CLUSTAL format seed alignment for MF_00863

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RPO1N_METTW           --------------MRGILKKISQINFGLMSPEDIRKMSVAQIVTPDTYDEDGYPIENEL
R9SJC4_9EURY          ------------MRDKGIIKKIQEINFGLMSPDQIRKMSVVKIETPDTYDEDGYPIENGL
Q2NEK4_METST          --------------MKGIIKKVSEIDFGLMSPEVIRKMSVTKIVTPDTYDEDGYPIESGL
E3GYR8_METFV          --------------MIGTLKKIKEIEFTLMSPEEIRNLSVVKIDTPDTYDEDGYPIEGGL
D3DZI7_METRM          -----------------------------MSPDQIREMSVVNITRPDTYDEDGYPIENGL
Q8U0M4_PYRFU          -----------------MKKVIGSIEFGILSPQEIRKMSAVEVTVPDTYDDDGYPIEGGV
F6BAY9_METIK          -----------MMDRYEIPKEIGEIIFGLLSPEHIRKMSVAKIVTADTYDDDGYPIDGGL
D5EA57_METMS          -----MMVISMDNTIPSIPQRIGAIRFGLLSPREIRKMSVTSIITADTYDDDGYPIDMGL
G7WMA4_METH6          -------------MNMTVPKRIGKISFGLISPQEFRRMSVVKIITADTYDDDGFPIEMGL
Q0W8G9_METAR          ---------------MTSPKRIKKIRFGLLSPAEIRKMSVTKIITADTYDDDGYPIDMGL
A0A650A1Z2_9EURY      ------------MSTGQSPKSIGKISFGLMDPEEYRDMSATKVITADTYDDDGFPIDMGL
A0A1M5K087_9EURY      -------------MAGQTPKEIGGINFGLMDPETYRDMSATKVITADTYDDDGYPIDMGL
M1Y5V8_NATM8          -------------MQGQTPKEIGTLSFGLMDPEEYRNMSATKIITADTYDDDGFPIDMGL
A2SSM4_METLZ          ---------------MTSPKRIGKIEFGILSPKAIRDMSVCKVIWPDTYDDDGFPYPKGL
N0BKJ3_9EURY          ----------------MIPKRIDSIRFEVLSPQEIRRMSVTKIISSETYDDDGFPIEAGL
D3T9X0_ACIB4          ----------MSHHIFGLTKRINSIKFALLSPEEIRRMSAVKVITADTYDDDGFPIDKGL
Q6L2F9_PICTO          ------------MNFNNVSKRIKDIKFALLSPDEIRKMSQVKVITPDTYDDDGYPIDKGL
A0A6B9TE98_9ARCH      ------------MTTPGITKRIGSIKFSCVSPEEIRKMSATKVITADTYDEEGYPIEMGL
M4YUS2_THEXX          --------------MNNITKRIGSIKFSCLSPEEIRKMAAVKIITADTYDDEGHPIEQGL
A0A0X8UZD5_9ARCH      --------------MNTVDRKIGSIKFSCISPEEIKNMSAVKIITADTYDDEGYPIQGGL
R9TC03_METII          -------------MMRGVSKRIGSIKFSILSPEEIRKMSATKVITADTYDDDGFPIDMGL
A0A0U3F394_9CREN      --MVRKPAPRIRSKVQRIDKIIKEIKFGILSPHEIRQMSRVTIVSDRAYDEAGMPIEGGI
G0EEX9_PYRF1          ---------------MVEEKIIKEIKFGILSPDEIRKMSVVAITTDQLYDPDGRPIPGGL
E0SPC3_IGNAA          --------------MAMEEKVIKGIKFGILSPDEIRRMSVVQIVSPETYDEDGTPISGSV
I0A0T4_FERFK          --------------MPGVQKKIKGIKLSVLSPDEIRRMSKVQIITAETYDDDGLPIQGGV
A4YCQ9_METS5          ----------MSERYQVNEKIIKGVRFGILSPDEIRKMSVTAIITADVYDEDGTPIEGSV
RPO1N_SACSH           ----------------MSEKNIKGIKFGILSPDEIRKMSVTAIITPDVYDEDGTPIEGSV
B8D6G9_DESA1          ------------MSSKIVTNRISRIKFGILSPDEIRKMSVTQIFSSEVYDNDGSPIDGGV
Q9YAU1_AERPE          --------MSLRLSEFRETNLLDKILFGVLSPHEIRQLAKVTVVRGDLYEADGTPVSGGL
D9Q2P3_ACIS3          --------MSYSPGEERERYTISGIRFSLLSPREIREMAKVTVIRPEIYEVDGSPVMGGL
S5ZUY1_9CREN          ----------MGMSTRESSKIIAGLKFGILSPEMIRKLAVLRIETSELYDDEGFPIPGGL
Q8ZYQ8_PYRAE          -------MSLREEFDAIPKKVIKSIKFGVLSPEMIRKYSVMEVTTSEVYDEGGLPVRGGI
E1QRA0_VULDI          MATQAEKTSVREE--EIPLKTIKAIKFSILSPDVIRSMSVMEITTSETYDEAGRPMVGGL
A8MAA2_CALMQ          --MSYSNQGSGED--NIPLKVIKEISFNVLSPDLIRKMSVMEVTTSETYDEAGNPVKGGL
Q74M69_NANEQ          ----------------MEIKKLGLIDLRPLDPEVIRKLSVVEVKIPEPYDRDGLPIENGP
A0A218NM91_9ARCH      ----------------MQAEIIDSIKFTTLSPDTIKKMSVAKLIVADTYNEDGYPIDGGL
C7DHC4_MICA2          ----------------MQAETIEYIKFTSISPEMIKKMSVAKLIVPDTYNEDGYPIDGGL
                                                   :.*   :  :   :     *:  * *     

RPO1N_METTW           MDPRLGVIGSSLRCRSCGAKGGECPGHFGSINLARPVIHVGFADTIHKILSSICR--KCS
R9SJC4_9EURY          MDPHLGVIDPSLKCRTCGFRGGECQGHFGSIDLARPVIHVGFGDVIHKILRSTCN--ECG
Q2NEK4_METST          MDPRLGVIDPGLKCRTCGSKGGDCQGHFGHINFARPVIHVGFADTIHKILRSTCR--KCG
E3GYR8_METFV          MDPRLGVIDPSLRCKTCGLRGGQCPGHFGRIELARPVIHVGFADVIHKILRSTCR--KCG
D3DZI7_METRM          MDSRLGVIDPSLKCRTCGEKGGECQGHFGMIDLARPVIHVGFGDDIHKILRSTCN--ECG
Q8U0M4_PYRFU          MDKRMGVIDPGLRCETCGGRAGECPGHFGHIELARPVIHVGFAKTIYRILESTCR--ECG
F6BAY9_METIK          MDTRLGVIDPGLVCKTCGGRVGTCPGHFGHIELAKPVIHIGFAKDIYKILKAVCP--HCG
D5EA57_METMS          MDLRLGVIDPGLKCKTCGGRAGECPGHFGHIELVAPVLHVGFNKIIRKILRSTCR--NCS
G7WMA4_METH6          MDPRLGVIDPGLRCRSCGGRPGECPGHFGHIDLIAPVIHVGFAKLIRKILRAICR--DCS
Q0W8G9_METAR          MDPRLGVIDPGLRCRTCGGRPGECPGHFGHIELAAPVIHVGFARLLRKVLRTTCR--KCG
A0A650A1Z2_9EURY      MDPRLGVIDPGLECKTCGKHSGACNGHFGHIELAAPVIHVGFSKLIRRLLRGTCR--ECS
A0A1M5K087_9EURY      MDPRLGVIDPGLECRTCGKHSGSCNGHFGHIELAAPVIHVGFTKLIRRLLRATCR--NCG
M1Y5V8_NATM8          MDPRLGVIDPGLECKTCGKHSGSCNGHFGHIELAAPVVHVGHAKLIRRLLRGTCR--ECG
A2SSM4_METLZ          MDPSLGVIDPGLRCKTCGQKQGDCPGHFGHIDLAKPVIHVGYTRLIRKLLRVTCR--DCG
N0BKJ3_9EURY          MDPRLGVIDPGLRCKTCGGKAGECPGHFGHVELAAPVIHVGYAKLIAKLLASTCR--ECG
