD---SGALMRASRGMTS
A0A1G9WAS2_9FIRM      TDEVTRVIQDAV----TADAYQT--LQSMTVGEFREFILK--SD---GLSLAAVRDGLTA
A0A172TFU4_9BACL      QDEVSRVIEASV----DEEVYRE--LSGWSVAELRESLLSSATS---GSDMLRLSRGLTS
K4LD86_THEPS          EDEVSRVILESV----RMPIYNQ--IKNWTVAELREFLLADTTT---NEDIAYLRQGLTS
A0A1L6L3D0_9DELT      QDELTRMVEDTL----DEQAFRA--VKELTVGQFREWILDTSTP---GPTIRSVSAGLTP
A0A1S1QHB2_9ACTN      -DAVTELILREH----DVAAFADAGLASRTVGEFRELVLSPGFA--DAWSAGGFASAITP
Q0REB7_FRAAA          -DAVTDLILRGQ----DAALFAP--LASLTVGEFRELVLSPSFP--ARWRDDGLARAITP
A0A3D9TPJ5_9NOCA      -DAITDAVHGAI----DSEVFGS--ISGLTVGEFREVVLSDGFA--DEWSA-GVAAAIGP
A0A2I2KSF5_9ACTN      -DEVTTAILSRL----DRERFDTT-LGGLTVGEFRERVLSPGFA--SEWPG--LRGLVTP
F0KH72_ACICP          TDEITRLIIDEH----DLAAFAP--ISHFTVGDFRNWLLGEEA---TTQSLKALASGLTP
C5BM48_TERTT          EDEVTRLIIDTH----SADAFAP--ISHFTVGDFRNWLLSDAA---DGATLAQIRPGLTP
A0A378QVL5_MOROS      VDEVSRLIRQQH----DSVAFVP--FGNISIGEFRNWLLSEHA---TTQILQDCKWAFTP
A0A1I5JPZ8_9RHIZ      NDEITELIYSSH----DLPAFAP--ISHMTMGEFREWLLAPTT---TSEILNKLQPGLTP
A9H4V4_GLUDA          DDEVTRLIVDTH----DAASFAP--VAHMTVGQFRDWLLSYTA---DGDAITALGPGLTP
A0A1H6BNL4_9BACT      ADDVTRLIVDTHATSAAQAAFTP--IAGLTVGELRDWLLSDDA---TTDRLTALAPGLTP
F0JDT3_DESDE          DDAVTRLIVDT----LDREALSP--VAGLTVGAFRDWLLTAGA---DGDALKALAPGLMP
K7S741_ACIA4          ADDVTRLILADH----DRAAFAP--VSGLSVGGLRDWLLSTCVRPDAAQVLTALAPGLTP
                       * ::                    .   ::  :*: :*                  .  

EUTB_ECOLI            EVVAAVAKICSNADLIYGAKKMPVIKKANTTIGIPGTFSARLQPNDTRDDVQSIAAQIYE
EUTB_SALTY            EVVAAVAKICSNADLIYGGKKMPVIKKANTTIGIPGTFSCRLQPNDTRDDVQSIAAQIYE
A0A0C5WP75_9GAMM      EMVSAVGKLCSNGDLMYGASKMPVITKANATVGLPGHFSCRLQPNDTRDNVNSILAQTYE
A0A347WLZ2_9LACT      EMVAAVAKIMTNLDLIVGAQKIIIEKTANTTIGKKGTFSSRLQPNHTTDNIDGIMATTME
G9YS01_FLAPL          EVAAAVAKLMSAMDLVYGASKIHHITRCNTTIGQPGVLAFRNQPNSPTDDPEEILIQMME
A0A1I5D6B1_9CLOT      EVAAGVAKLMSSMDLVYGASKIHKITRCNTEIGHPGTLSYRIQANSTTDNPETIILGVME
A0A415DX42_9FIRM      ETIAGVSKLMGNMDLVYAARKIRNVTHCNTTLGQQGILASRLQPNHPSDDPDGIRMSIFE
A0A0U9HJC1_9FIRM      EMVSAVAKLMSNMDLVYAASKIHVVTKNRTEIGLPGTLSYRIQPNHPNDSVEGILASVME
G2SZ36_ROSHA          EVIAGISKIMSNMDLILAGSKIRVTATCNTTIGTENVLASRLQPNHPVDDVEGVAASTLE
A0A1G9WAS2_9FIRM      EMIAGVTKLMSNLDLVYAAKKLGVTATCNTTIGEAGTLSSRLQPNHPTDDLRGVMASVME
A0A172TFU4_9BACL      EMIAAVTKLMSNLDLIQAAAKIEVITRCNTEIGRKGTLASRAQPNHPADSPEGMKASLYE
K4LD86_THEPS          EMIAAVCKIMSNLDLIYAASKIVVTSHCNNTLGIKGTLNARLQPNHPTDDVEGILWSMRE
A0A1L6L3D0_9DELT      EMAAAAAKLMSNMDLMIAGAKCQVVVRANNTLGLPGRMSSRLQPNHPTDDVQGILYSTRE
A0A1S1QHB2_9ACTN      EMAAAVAKLMSDKDLIVGAKPLRTVTRCRNTMGEAGVLGVRVQPNHPTDDVEGILLSALD
Q0REB7_FRAAA          EIAAATAKIMSDKDLICAAKPLRTVTRCRNTIGEAGVLGVRVQPNHPADDLEGILLSVLD
A0A3D9TPJ5_9NOCA      EIAAATAKLMSDLDLIVAASRLRVVTKCRNTQGESGIFGCRIQPNHPTDDVTGIMLSALD
A0A2I2KSF5_9ACTN      EIAAATAKLMSNLDLVRATVALQVETTCRTTVGQPGVLAARLQPNHPTDDPAGIAYSIFD
F0KH72_ACICP          EMVAAVSKIMRNQDLIYVASKCEVVTQFRNTIGLKGHLSTRLQPNHPTDDVLGISASILD
C5BM48_TERTT          EMVAAVSKIMRNQDLILVAKKCQVTTAFRNTIGLPGRFSTRLQPNHPTDDSTGIAASILD
A0A378QVL5_MOROS      EMVAAVSKLMRNQDLIAVAAKCQTITAFRNTIGLPDRVSVRIQPNHPTDDMRGVIASTFD
A0A1I5JPZ8_9RHIZ      EMVAAVSKIMRSQDLIAVAQKCRVVTKFNNTIGLEGRMATRNQPNHPTDDSRGILASAID
A9H4V4_GLUDA          EIVSAVSKLMRNQDLIAAARKIRVVTAFRNTQGLPGRLGTRLQPNHPTDDARGIAASLLD
A0A1H6BNL4_9BACT      EIVAAVSKLMRVQDLIAVARKCEVVTRFRTTVGLKQRLSTRLQPNHPTDDPAGIAASILD
F0JDT3_DESDE          EMVAAVSKLMRVQDLIHVASKVRVVTRFRTTVGLPGTLAARLQPNHPADDPAGIAASVFD
K7S741_ACIA4          EMAAAVSKLMTIGDMIAVSSALRVVTAFRSTIGLPGTLATRLQPNDPTDDPTAVAAETLD
                      *  :.  *:    *::            .   *    .  * *.* . *.   :     :

EUTB_ECOLI            GLSFGVGDAVIGVNPVTDDVENLSRVLDTIYGVIDKFNIPTQGCVLAHVTTQIEAIRRG-
EUTB_SALTY            GLSFGAGDAVIGVNPVTDDVENLTRVLDTVYGVIDKFNIPTQGCVLAHVTTQIEAIRRG-
A0A0C5WP75_9GAMM      GLTFGCGDAVIGINPVTDSIENTTQMLNAIQDVITKWDIPTQPCVLAHISTQMEAVRRG-
A0A347WLZ2_9LACT      GLSYGIGDATIGINPVNDNVESTYQILNEVNDFINKWEIPTQHVVLAHITTQMKAMEKG-
G9YS01_FLAPL          GVSYGCGDACMGINPVENNVESTRRIADAVYSFICRNDIPTQLVVLSHMTTQMDAIRKG-
A0A1I5D6B1_9CLOT      GISFGSGDACIGINPVEDNFESTNRIAQKVFEFVKKYDVPTQITVLSHITTQMDAMRRG-
A0A415DX42_9FIRM      GLSYASGDCVIGINPATTNLDTTRRIMNMLQELKEKYEIPTQVCYLVHLTTMMEAMKSG-
A0A0U9HJC1_9FIRM      GLTYGSGDAVIGINPNEDTVENTVKLMNASFDFMMDWAIPTQNCVLSHITTQMKAVEAG-
G2SZ36_ROSHA          GLSYGIGDAVIGLNPAIDTVDSTLAIWKVLGDIRDKYEIPTQTCVLSHVTTQMEALRTGQ
A0A1G9WAS2_9FIRM      GISYGAGDAVIGLNPAIDSIDGISALLTQFKTFTNKWKIPTQNCVLAHVTTQMKALQQG-