D3T9X0_ACIB4          MDLHMGVIEPGLRCKTCGGKVDECPGHFGHIELAMPVIHVGFVKNIKNYLDATCR--ECG
Q6L2F9_PICTO          MDLHMGVIEPGLRCATCGGKVDECPGHFGHIELAMPVVHVGFVKEIKTMLDSSCK--VCG
A0A6B9TE98_9ARCH      MDPHMGVIEPGLRCKTCGCKVDECPGHFGHIDLAMPVIHVGFIKDIKMLLESTCC--KCG
M4YUS2_THEXX          MDMHMGVIEPGLRCKTCGCKVDECPGHFGYIDLAEPVTHVGFVKDIKMLLEATCRNPKCG
A0A0X8UZD5_9ARCH      MDPRMGVIEPGLRCKTCNCKVDECPGHFGRIELAMPVIHVGFVKDIKLMLESTCC--KCG
R9TC03_METII          MDPHLGVIEPGLRCKTCGNKVDECPGHFGHIDLAMPVIHVGLVKEIKKLLQSTCK--SCG
A0A0U3F394_9CREN      MDPRMGVVNPGQKCPTCGNTMHDCPGHFGSIELAKPVYHYVFIQYIYDALRATCR--RCG
G0EEX9_PYRF1          MDPRLGAAIPGQRCETCGNDYRLCPGHFGRIELALPVINVGFARHIYEILRATCR--NCG
E0SPC3_IGNAA          MDPRLGAIEPGQTCPICGNTMKACPGHFGHIELALPVINVLYVKHIYDLLRATCA--NCG
I0A0T4_FERFK          MDPRLGVIEPGQKCPVCGNTMQSCPGHFGHIELAKPVIHIGYVKEIYDLLRGTCW--KCG
A4YCQ9_METS5          MDSRLGIIEPGQKCPICGNVIGNCPGHFGHIELVRPVIHVGFVKHVYDLLRSTCR--RCG
RPO1N_SACSH           MDPRLGVIEPGQKCPTCGNTLGNCPGHFGHIELVRPVIHVGFVKHVYEFLKATCR--RCG
B8D6G9_DESA1          MDRRLGAIEPGETCPICGNTRDSCPGHFGHIELAKPVIHAGFAKQILIYLKATCR--NCG
Q9YAU1_AERPE          RDPHFGAIEPGERCPVCGNSREECPGHFGKIELARPVLIPHYTDYVYKILQATCR--VCG
D9Q2P3_ACIS3          RDPHFGAIEPGERCPVCGNTRQDCPGHFGKIDLARPVVLPHLGDKIYQLLQSTCR--SCG
S5ZUY1_9CREN          MDRRMGSIEPGAVCQTCGNRFTNCPGHFGYIELARPVVHPEFTPYIALLLKATCS--KCG
Q8ZYQ8_PYRAE          ADRRLGVAEPGSRCETCGQTHDVCPGHFGHIELVKPVIHVGFARIIYDVLRATCP--NCG
E1QRA0_VULDI          MDRRLGVVEPGARCETCGNPPDKCPGHFGRIELARPVIHVEYAKYIHDLLRTTCR--ECG
A8MAA2_CALMQ          MDRRLGVDEPEARCETCGNDWRRCPGHFGRIELVRPVVHPEFVKPIYDILRATCP--NCG
Q74M69_NANEQ          MDPRMGVIDPGLRCKTCGGKYGECLGHFGRIELARPVYHVKFLNEIKRLLQYTCP--KCG
A0A218NM91_9ARCH      MDQRLGVIDPGLKCKTCGGRAKSCMGHFGHIELVRPVIHPEFARFIYMLLQSTCE--KCN
C7DHC4_MICA2          VDQRLGVIDPGLKCKTCGGRAKSCTGHFGHLELIRPVIHPEFAKSIYFMLQSTCE--SCH
                       *  :*   .   *  *.     * **** :::  **        :   *   *    * 

RPO1N_METTW           RILLT-----------------------------------------ETEIQDYRQRILEA
R9SJC4_9EURY          RILLD-----------------------------------------EVEIEEFRQKIDFC
Q2NEK4_METST          RVLLT-----------------------------------------DTEKLEYKDKLEER
E3GYR8_METFV          RILLT-----------------------------------------KSEIEHYHDLLKQA
D3DZI7_METRM          RVLLD-----------------------------------------EEEIEEYTEKLNEL
Q8U0M4_PYRFU          RIKLT-----------------------------------------DEEIEEYMKKIELA
F6BAY9_METIK          RIAIN-----------------------------------------EVKIKEYLEKMKKL
D5EA57_METMS          HLLLE-----------------------------------------DKQKKAYINQFAKL
G7WMA4_METH6          RLMLL-----------------------------------------ENEKRMYLEQIETL
Q0W8G9_METAR          RLLMD-----------------------------------------EKTKAEYLRQIQTA
A0A650A1Z2_9EURY      RLTAVDAAK--------------------FTDGEGAVDLAAAEAAAEEKKREFRQELRRT
A0A1M5K087_9EURY      RL-----------------------------------------ALTEEEKEEFKEKLVRT
M1Y5V8_NATM8          RLTLADPSDREYRREYFKERDDTPPRNWFVSPEDARKAQEKAERAAERKREQFLEQLERT
A2SSM4_METLZ          RLLLDK------------------------------------------------EEIERF
N0BKJ3_9EURY          RVLLPDS-----------------------------------------KRDKFIEEIERR
D3T9X0_ACIB4          RIKLK-----------------------------------------DDEIEIYKQKIEEA
Q6L2F9_PICTO          RIKLT-----------------------------------------DEEIENYKKSIEDL
A0A6B9TE98_9ARCH      RLMLS-----------------------------------------EDQIQARRESMERM
M4YUS2_THEXX          RLMLT-----------------------------------------EEQIGKMQKRMDSI
A0A0X8UZD5_9ARCH      RLMLS-----------------------------------------PEEIQNRIDRLNTI
R9TC03_METII          HLLMT-----------------------------------------QEEAAEKTKQMEMV
A0A0U3F394_9CREN      KLKLN-----------------------------------------EDEIEEYLDLYERL
G0EEX9_PYRF1          RIKLP-----------------------------------------ERELKRYLKLLERL
E0SPC3_IGNAA          RIKVS-----------------------------------------PSEIEKYMVYLRKL
I0A0T4_FERFK          RILLP-----------------------------------------EEEIKQYLDLMRRV
A4YCQ9_METS5          RVKIS-----------------------------------------ENDIEKYRKIYDAI
RPO1N_SACSH           RVKIS-----------------------------------------EDEIEKYSRIYNAI
B8D6G9_DESA1          RLKIP-----------------------------------------EEEKGEYLRLLSDL
Q9YAU1_AERPE          RITLP-----------------------------------------EEKIKYYRLIFRRL
D9Q2P3_ACIS3          RILIP-----------------------------------------PQKAAYMLGIYRRL
S5ZUY1_9CREN          RLKLD-----------------------------------------EERIEKARKRMEVY
Q8ZYQ8_PYRAE          RIMLR-----------------------------------------DEEIERYRERLNKL