A0A172TFU4_9BACL      ALSYGIGDAVIGINPVMDTAENTEILLRAAKDVMNNMQVPTQNCVLSHVTTQMQAIRSG-
K4LD86_THEPS          GLAYGVGDAVIGINPVNDSVASVSRLMEATHEMITEFGIPTQNCVLAHITTQMEAVRNG-
A0A1L6L3D0_9DELT      GLSYGCGDAVLGVNPATDTAESTAEILKALGDVMSRNGIPTQQCVLSHVTVQMKALDLG-
A0A1S1QHB2_9ACTN      GILYGCGDAVLGVNPVNESVASVGAVLHGLQSLIRRLSLPTQTCVLAHITTQLAXLATGA
Q0REB7_FRAAA          GLLHGCGDAVLGVNPARESVEQVGTILRGLGALVDALALPTQTCVLAHLTTQLAALAAGA
A0A3D9TPJ5_9NOCA      GLMYGCGDAVIGVNPATESPQTVGRVLHAIHDLIELTGAPTQSCVLSHITTQLAALEHGA
A0A2I2KSF5_9ACTN      GLSHACGDALLGVNPAVESVESVVAILRMLDAFIDELAIPTQGCVLAHVTTQLAAIERGA
F0KH72_ACICP          GLMYGNGDAVIGINPATDNLHNLSELLKLLDHVIQEYQIPTQSCVLTHISSGIQLAEKNV
C5BM48_TERTT          GLMYGSGDAVIGINPATDNLAQCQNLLHMLDEIIQRYQIPTQSCVLTHVTNAIEAIELGA
A0A378QVL5_MOROS      GLLYGMGDAVIGINPASDSMPILGDLSKMFDALIHEYEIPTQSCVLTHITNTIELINQGV
A0A1I5JPZ8_9RHIZ      GLIMGTGDAVIGVNPATDTVEDYIRIVSLLDRLVEALEIPTQHCCLGHVTVALEAIGRGA
A9H4V4_GLUDA          GLLLGVGDAVLGINPATDSIANGIVLLDMLEQVRTRYAIPAQTCVLTHITNAIAMMARGA
A0A1H6BNL4_9BACT      GLLLGSGDAVIGINPASDSPQSVLKLLAMIEHVRERFAIPTQSCVLAHVTTQMRAIEQAA
F0JDT3_DESDE          GLMYGSGDACIGVNPASDSTASAVRLLELLDRLRREYDIPTQTCVLTHVTNTIAAVERGA
K7S741_ACIA4          GLLMGSGDAVIGVNPASDSPGTVRALLDALDDMRSGAQIPTQTCVLTHITTTIDLMDAGA
                      .:  . **. :*:**          :      .      *:*   * *::  :       

EUTB_ECOLI            AP-----GGLIFQSICGSEKGLKEFGVELAMLDEARAVGAEFNR------------IAGE
EUTB_SALTY            AP-----GGLIFQSICGSEKGLKEFGVELAMLDEARAVGAEFNR------------IAGE
A0A0C5WP75_9GAMM      AP-----GGLLFQSIAGSEKGLAEFGVSVEMLDEAYEIGKQYCN------------LAGE
A0A347WLZ2_9LACT      AP-----TGLVFQSIAGTERANEGFGIDAKLIDEAYDMALKTGS------------AVGP
G9YS01_FLAPL          AP-----LSMIFQSIAGTEAANNDFGVSRQLCTEAYELACQHAL------------STGP
A0A1I5D6B1_9CLOT      TP-----LSMIFQSIAGTEKTNDSFGVTKKLIQEAYQVAFEFGI------------SSGP
A0A415DX42_9FIRM      SP-----SDLIFASIAGTQKCNDTFGVNVESLEEARETALRYGT------------STGP
A0A0U9HJC1_9FIRM      AR-----VCAFFQSISGSETCNKVFGISAKMLDEAFDMIKKKGF------------APGP
G2SZ36_ROSHA          GS-----ADLCFQSIAGSEAALSAFGINTGMLSEAEMLFREEGP------------AKGP
A0A1G9WAS2_9FIRM      AP-----MDLMFQSLAGSQKSNEAFGIDVNLLDDAYQLMQAHKS------------STGP
A0A172TFU4_9BACL      AP-----ADMLFQSIAGTEAGNRAFGISEALLDEADALIRASGT------------ASGP
K4LD86_THEPS          AP-----VSVFFQSIAGTEKGNKAFGISVSLLDEAYEVIKRYST------------AAGP
A0A1L6L3D0_9DELT      AP-----MGLMFQSLSGSETGNRAFGISLALMDEAWDKMKRLGA------------TRGP
A0A1S1QHB2_9ACTN      P------VDLLFQSIAGTEAANRSFGISLEMLAEGREAVLAHHR-DRSGE------FVGD
Q0REB7_FRAAA          P------VDLLFQSVAGTEAANTSFGITLDLLAEGREAVLAHHRRDRSGD------FVGE
A0A3D9TPJ5_9NOCA      P------VDLLFQSVAGTEAANRSFGISLDMLREGRDAVAESHR-ARPGE------FVGS
A0A2I2KSF5_9ACTN      R------ADLLFQSVAGTAAANRAFGVDLALLMEAADAVRAQHE-ADPGR------YAGR
F0KH72_ACICP          P------IDLMFQSIAGTQLANEGFGISLDLLQEGYEATLALKRGTI-----------GQ
C5BM48_TERTT          P------LDLVFQSIGGTEATNTSFGFNLAHLAQAEAAAQSLARGTV-----------GN
A0A378QVL5_MOROS      P------VDLVFQSIGGTEAVNRSFGVDLAILKEGYEAGLSLNRGTV-----------GQ
A0A1I5JPZ8_9RHIZ      P------VDLVFQSIAGSQKANEGFGVNLSLLCEAHEAALSLKRGRI-----------GD
A9H4V4_GLUDA          P------VDLVFQSVAGTQAANAGFGVSLSVLAEAHDAARSLNRGTV-----------GH
A0A1H6BNL4_9BACT      AAGTQAQLDLIFQSIAGTELANKGFGITLDLLAEAESMAASLHRNPSQPTPNPYSLIPNP
F0JDT3_DESDE          P------VDLVFQSVGGTEGVNRSFGVTPDLLREGLEAGWSLKRGTV-----------GD
K7S741_ACIA4          P------VDLAFQSIAGTQAANDGFGVNLAMLDEASAAGDELARGTV-----------GD
                                 * *: *:      **.      :.                       . 

EUTB_ECOLI            NCLYFETGQGSALSAGANFGA-----DQVTMEARNYGLARHYDPFIVNTVVGFIGPEYLY
EUTB_SALTY            NCLYFETGQGSALSAGANFGA-----DQVTMEARNYGLARHYDPFLVNTVVGFIGPEYLY
A0A0C5WP75_9GAMM      NMMYFETGQGSELSADAHHGA-----DQMTMEARCYALAQRYKPHLVNTVVGFIGPEYLY
A0A347WLZ2_9LACT      NLMYFETGQGSE-YPDGHHGI-----DQVTLEARCYGFARNWDPYIVNTVVGFIGPEYLY
G9YS01_FLAPL          NLLYFETGQGSEVSIGADCGV-----DEMTLEARTYGFGRFFRPFMVNNVSGFIGPETLY
A0A1I5D6B1_9CLOT      NLLYFETGQGSEVSVDADEGV-----DEMTLEARTYGFARYFDPFMVNNVSGFIGPETIY
A0A415DX42_9FIRM      NVMYFETGQGPENAGNMHYGA-----DMATLEARTYGFGRHFAPFIVNDVVGFVGPEVQY
A0A0U9HJC1_9FIRM      NFMYFETGQGSELSLDAHHGA-----DMQTLEARTYGFGRRYMPFMVNNVSGFIGPETLY
G2SZ36_ROSHA          NVMYFETGQGSELSSSAAFGS-----DQQTMECRCYGLARHYHPFLVNTVVGFMGPEYIY
A0A1G9WAS2_9FIRM      NFMYFETGQGSELSSGGHNGA-----DQVTLEARCYGLAKRYRPFLVNTVVGFIGPEYLY
A0A172TFU4_9BACL      NRWYFETGQGSELSSDAHHGI-----DQVTLESRCYGFILKYKPFLVNTVVGFIGPEYLY