E1QRA0_VULDI          RILLT-----------------------------------------DEEIEKYSKRLARL
A8MAA2_CALMQ          RLKLT-----------------------------------------DEEYKRYSERIKRL
Q74M69_NANEQ          RAIIPQKLK-------------------------------------EQFLKKINEYINEG
A0A218NM91_9ARCH      RVMLS-----------------------------------------KELADDVRSALKEI
C7DHC4_MICA2          RILLG-----------------------------------------EDQISEAKEAMKSL
                      :                                                           

RPO1N_METTW           MEREESLTPI----IKEIYAEAR----RDRCPHCEEE----------QEEIKLDKPVSIV
R9SJC4_9EURY          KEHEENLNDI----IKEVYKAAK----KDTCPHCGAE----------QEDIKIDKPTTIT
Q2NEK4_METST          IENGEDISKI----LKQIHLAAK----KEKCPHCEEE----------QIEIKIDKPISLV
E3GYR8_METFV          EKKDMNIDPI----LKEIYETAR----REECPHCNEK----------QKEIKLDKPVTIT
D3DZI7_METRM          QEAGESTEDL----IKEVYKICKAKKAKDVCPHCGAE----------QEDIKIVKPIGII
Q8U0M4_PYRFU          RNRRSEFNEI----IKEIHKKAK---ERMVCPHCGAP----------QYPIKFEKPTIYW
F6BAY9_METIK          EEDGGDKWEV----CEEVLKEAA---KANVCPHCGEI----------KYDIKYEKPTTYY
D5EA57_METMS          DVMSHLPDD-------LINNVFKEARKTKICPYCGEE----------QLEIKFEKPSDYI
G7WMA4_METH6          VRLGQTTDD-------VVNKVFSEARKHKVCPYCGAP----------QQEIKFERPLAYV
Q0W8G9_METAR          QRLGQPIDE-------IVKNVFKDA-KGTTCPYCGEE----------QKEIKFEKPTGYI
A0A650A1Z2_9EURY      AELGNDLDD-------VLKSAIRQARSASRCPYCGAE----------QFDVKHEKPTTYY
A0A1M5K087_9EURY      KDLGGDPTD-------VLKSAVRQARKANNCPHCGEP----------QADIKHEKPTTYY
M1Y5V8_NATM8          RDLGEDPSD-------VLKAGIRQARDADYCPYCTEDDDYRKGYPTAQYDITHEKPSTYL
A2SSM4_METLZ          SALEDDPYS-------AETIGEKDIKKERICPYCGDQ----------QFKINFEKPTSFV
N0BKJ3_9EURY          KSLNQDYED-------VVKEVFRITKAAKKCPHCHAD----------QFDIKFDKPTFFY
D3T9X0_ACIB4          KKMGASPLEL----LFITKKIIDDASSRPICPHCGAE----------QKKITLDKPTTFR
Q6L2F9_PICTO          NFVRDDPEII----DIKLRKITDLASSREICPHCGSE----------SPKTIIDKPTTFR
A0A6B9TE98_9ARCH      EELGGGTIEV----KNFSKETAKDASGKGICPYCGAE----------QIKIKLDKPTTFR
M4YUS2_THEXX          LEFGGDTIDQ----KVYSKEIAKEASNNTSCPICGAD----------QMKIKLDKPTRFR
A0A0X8UZD5_9ARCH      SDLGGDTIDQ----KNYSKETVKAASNRGICPYCNAE----------QSKIKLDKPTTFR
R9TC03_METII          EELGGDAIDY----RILAKDLAKDASKNAVCPHCGEI----------QGKITLDKPTTFR
A0A0U3F394_9CREN      TNK--WPLHA----KRLVSYIKKKAAKAQTCPHCGAK----------QYKVRLEKPYKFL
G0EEX9_PYRF1          KNK--WPLLA----KALINEVKQRAAKTTECPHCKEH----------NYKIVFEKPYKYY
E0SPC3_IGNAA          KAR--YPYLA----KRFSEFIKKKAIKVTVCPHCGAK----------QPKIKLEKPTTFV
I0A0T4_FERFK          EKY--MPFLL----PRLYEHIKQKASKTTVCPHCGAA----------QRKIKLERPTTFL
A4YCQ9_METS5          KKR--WPSAA----KRLIDHVKKTSMKAAVCPHCSEK----------QLKIKLEKPYNFY
RPO1N_SACSH           KKR--WPSAA----RRLTEYVKKTAMKAQVCPHCGEK----------QFKIKLEKPYNFY
B8D6G9_DESA1          QELG-APYLI----KRFHEYIRRRASTADTCPHCGAK----------QYKVKLEKPHTFY
Q9YAU1_AERPE          RGK--WPQLA----KTFATMVVKEAAQATQCPHCGKP----------QYKVVYIRPFHFY
D9Q2P3_ACIS3          REK--WPLLA----DIFVEEVIKEASSATECPHCGAK----------QYKIKFIKPYNFY
S5ZUY1_9CREN          SRK--WPSLK----IKYANTLLKEAAKATECPHCHAP----------QYKIKVDKPYTFY
Q8ZYQ8_PYRAE          KAR--WRLLA----LNLHEKIRKKATERMTCPHCGYK----------RNKVRFERPYYFY
E1QRA0_VULDI          RVR--WKLLA----DRLIERIRKKAMERTVCPHCGAK----------QYKIRFERPYTFY
A8MAA2_CALMQ          KKH--WRALS----DRLILRVKKKAAARSTCPHCGAP----------QPKIRLDKPFKFY
Q74M69_NANEQ          KYDELSNFIQ----STVIPKINEYRKKHKKCPYCNAE----------LKEIKFEKPWYFY
A0A218NM91_9ARCH      NLNADEQK-----EELLFNDIVKKLKTLKKCPYCGSD----------QHKRKFERPTFFY
C7DHC4_MICA2          VVSDSEDEQHEIEKNAVLGGVLKKLKTVKKCPHCGAP----------KRKLKFERPTFFY
                                                    ** *                    :*    

RPO1N_METTW           E-----------------------------------------------------------
R9SJC4_9EURY          Q-----------------------------------------------------------
Q2NEK4_METST          E-----------------------------------------------------------
E3GYR8_METFV          E-----------------------------------------------------------
D3DZI7_METRM          EVRKEYDENGELLTDANGN-----------------------------------------
Q8U0M4_PYRFU          EIRKDEQGN---------------------------------------------------
F6BAY9_METIK          QIDGK-------------------------------------------------------
D5EA57_METMS          E-----------------------------------------------------------
G7WMA4_METH6          E-----------------------------------------------------------
Q0W8G9_METAR          E-----------------------------------------------------------