K4LD86_THEPS          NLMYFETGQGSELSSDAHEGV-----DQLTLEARCYGLAKRYNPLLVNTVVGFIGPEYLY
A0A1L6L3D0_9DELT      NVMYFETGQGSALSSAAHHGA-----DQVTLEARCYGFARRYKPFLVNTVVGFIGPEYLE
A0A1S1QHB2_9ACTN      NVMYFETGQGSALSADAHGGL-----DQLTVEARAHGVARAYQPFLVNSVVGFIGPEYLA
Q0REB7_FRAAA          QVMYFETGQGSALSADAHHGV-----DQLTCEARAHGVARAFDPFLVNSVVGFIGPEYLA
A0A3D9TPJ5_9NOCA      QFMYFETGQGSALSADAHHGV-----DQLTLEARAQAVARLYDPFLVNSVVGFIGPEYLA
A0A2I2KSF5_9ACTN      HAMYFETGQGSALSSDAHHGI-----DQLTCEARAQGFARLFDPFLINSVVGFIGPEYLA
F0KH72_ACICP          NVMYFETGQGSALSSNAHHGV-----DQQTLETRAYAVARKYNPLLVNTVVGFIGPEYLF
C5BM48_TERTT          NVMYFETGQGSSLSANAHWGL-----DQQTCEVRTYAVARQYNPLLVNTVVGFIGPEYLF
A0A378QVL5_MOROS      NVMYFETGQGSALSANAHYDI-----DQQTCEVRAYAVARQFNPLLINTVVGFIGPEYLA
A0A1I5JPZ8_9RHIZ      NVMYFETGQGAALSADAHHGM-----DQQTMEARAYAVAREFRPLLVNTVVGFIGPEYLF
A9H4V4_GLUDA          NVMYFETGQGSALSAGAHHGM-----DQQTAEVRAYAVARAFSPLLVNTVVGFIGPEYLY
A0A1H6BNL4_9BACT      CLFYFETGQGSALSAEAHHGC-----DQQTLEARAYAVASRFSPFLVNTVVGFIGPEYLY
F0JDT3_DESDE          NVMYFETGQGSALSAGAHHGV-----DQQTLEARAYGLARRYDPFLVNSVVGFIGPEYLY
K7S741_ACIA4          NMMYFETGQGSALSSGGHLGVGGRPVDQQTLEVRAYGLARHYRPLLLNTVVGFIGPEYLY
                         *******.        .      *  * * *  ..   : * ::* * **:***   

EUTB_ECOLI            NDRQIIRAGLEDHFMGKLSGISMGCDCCYTNHADADQNLNENLMILLATAGCNYIMGMPL
EUTB_SALTY            NDRQIIRAGLEDHFMGKLSGISMGCDCCYTNHADADQNLNENLMILLATAGCNYIMGMPL
A0A0C5WP75_9GAMM      NHQQIIRAGLEDHFMGKLSGIPMGCDACYTNHADTDQNSNENLVTLLAAAGVNFVIGMPL
A0A347WLZ2_9LACT      NSKQVIRAGLEDHFMGKLSGISMGCDICYTNHMDSDQNDSENLTVLLAVAGVNFIIGVPS
G9YS01_FLAPL          DGKEMIRASLEDHFMGKLMGLPMGMAPCYTNHTSITQDEQEMATMLLNAAGANYYIGVPV
A0A1I5D6B1_9CLOT      DGKEMIRANLEDHFMGKLMGLPMGMAPCFTNHTPINMDDQQIGTMLLTMAGANFFMGIPH
A0A415DX42_9FIRM      DAKQCTRSMLEDVFMAKMSGIPIGTDIAFSSHVKADYNDNDVVMMAASLAGTEYWIGVPG
A0A0U9HJC1_9FIRM      DGKQITRASLEDHFMGKLLGLPMGMAPCYTNHVKVDQNDQEGAIMLLAMAGANYYMGVPG
G2SZ36_ROSHA          DTKQLTRAALEDVFCGHLHGLPMGCDVCYTNHMPTDQNDSETILTLLGTAGVHYVMGLPQ
A0A1G9WAS2_9FIRM      DGRQMIRAGLEDHFMGKLTGLPMGVDVCYTNHMKADQNDLENLAMILAMGDCTYFMGIPC
A0A172TFU4_9BACL      DGKQITRAGLEDHFMGKMHGLPMGVDICYTNHMRADQNDMDNMGVLLAAAGVNFVIGVPM
K4LD86_THEPS          DSRQVIRAGLEDHFMGKLTGVPMGCDACYTNHMKADQKDIENLAVLLTAANCNYFMGVPM