A0A650A1Z2_9EURY      EIIEVPHPEIEERLSMAMDPPEG-EPVTPDELAEAIDDAFSAGR---------IRELLSG
A0A1M5K087_9EURY      EVQDVLSGDYSELITRAMQPDQP-DDEADDEEAAEVDEA----------------EAMSP
M1Y5V8_NATM8          EQGPVPDGDVRDLLAEALEGGEGGTEIELDELVEAVNDVVARWGGDERITVADISRLMSG
A2SSM4_METLZ          EIVTEMGEDGK-------------------------------------------------
N0BKJ3_9EURY          E-----------------------------------------------------------
D3T9X0_ACIB4          --EEGR------------------------------------------------------
Q6L2F9_PICTO          --EGSI------------------------------------------------------
A0A6B9TE98_9ARCH      EIEDNH------------------------------------------------------
M4YUS2_THEXX          EVEPSHGKDDN-------------------------------------------------
A0A0X8UZD5_9ARCH      IVNENN------------------------------------------------------
R9TC03_METII          --EDGH------------------------------------------------------
A0A0U3F394_9CREN      EERETQV-----------------------------------------------------
G0EEX9_PYRF1          EDRPAGR-----------------------------------------------------
E0SPC3_IGNAA          EQHEESKE----------------------------------------------------
I0A0T4_FERFK          EEEKGSS-----------------------------------------------------
A4YCQ9_METS5          EERKEGV-----------------------------------------------------
RPO1N_SACSH           EERKEGV-----------------------------------------------------
B8D6G9_DESA1          EQTERGL-----------------------------------------------------
Q9YAU1_AERPE          EKKPEGD-----------------------------------------------------
D9Q2P3_ACIS3          EVRPEGE-----------------------------------------------------
S5ZUY1_9CREN          EEREEGL-----------------------------------------------------
Q8ZYQ8_PYRAE          EETKSGA-----------------------------------------------------
E1QRA0_VULDI          EEKENGV-----------------------------------------------------
A8MAA2_CALMQ          TESEDGR-----------------------------------------------------
Q74M69_NANEQ          IKEKIGDKE---------------------------------------------------
A0A218NM91_9ARCH      LNGE--------------------------------------------------------
C7DHC4_MICA2          LEGN--------------------------------------------------------
                                                                                  

RPO1N_METTW           ----------------------------------------------GDYKLTPSEVRERL
R9SJC4_9EURY          ----------------------------------------------GDYKLTASEVRERL
Q2NEK4_METST          ----------------------------------------------GTYKLTASEVRERL
E3GYR8_METFV          ----------------------------------------------DGYKLTPTEVRERL
D3DZI7_METRM          -------------------------------------------PVTTDYDLTASEVREKL
Q8U0M4_PYRFU          ---------------------------------------------EYRHRLMPTEVRDWL
F6BAY9_METIK          ----------------------------------------------TEKLLTPSDVREIL
D5EA57_METMS          ----------------------------------------------NDYKLTPTEIRDRL
G7WMA4_METH6          ----------------------------------------------EGHKLTPSDIRDRF
Q0W8G9_METAR          ----------------------------------------------DGHKLMPTDVRDRL
A0A650A1Z2_9EURY      TYRPDRNDIGALQQIGKALSRFNDLEE-HLGEQLDFESASSYLLDEDMDKLMPSDIRDWF
A0A1M5K087_9EURY      MDLADETGI-ALDRINEILSGEFRPRK-EDRKALE-KALDIDLTVEDMNKLMPSDIRDWF
M1Y5V8_NATM8          QGPGDSERIGREHVSLLQIAGEVMSSDGAFGGRFESAPASDFLVSYSGDKLMPSNIRDRF
A2SSM4_METLZ          -------------------------------------------VHKSERKLTSADIRERL
N0BKJ3_9EURY          ----------------------------------------------GDHRLTPKDVRERL
D3T9X0_ACIB4          -------------------------------------------------KLTPKEIRERL
Q6L2F9_PICTO          -------------------------------------------------KITPKEIRERL
A0A6B9TE98_9ARCH      -------------------------------------------------KLTAKEVRERL
M4YUS2_THEXX          -------------------------------------------SPARSHDLTPKEIRARL
A0A0X8UZD5_9ARCH      ------------------------------------------------KKLTPLEVRERL
R9TC03_METII          -------------------------------------------------KLTPKEVRERL
A0A0U3F394_9CREN      ------------------------------------------------SKLTPIDVQKRL
G0EEX9_PYRF1          ------------------------------------------------VPLNPREVRSRL
E0SPC3_IGNAA          -----------------------------------------------VVRLNPLTVRSRL
I0A0T4_FERFK          ------------------------------------------------RKLAPDEIRNRL
A4YCQ9_METS5          ------------------------------------------------MRLTPSDIRERL
RPO1N_SACSH           ------------------------------------------------AKLTPSDIRERL