A0A1L6L3D0_9DELT      DGPQITRAALEDHFMGKLLGIPMGCDACFTYHAKMSQDELECLKVLLAAAGCSYLMSLPV
A0A1S1QHB2_9ACTN      DARQITRAGLEDHFIGKLLGLPMGIDVCYTNHVDADQNTNDDLLVLLVAAGCNFVMGVPG
Q0REB7_FRAAA          DARQITRAGLEDHFVGKLLGLPMGCDVCYTNHVDADQNTNDDLLVLLVAAGCTFVMGVPS
A0A3D9TPJ5_9NOCA      NSRQITRAGLEDHFVGKLMGLPMGCDVCYTNHVDSDQNENDNLLALLALSGCTFVMGVPA
A0A2I2KSF5_9ACTN      DAEQITRAGLEDHFVGKVMGLPMGADVCFTNHVAADHNSNDSALLLLALAGCTFVMGVPA
F0KH72_ACICP          NGKQIIRAGLEDHFCGKLLGVPMGCDICYTNHADADQNDMDVLLTLFGAAGINFIMGIPG
C5BM48_TERTT          DGKEIIRAGLEDHCCGKLLGLPMGVDVCYTNHAQADQNDMDTLLTLLAVAGCTYIMGIPG
A0A378QVL5_MOROS      DGKQILRAALEDHFCGKLLGLPMGCDVCYTNHCDADQDDMDSIIVSLVAAGLTFLIGVPG
A0A1I5JPZ8_9RHIZ      NGKQIMRAGLEDHFCGKLFGLPMGVDVCYTNHTDADQNDMDSLLVSLSAAGVNFVICVPG
A9H4V4_GLUDA          DGKQIIRAGLEDHFCGKLMGLPMGCDACYTNHAEADQDDMDNLMMLLTVAGVNFLIAVPG
A0A1H6BNL4_9BACT      DGKQILRAGLEDHLCGKLLGLPMGCDVCYTNHAEADQDDMDTLLTLLGAAGVNYIMGVPG
F0JDT3_DESDE          DEKQIVRAGLEDHFCGKLLGLPMGMDVCHTNHAEADQDSMDSLLTLLGVAGCNYIMGVPG
K7S741_ACIA4          DGRQIIRAGIEDNFCGRLLGVPMGVDVCYTNHAEAGPDDMSTLLTLLVAARTGYVICVPG
                      :  :  *: :**   .:: *:.:*   ..: *     .  .        .   : : :* 

EUTB_ECOLI            GDDIMLNYQTTAFHDTATVRQLLNLRPSPEFERWLESMGIMAN-GRLTKRAGDPSLFF--
EUTB_SALTY            GDDIMLNYQTTAFHDTATVRQLLNLRPSPEFERWLETMGIMAN-GRLTKRAGDPSLFF--
A0A0C5WP75_9GAMM      GDDIMLNYQTTSFHDTATVRQLLKLRPAPEFEAWMETMGLMEN-GRLTRKAGDPSIFFK-
A0A347WLZ2_9LACT      GDDIMLNYQSTGFHETVSARELLNLRPIKEFEEWCEKMGILED-GRLTDRAGDASIFLK-
G9YS01_FLAPL          NDDIMLSYQDTSYHDNATLRELSGRLPAPEFHQWMMKRGLIDEKGVLTELAGDASIFLQ-
A0A1I5D6B1_9CLOT      GDDVMLAYQDTSFHDDACLRELMGKKPAPEFHRWLMKKGLMDELGKLTALAGDASIFL--
A0A415DX42_9FIRM      AQDVTTYNMDTSFHDCAAMRRMLGLHTIPEFEKWCQKWGILDEDGNLGENAGDASIFL--
A0A0U9HJC1_9FIRM      SDDCMLSYQDTSYHDDATLRELLGRRPAPEFEKWLEKMGIMKD-GRLTPIAGDPSIFATM
G2SZ36_ROSHA          ADDIMLMYQSTSYHDVASIRQLLKKEPIPEFKAWLEKRGIWEN-GHLGPNAGDPSIFFK-
A0A1G9WAS2_9FIRM      GDDIMLMYQTTSFHDMAALRELTGKRPIKEFAERMEDLGIMLA-GRLTERAGDLSIFTV-
A0A172TFU4_9BACL      ADDCMLNYQSLSYHDIATLRELLRLGPAAEFAAWLESRGLMSG-GRLTSLAGNPALWTGG
K4LD86_THEPS          GDDVMLNYQCTSYHDIATLRQLLGLRPAPEFECWMEKMGLIRE-GILTDRAGDPRVFTKG
A0A1L6L3D0_9DELT      GDDIMLNYQSTSFHDIPSVRALVGKRPAPEFDAWLEERDIWRG-DRPGERFGDPGVIR--