B8D6G9_DESA1          ------------------------------------------------LKLTPSEVRGRL
Q9YAU1_AERPE          ------------------------------------------------VKLTPSEIRERL
D9Q2P3_ACIS3          ------------------------------------------------VRLTPSDVRERL
S5ZUY1_9CREN          ------------------------------------------------VRLTPLEIWERL
Q8ZYQ8_PYRAE          -----------------------------------------------LVKLDPEVLRERL
E1QRA0_VULDI          -----------------------------------------------LEKLDPMKIRERL
A8MAA2_CALMQ          -----------------------------------------------LTRLDPVSIREWL
Q74M69_NANEQ          ----------------------------------------------EWVKLTPLDVRQWL
A0A218NM91_9ARCH      -------------------------------------------------TLKPDTIRDWL
C7DHC4_MICA2          -------------------------------------------------KMKPDEIRDWL
                                                                        : .  :   :

RPO1N_METTW           ERITDNDSLLLGVNPEVARPEWMVLTVLPVPPVTVRPSITLETGERSEDDLTHKLVDILR
R9SJC4_9EURY          EKITDDDAYVLGVNPEVARPEWMVLTVLPVPPVTVRPSITLDTGERSEDDLTHKLVDILR
Q2NEK4_METST          EMIPEEDYIFIGINPKVARPEWMVLTVLPVPPVTVRPSITLETGERSEDDLTHKLVDILR
E3GYR8_METFV          EKIPDEDCYLLGINPSAARPEYMVLTVIPVPPVTMRPSITLETGERSEDDLTHKLVDILR
D3DZI7_METRM          ERIPDEDAYVLGVNPEVARPEWMVLTVLPVPPVTVRPSITLDTGERSEDDLTHKLVDILR
Q8U0M4_PYRFU          EKIPDKDLPLLGLDPEKSRPEWMVLTVLPVPPVTARPSITLETGIRAEDDLTHKLVDIIR
F6BAY9_METIK          EKIPDEDCILLGLNPEVMRPEWMVLTVLPVPPVTVRPSITLESGERSEDDLTHKLVDIIR
D5EA57_METMS          ERIPDDDLKVMGMDPESARPEWMVLTVLAVPPVTVRPSITLESGQRSEDDLTHKLVDIIR
G7WMA4_METH6          EKIPDEDIKVMGMNPDTARPEWMLLTVLPVPPVTMRPSITLESGQRSEDDLTHKLVDIIR
Q0W8G9_METAR          EMIPDEDIEVFGMDPRNARPEWMVLTVLPVPPVTVRPSITLESGQRSEDDLTHKLVDIIR
A0A650A1Z2_9EURY      EEIPDEDIEAIGINPDRSRPEWMILTVLPVPPVTARPSITLDNGQRSEDDLTHKLVDIIR
A0A1M5K087_9EURY      EDIPDEDLEPLGIHPQKSRPEWMILTVLPVPPVTTRPSITLDNGQRSEDDLTHKLVDIIR
M1Y5V8_NATM8          EAIPDEDIETLGINSDRSRPEWTILTVLPVPPVTARPSITLDNGQRSEDDLTHKLVDIIR
A2SSM4_METLZ          EKIPDDDLRLLGIDPEVARPEWTVLTVLPVPPVTVRPSIILENGQRSEDDLTHKLVDIIR
N0BKJ3_9EURY          ERIPDSDLPVFGMNPKAVRPEWMVLTVLPVPPVTVRPSIILETGQRSEDDLTHKLVDIIR
D3T9X0_ACIB4          ERIPDEDLPLLGMNPETARPEWMVLTVLPVPPVNVRPTITLETGERSEDDLTHKLVDIIR
Q6L2F9_PICTO          ERIPDDDLIFYGLNKDSARPEWMVLTVLPVPPINVRPSITLETGERSEDDLTHKLVDIIR
A0A6B9TE98_9ARCH      ERIPDEDLVTLGIEPSTCRPEWMVLTALAVPPVTVRPSITLDSGDRSEDDLTHKLVDVLR
M4YUS2_THEXX          ELIPDDDLRVLGIDPATCRPEWMILTALAVPPVTVRPSITLDSGDRSEDDLTHKLVDVLR
A0A0X8UZD5_9ARCH      ERIPDDDLRALGMDPAVCRPEWMVLTALAVPPVTVRPSITLESGDRSEDDLTHKLVDVLR
R9TC03_METII          ERIPDDDLLPLGIDPASCRPEWMVLTALAVPPVTVRPSITLESGDRSEDDLTHKLVDVLR
A0A0U3F394_9CREN      ALIPDHHARLLGFDPKEARPEWLVLTVLPVPPIPVRPSIVLESGIRSEDDLTHKLADIVR
G0EEX9_PYRF1          EKIPDDDVKLLGLDPKEARPEWMVLTVLPVPPIHVRPSIVLETGIRAEDDLTHKLADIVR
E0SPC3_IGNAA          ERIPNEDIELLGYDPRDSRPEWMVFTVLPVPPTSIRPSILIETGIRSEDDLTHKLVDIVR
I0A0T4_FERFK          SNTPDDDVRLFGINPEDSRPEWFILTVLPVPPVQVRPSIMLETGIRAEDDLTHKLVDIVR
A4YCQ9_METS5          ERIPDSDVELLGYDPTTSRPEWIILTVLPVPPITIRPSIMIESGIRAEDDLTHKLVDIVR
RPO1N_SACSH           EKVPESDVEILGYDPTTSRPEWMILTVLPVPPITIRPSIMIESGIRAEDDLTHKLVDIVR
B8D6G9_DESA1          EKISNDDVKLLGGDPNDTRPEWMVLTVLPVPPRSVRPSVLLETGIRSEDDLTHKLVDIIR
Q9YAU1_AERPE          EKT-GSEIEILGVHPERSRPEWMVATVLIVPPLAVRPSITLETGLRSEDDLTHALAEIVR
D9Q2P3_ACIS3          EKIPDDDVELLGWDPKSARPEWAVLTVLPVPPLSVRPSITMESGSRAEDDLTHALAEIVR
S5ZUY1_9CREN          SRIPDKDLEVVGIDPKEARPEWMVLRVVPVVPPSVRPSITLESGDRSEDDLTHKLVDIIR
Q8ZYQ8_PYRAE          SKVPSEDLELLGINPSVARPEWAILKVLPVPPPHVRPSIQLETGIRSEDDLTHKLVDIIR
E1QRA0_VULDI          EKIPDSDLELLGWDPKFARPEWAILTVLPVPPPQVRPSIQLETGQRSEDDLTHKLVDIVR
A8MAA2_CALMQ          EKVPDDDLELLGWNPSTARPEWAVLTVLPVPPPQVRPSIQLPSGQTSADDLTHALTTILR
Q74M69_NANEQ          EKIPDEDAKLFGIIN--GRPEWLVLTVILVPPVTARPSIILETGERSEDDLTHKIADIVR
A0A218NM91_9ARCH      ANIPDEDLVSIGIDPNATRPEWLILSVLLVPPVNVRPSITLESGERSEDDLTHKLVEIMR
C7DHC4_MICA2          SGITDEDLKMFNMDAKAARPEWFVLTALLVPPVNVRPSITLESGERSEDDLTHKLVEIMR
                            .    .      ***: :  .: * *   **:: : .*  : ***** :. ::*

RPO1N_METTW           INQRLKENMEAGAPQLIVEDLWELLQYHVTTYFDNEASGVPPARHRS--GRPLKTLAQRL
R9SJC4_9EURY          INQRLIENMEAGAPQLIVEDLWELLQYHVTTYFDNEASGVPPARHRS--GRPLKTLAQRL
Q2NEK4_METST          INQRLKENMEAGAPQLIVEDLWELLQYHVTTYFDNEASGVPPARHRS--GRPLKTLAQRL
E3GYR8_METFV          INERLRENMEAGAPELIIEDLWELLQYHVVTYFNNEASGVPPARHRS--GRPLRTLMQRL
D3DZI7_METRM          INQRLIENMDAGAPQLIVEDLWQLLQYHVTTYFDNEASGVPPARHRS--GRPLKTLAQRL
Q8U0M4_PYRFU          INNRLKQNIEAGAPQLIIEDLWDLLQYHVTTYINNEAPGVPPAKHKS--GRPLKTLAQRL
F6BAY9_METIK          INQRLEENIEGGAPNLIIEDLWDLLQYHVNTYFDNEAPGIPPARHRS--GRPLRTLAQRL
D5EA57_METMS          INQRFQENRDAGAPQLIIEDLWELLQYHLTTFFDNEVSGVPPARHRS--GRPLKTLTQRL
G7WMA4_METH6          INQRFQENREAGAPQLIIEDLWELLQYHITTFLDNTVSGVPPARHRS--GRPLKTLSQRL
Q0W8G9_METAR          INQRFQENRDAGAPQLIIEDLWELLQYHVTTYMDNAVSGVPPARHRS--GRPLKTLSQRL
A0A650A1Z2_9EURY      INQRFMENREAGAPQLIIEDLWELLQYHVTTFMDNEISGTPPARHRS--GRPLKTLSQRL
A0A1M5K087_9EURY      INQRFMENREAGAPQLIIEDLWELLQYHVTTFVDNEISGTPPARHRS--GRPLKTLSQRL
M1Y5V8_NATM8          INQRFMENREAGAPQLIIEDLWELLQYHVTTFMDNEISGTPPARHRS--GRPLKTLSQRL
A2SSM4_METLZ          INQRFKENQDAGAPQLIIEDLWELLQYHVTTYLDNEVAGCPPARHRS--GRPLKTLSQRL
N0BKJ3_9EURY          INQRFIENKDAGAPQLILEDLWELLQYHVTTYLDNEVSGIPPARHRS--GRPLKTIAQRL
D3T9X0_ACIB4          INQRLRENRDSGAPQLIIEDLWELLQYHVTTYFDNQTSGIPPARHRS--GRPLKTLVQRL
Q6L2F9_PICTO          ISQRLRESRDNGSPQLIIEDLWDLLQYHVTTYFDNQTAGIPPARHRS--GRALKTLVQRL
A0A6B9TE98_9ARCH      INQRLRENRDAGAPQLIVEDLWELLQYHVTTYFDNQTSGIPPARHRS--GRPLKTLAQRL
M4YUS2_THEXX          INQRLRENRDAGAPQLIIEDLRELLQYHITTYFDNQTSGTPPARHRS--GRSLKTLAQRL
A0A0X8UZD5_9ARCH      INQRLRENRDNGAPQLIVEDLWELLQYHVTTYFDNQTSGIPPARHRS--GRPLKTLAQRL
R9TC03_METII          INQRLRENRDAGAPQLIVEDLWELLQYHVTTYYDNQTSGIPPARHRS--GRPLKTLVQRL
A0A0U3F394_9CREN      INNKLRDNLESGASEAMIENLWDLLQYHVATFFDNEIPGVPPSRHRS--GKPLRTIAQRL
G0EEX9_PYRF1          TNEKLRETLESGMPHSVIDEWWNLLQYHVATYIDNELPKIPVARQRGGLGRPLKGLAQRL
E0SPC3_IGNAA          TNERLREHISAGAPQIIIDDLWELLQYHVTTYLDNEVPGLPPAKHRS--GRPLKTLAQRL
I0A0T4_FERFK          TNQRLKESMEAAAPPIVIDDIWELLQYHVTTYFDNEVPGIPPAKHRT--GRALKTLAQRL
A4YCQ9_METS5          INERLKESIDAGAPQLIVEDLWDLLQYHVATYFDNEIPGLPTSKHRS--GRPLRTLAQRL
RPO1N_SACSH           INERLKESIDAGAPQLIIEDLWDLLQYHVATYFDNEIPGLPPSKHRS--GRPLRTLAQRL
B8D6G9_DESA1          TNNRLREHVEGGAPSAIIEDEWELLQYHITTYFDNEVPGLPVAKHRS--GKTLKGIAQRL
Q9YAU1_AERPE          QNEKLRNVIVTNAPETLIEENWMVLQEMVAAYIDNELPGARRLTHRR--KRYLKTLAQRL
D9Q2P3_ACIS3          QNERLKNFISSSAPESMIEEAWQALQNVIAAYIDNELPNIYQLSHRG--RKQLKTLAQRL
S5ZUY1_9CREN          VNQRLKENIDSGSPSLVIEDLWGLLQYHVATYFDNELPGIPPARHRS--GRALRTLAQRL
Q8ZYQ8_PYRAE          MNEKLKIAIETGAPTNVVDNLWELLQYHVATYFDNELPGIPVAKHRG--GRPLKGIAQRL
E1QRA0_VULDI          VNEKLRTAIDSGAPSSVVDQLWDLLQYHVATYFNNELPNLPPVKHRS--GRPLKTLAQRL
A8MAA2_CALMQ          YNEKLRNAIESGSPTTSILDLWDSLQANVATYIDNELPGGIQARHRS--KRPLKGIAQRL
Q74M69_NANEQ          INNRIEELLSYGAPEPILEENWEMLQYHVATYFDNELPNVPKARHRS--GRPLKGLLQRI
A0A218NM91_9ARCH      INERLSQDIDAGAPQIIIDDLWELLQYHVTTYFNNETPGVPVARHRS--TKPLKTLAQRL
C7DHC4_MICA2          INQRLEQDIDAGAPQIIIDDLWELLQYHVTTYFNNETPGVPVARHRS--TRPLKTIAQRL
                       .:::        .   : :    **  : :: :*  .      ::    : *: : **:

RPO1N_METTW           KGKEGRFRSNLSGKRVNFSARTVVSPDPNVSVNEVGVPELIAKEVTVPVYVTEWNIDRMK
R9SJC4_9EURY          KGKEGRFRSNLSGKRVNFSARTVISPDPNISINEVGVPEMIAKEVTVPTYVNEWNIDEMR
Q2NEK4_METST          KGKEGRFRSNLAGKRVNFSARTVISPDPTLSINEVGVPEMIAKEVTVPIAVTEWNMEKMK
E3GYR8_METFV          KGKEGRFRGNLSGKRVNFSARTVISPDPNLSINEVGVPEIIAKELTVPVRVNEWNIEEVK
D3DZI7_METRM          KGKEGRFRSNLSGKRVNFSARTVISPDPNISINEVGVPEMIAKEVTVPTYVNEWNIEDLR
Q8U0M4_PYRFU          KGKEGRFRGNLSGKRVNFSARTVISPDPMISINEVGVPVEVAMELTVPEKVTEFNIERLR
F6BAY9_METIK          KGKEGRFRHNLAGKRVNFSARTVISPDPCLSINEVGVPEVVAKELTVPEKVTKYNIDKIR
D5EA57_METMS          KGKEGRFRGSLSGKRVNFSARTVVSPDPNLSINEVGVPYQIAKHMTIPVRVISRNLEMMR
G7WMA4_METH6          KGKEGRFRGSLSGKRVNFSARTVISPDPNLSINEVGVPLEIAMELSVPLVVNGRNIEVMR
Q0W8G9_METAR          KGKEGRFRGSLSGKRVNFSARTVISPDPNLSINEVGVPLRIAKEMTVPVTVTPFNIEVVR
A0A650A1Z2_9EURY      KGKEGRFRGSLSGKRVNFSARTVISPDPTLSLNEVGVPDRVASEMTQTMNVNERNLEDAR
A0A1M5K087_9EURY      KGKEGRFRGSLSGKRVNFSARTVISPDPTLSLNEVGVPERVAEEMTQVMNVAERNIDRAR
M1Y5V8_NATM8          KGKEGRFRGSLSGKRVNFSARTVISPDPTLSLNEVGVPDRVASEMTQTMNVNERNLQDAR
A2SSM4_METLZ          KGKDGRFRGSLSGKRVNFSARTVISPDPNLSIGEVGIPLAIANEMSVPVRVTKQNLEDMR
N0BKJ3_9EURY          KEKEGRFRGSLSGKRVNFSARTVISPDPNLSIMEVGVPISIAQELTVPIFVTEKNIDEAR
D3T9X0_ACIB4          KGKEGRFRSNLSGKRVNFSARTVISPEPFLSINEVGVPEAAARELTVPITVTEYNIEKMK
Q6L2F9_PICTO          KGKEGRFRANLSGKRVNFSSRTVISPEPFLSINEVGVPERAAREMTVPVTVNAFNIDVMR
A0A6B9TE98_9ARCH      KGKEGRFRSNLSGKRVNFSARTVISPDPLLSINEVGVPIIAARELTVPVHVNEHNIEKIR
M4YUS2_THEXX          KGKEGRFRSNLSGKRVNFSARTVISPDPNLSINEVGVPVIAARELSVPMHVNERNIEKMR
A0A0X8UZD5_9ARCH      KGKEGRFRSNLSGKRVNFSARTVISPDPNLSINHVGVPVRAARELTVPMHVNEHNLEEMR
R9TC03_METII          KGKEGRFRSNLSGKRVNFSARTVISPDPALSINEVGVPYSAARELTVPVRATRSNIEALR
A0A0U3F394_9CREN      KGKEGRFRANLSGKRVDFSARTVISPDPNISINEVGVPEEVAKILTVPVRVTPWNIEEMR