A0A1S1QHB2_9ACTN      ADDVMLSYQSTSYHDAAGMRDLFGLSATPEYTAWLHDRGLVRGGRLADPDPDVAAALLAG
Q0REB7_FRAAA          ADDVMLGYQSTSYHDAAGMRELFNLHAAPEFTAWLTDRGLLVDGHLADPTGPVAALLTAG
A0A3D9TPJ5_9NOCA      GDDVMLNYQSTSYHDIASVRRLMGSGPAPEFASWLEDQ------QGWDPSHGVFELPEAW
A0A2I2KSF5_9ACTN      GDDVMLGYQSTSYHDVATTREVLGRRPAPEFDAWHRRT--------FGTRSAQEAAVPAA
F0KH72_ACICP          SDDVMLNYQTTSFHDALYLRQLLGLKPAPEFSAWLEQQGIFKQQNSQICWADHMPDQFSR
C5BM48_TERTT          ADDIMLNYQTTSFHDALYARQVLGLRAAPEFEAWLEKMQIV-ETDQPAKLVDAMPDTFAR
A0A378QVL5_MOROS      ADDIMLNYQSTSFHDARFIRETLKKRAAPEFEAWLQKMQLTDPQGHLLSDGKRFLMAPDN
A0A1I5JPZ8_9RHIZ      ADDIMLNYQSLSSHDAIFVRETLHKAPAPEFSDWMENKGITDKTGRMRS--EPALSGPSL
A9H4V4_GLUDA          GDDVMLSYQSLSHHDMLTLRSSFGVRAAPEFEAWLHEMNLLDPDGRLRVNAPQSLGRILG
A0A1H6BNL4_9BACT      ADDVMLNYQSTSFHDALYLRRTLNLRPAPEFEAWLASPHFEDLKRLGPNPTALLPLASGN
F0JDT3_DESDE          ADDIMLNYQSTSFHDALYLRRQLGLAPAPEFAAWLERTGIFEHGALRA-PKSALRIPDKE
K7S741_ACIA4          TDDIMLGYQSLSFHDVLAARRVAGLRPAPEFDAWLEAVGLMGRDGGILDVGTTGPAITAL
                       :*        . *:    *      .  *:                             

EUTB_ECOLI            ---------------------
EUTB_SALTY            ---------------------
A0A0C5WP75_9GAMM      ---------------------
A0A347WLZ2_9LACT      ---------------------
G9YS01_FLAPL          ---------------------
A0A1I5D6B1_9CLOT      ---------------------
A0A415DX42_9FIRM      ---------------------
A0A0U9HJC1_9FIRM      TPLGRR---------------
G2SZ36_ROSHA          ---------------------
A0A1G9WAS2_9FIRM      ---------------------
A0A172TFU4_9BACL      GSKLGRTS-------------
K4LD86_THEPS          GFAGNG---------------
A0A1L6L3D0_9DELT      ---------------------
A0A1S1QHB2_9ACTN      LDKAVLDVPAPTRALTSGR--
Q0REB7_FRAAA          LDDALAALPTRP-ALPSGPTR
A0A3D9TPJ5_9NOCA      WSAVGGRTLPAIGA-------
A0A2I2KSF5_9ACTN      IGRRIGDLVAGR---------
F0KH72_ACICP          LLMN-----------------
C5BM48_TERTT          TLEHLSDSDSSDARAETGQ--
A0A378QVL5_MOROS      LSVNYGYPYQ-----------
A0A1I5JPZ8_9RHIZ      LALTEAAQ-------------
A9H4V4_GLUDA          PG-------------------
A0A1H6BNL4_9BACT      WPTGT----------------
F0JDT3_DESDE          RLRGLSS--------------
K7S741_ACIA4          AHGPMAALAGGSLVG------