G0EEX9_PYRF1          KGKEGRFRGNLSGKRVNFSARTVISPDPNISINEVGVPIEIAKILTVAVRVTPWNIEELR
E0SPC3_IGNAA          KGKEGRFRGNLSGKRVDYSARTVISPEPYLSINEVGVPIDVAKILTVPEKVTEWNIEEMR
I0A0T4_FERFK          KGKEGRFRGYLSGKRVDFSSRTVISPDPNIGINEVGVPEDAAKILTVPVKVTQWNLEEMR
A4YCQ9_METS5          KGKEGRFRGNLSGKRVDFSARTVISPDPNISIDEVGVPYDVAQILTVPEKVTKWNIERMR
RPO1N_SACSH           KGKEGRFRGNLSGKRVDFSSRTVISPDPNISIDEVGVPEIIARTLTVPERITPWNIEKLR
B8D6G9_DESA1          KGKEGRFRNNLRGKRVDFSARTVISPDPSLSINEVGVPEDVAKILTIPERVTPWNIEEMR
Q9YAU1_AERPE          KGKDGRIRGNLSGKRVNYSARTVISPDPYISINEVGVPEEIAKTLTIAMRVTPYNLEEAR
D9Q2P3_ACIS3          KGKEGRLRGNLNGKRVNFSSRTVISPDPLISINEVGVPIEVAKILTVPMVVTKFNIEEAR
S5ZUY1_9CREN          KGKEGRFRGSLAGKRVDFSSRTVISPDPNLSINEVGVPIDVAKVLTVPEKVTSWNIEKMR
Q8ZYQ8_PYRAE          KGKEGRFRGSLSGKRVNFSARTVISPDPHISINEVGVPYDIAKVLTVPERVTAWNVDVLR
E1QRA0_VULDI          KGKEGRFRGSLSGKRVDFSSRTVISPDPNLSINEVGVPIDVAKILTVPMTVTEWNIEMAR
A8MAA2_CALMQ          KGKEGRFRGSLSGKRVEFSARTVISPDPNLSINEVGVPIDIAKELTVVEPVTEWNIDLMR
Q74M69_NANEQ          KGKEGRLRRNLAGKRVNFSARGVISVDPRIDIDEVGVPEQVAKELTFPEIVTEWNLDWLK
A0A218NM91_9ARCH      KGKEGRLRYNLSGKRVNFSARSVISSDASLTINQVGVPMKIASVMTIPLYVTKWNIEAAK
C7DHC4_MICA2          KGKEGRLRYNLSGKRVNFSARTVISSDSSLTVNQVGIPIKMAENLTVPVYVTKWNIDAAK
                      * *:**:*  * ****::*:* *:* :. : : .**:*   *  ::        *::  :

RPO1N_METTW           EHIENGP-----------------------------DVHP-----GANYVIRP----DGR
R9SJC4_9EURY          EYIKNGP-----------------------------NVHP-----GANYVVRL----DGR
Q2NEK4_METST          EYINNGP-----------------------------DVHP-----GANYIIRP----DGR
E3GYR8_METFV          KYIKNGP-----------------------------DKHP-----GANYVIRP----DGR
D3DZI7_METRM          EAILNGP-----------------------------DAHP-----GANYVRKY----NDR
Q8U0M4_PYRFU          KMVLNGP-----------------------------DKYP-----GANYVIDP----EGR
F6BAY9_METIK          ELLKNGS-----------------------------EKHP-----GVNYVIKKVKLRDGR
D5EA57_METMS          AYVARGG-----------------------------ETHP-----GANYVFRE----DGR
G7WMA4_METH6          DFVRRGA-----------------------------DKHP-----GVNYVTRA----DGR
Q0W8G9_METAR          EYVRRGS-----------------------------ENHP-----GANYVKRA----DGR
A0A650A1Z2_9EURY      RYVANGP-----------------------------EAHP-----GANYVRRP----DGR
A0A1M5K087_9EURY      QYVRNGP-----------------------------EAHP-----GANYVKRP----DGR
M1Y5V8_NATM8          RYVSNGP-----------------------------EVHP-----GANYVKRP----DGR
A2SSM4_METLZ          ALIRIGP-----------------------------HRPTLRDPCGANYVNRP----DGR
N0BKJ3_9EURY          EYILRKE-----------------------------HPK-------ANYVIRS----DGR
D3T9X0_ACIB4          EIVRRGS----------------------------NPKGD-KYLPGANYVIRP----DGR
Q6L2F9_PICTO          EWVKRGP----------------------------NPENNGKYIAGVNYLIRP----DGR
A0A6B9TE98_9ARCH      EMVARGP---------------------------SPTPDKP-YLPGVNYVIRS----DGR
M4YUS2_THEXX          EYVKRGP---------------------------SPADDENGYVFGVNYVIRN----DGR
A0A0X8UZD5_9ARCH      KFVMRGPIAFGRFLNKEDGTYDLEASNAYIAKGLTDEEMDEDFLTGVNYVFRN----DGR
R9TC03_METII          EMVKRGN---------------------------NPAIENGKYLPGVNYVIRP----DGR
A0A0U3F394_9CREN      QLVINGP-----------------------------ERWP-----GANYVITP----QGQ
G0EEX9_PYRF1          KYVINGP-----------------------------DKWP-----GANYVIDP----RGR
E0SPC3_IGNAA          KLVINGP-----------------------------NRWP-----GANYIITP----DGR
I0A0T4_FERFK          SYVLNGP-----------------------------YKWP-----GANYIIRP----DGK
A4YCQ9_METS5          QYVINGP-----------------------------DKWP-----GANYVVRP----DGR
RPO1N_SACSH           QFVINGP-----------------------------DKWP-----GANYVIRP----DGR
B8D6G9_DESA1          KLVLNGP-----------------------------EKWP-----GANYIVRP----DGR
Q9YAU1_AERPE          RYVLNGP-----------------------------DKWP-----GALFVYKAS---ERK
D9Q2P3_ACIS3          KYVLNGP-----------------------------YQWP-----GATIVYKKR---EGV
S5ZUY1_9CREN          QLVINGP-----------------------------DVWP-----GANYIIKP----DGS
Q8ZYQ8_PYRAE          EYVIRGP-----------------------------ESWP-----GANYVVTP----EGR
E1QRA0_VULDI          QLVLNGP-----------------------------EVWP-----GANYVVYP----DGR
A8MAA2_CALMQ          MLVVNGP-----------------------------ETWP-----GANRVITP----DGK
Q74M69_NANEQ          QKVLNGP-----------------------------ESLD-----GANYVIDP----NGR
A0A218NM91_9ARCH      KFILNPD-------------------------------YP-----KALNVISK----GGI
C7DHC4_MICA2          KFLENKE-------------------------------YP-----TVVNVITK----DGM
                        :                                           .  :          

RPO1N_METTW           -----KIRAYNE---TKDVVLENLKPGYIVERHLKDG-----DIVLFNRQPSLHRMSMMA
R9SJC4_9EURY          -----KIRIYDE---TKDKILEQLEPGFIVERHLHDG-----DMVLFNRQPSLHRMSMMA
Q2NEK4_METST          -----KIRVYDE---TKEMVVENLKPGYIVERHIIDG-----DIVLFNRQPSLHRMSMMA
E3GYR8_METFV          -----KIKIYEE---NKEAILEQLKPGYIVERHLKDG-----DIVLFNRQPSLHRMSMMA
D3DZI7_METRM          IKDYNKVRVLDS---NKETVAEMLTCGDIVMRHLKDG-----DIVLFNRQPSLHRMSMMA
Q8U0M4_PYRFU          -----RRRIMDS---NKETLANQLDIGWTVERHLMDG-----DIVLFNRQPSLHRMSIMA
F6BAY9_METIK          -EEEVKIKITEK---NKDFWVENIEEGMIVERHLMDG-----DIVLYNRQPSLHRMSIMA
D5EA57_METMS          -----RLKITEA---NKEELSEKLEPGWTVERQMQDG-----DIVLFNRQPSLHKMSIMA
G7WMA4_METH6          -----RVKVTDR---NAEEVADQLEPGWKVDRQLMDG-----DIVLFNRQPSLHRMSIMS
Q0W8G9_METAR          -----RLKITDK---NCEELADQIEVGWKVDRQLKDG-----DIVLFNRQPSLHRMSIMS
A0A650A1Z2_9EURY      -----RLKVTEK---NCEELAEKVEPGWEVARHLVDG-----DIIIFNRQPSLHRMSIMA
A0A1M5K087_9EURY      -----RLKVTEK---NCEELAEKVEPGWEVNRHLVDG-----DIVIFNRQPSLHRMSIMA
M1Y5V8_NATM8          -----RLKVTEK---NCEELAEKIQPGWEVARHLIDG-----DIVIFNRQPSLHRMSIMA
A2SSM4_METLZ          -----RIRLIAGEEGNCDTVAEMIEPGWKIDRQLRDG-----DIVLFNRQPSLHRMSIMS
N0BKJ3_9EURY          -----RIRVLDL---NAEEIAERLEPGWIVERQLKDG-----DIVLFNRQPSLHRMSIMA
D3T9X0_ACIB4          -----RIKITDR---NAEDVSKKLDIGWVVERHLIDG-----DVVLFNRQPSLHRMSMMG
Q6L2F9_PICTO          -----RVKITKD---NAEENSKRLDIGWTVERQLNEG-----DIVLFNRQPSLHRMSMMA
A0A6B9TE98_9ARCH      -----RIRVTDR---NAADVAEGIDIDYTVERQLVDG-----DVVLFNRQPSLHRMSMMA
M4YUS2_THEXX          -----KIRVTPD---NAETVAEGLSIDYVVWRQLIDG-----DIVLFNRQPSLHRMSIMA
A0A0X8UZD5_9ARCH      -----RIKVTSE---NAPTVAENLNIDYVIERQLSDGRNGEKDIVLFNRQPSLHRMSIMA
R9TC03_METII          -----RMKVTER---NAETIAEGLELEYVIERHLMDK-----DVVLFNRQPSLHRMSMMA
A0A0U3F394_9CREN      -------RIDLKFRKDRKELASALKPGYIIERHLQNG-----DVVLFNRQPSLHRMSIMA
G0EEX9_PYRF1          -------KIDLRF-ADRKSIAEALQPGWIVERHLKDG-----DIVLFNRQPSLHRMSIMA
E0SPC3_IGNAA          -------RIDLRYVKDRKSVAESLAPGYIVERHVRDG-----DIAIFNRQPSLHRMSMMG
I0A0T4_FERFK          -------RVDLRYFKDRKALASSLTPGYIIERHLIDG-----DIVLFNRQPSLHRMSIMA
A4YCQ9_METS5          -------RIDLRYVKDRKELAATLAPNFIVERHLVDG-----DIVIFNRQPSLHRISMMG
RPO1N_SACSH           -------RIDLRYVKDRKELASTLAPGYVVERHLTDG-----DVVLFNRQPSLHRISMMA
B8D6G9_DESA1          -------KISLKF-VDRKAAAESLESGFIVERHLMDG-----DIVLFNRQPSLHRISVMA
Q9YAU1_AERPE          -------KYDLRFFKDYEKLAESLEPGDVVERHLING-----DIVLFNRQPSLHRMSIMG
D9Q2P3_ACIS3          -------KLDLRYQRNLRQLAESLEVGDIVERHLIDG-----DIVLFNRQPSLHRMSIMG
S5ZUY1_9CREN          -------RIDLRFAKHREELSQALAPGYIVERHLMDG-----DIVLFNRQPSLHRISIMA
Q8ZYQ8_PYRAE          -------RIDLRYVKDRKALAERLAPGWIVERHLIDG-----DIVLFNRQPSLHRVSMMG
E1QRA0_VULDI          -------RVDLRYFRDRRELANKLAPGFIVERHLMNG-----DIVLFNRQPSLHRMSMMG
A8MAA2_CALMQ          -------KIELKVRRDRSELAQQIQPGWMIERHLMDG-----DYVLFNRQPSLHKMSMMC
Q74M69_NANEQ          -----RFKIMEE---NKEELAERLEPGWVVERHIING-----DYALFNRQPSLHKMSMMG
A0A218NM91_9ARCH      -----RKRVTET---NREDLVASLEPGDVVERQLMDN-----DLVLFNRQPTLHRLSIMA
C7DHC4_MICA2          -----RKRVSDL---NREELLKEVEPGYVLERQLIDN-----DIVLFNRQPTLHRLSIMA
                             :               :     : *:: :      *  ::****:**::*:* 

RPO1N_METTW           HEVRVLPYKTFRLNLCVCPPYNADFDGDEMNMHVFQTEESRAEAKTLMRVQDHILSPRFR
R9SJC4_9EURY          HEVKVLPYKTFRLNLCVCPPYNADFDGDEMNMHIFQTDEARAEAKSLMRVQEHILSPRFG
Q2NEK4_METST          HEVRVLPYKTFRLNLCVCPPYNADFDGDEMNMHVFQTPEARAEANDIMKVQEHILSPRYG
E3GYR8_METFV          HEVKVLPYKTFRLNLCVCPPYNADFDGDEMNLHVLQTEEAQAEAKTLMKVQEHILSPRFG
D3DZI7_METRM          HEVRVLPYKTFRLNLCVCPPYNADFDGDEMNMHVFQTDESRAEAKSLMRVQEHILSPRFG
Q8U0M4_PYRFU          HRVRVMPYRTFRLNLAVCPPYNADFDGDEMNLHVPQTEEAQAEARILMEVQNHIISPRYG
F6BAY9_METIK          HRVKVLPYRTFRHNLCVCPPYNADFDGDEMNLHVPQSEEARAEAEALMLVEKHILSPRFG
D5EA57_METMS          HKVKVLPNKTFKLNPAVCPPYNADFDGDEMNMHVLQTEESRAEANILMQVQENILSPRFG
G7WMA4_METH6          HRVIVMPHKTFRLNPAVCPPYNADFDGDEMNLHVPQTEEARAEAEILMRVQENILSPRFG
Q0W8G9_METAR          HFVRVMPHKTFRLNPAVCAPYNADFDGDEMNLHVPQTMEALAEARILMLVQENILSPRFG
A0A650A1Z2_9EURY      HEVVVMPYKTFRLNTTVCPPYNADFDGDEMNMHALQNEEARAEARVLMRVQEQMLSPRFG
A0A1M5K087_9EURY      HEVVVMPYKTFRLNTVVCPPYNADFDGDEMNMHALQNEEARAEARVLMRVQEQILSPRFG
M1Y5V8_NATM8          HEVVVMPYKTFRLNTTVCPPYNADFDGDEMNMHALQNEEARAEARVLMRVQEQILSPRFG
A2SSM4_METLZ          HHIKVMNGRTFRLNPAVCPPYNADFDGDEMNLHVPQTEEARAEAELLVAVQENILSPRFG
N0BKJ3_9EURY          HYVRVLPYKTFRLNPAVCPPYNADFDGDEMNLHVPQSLEAQAEAKVLMAIQEHILSPRFG
D3T9X0_ACIB4          HLVKVMPNRTFRFNLAVCPPYNADFDGDEMNLHVLQSEEARAEAKILMLVQEHILSPRFG
Q6L2F9_PICTO          HTVRILPGLTFRFNLAVCTPYNADFDGDEMNLHVVQSEEARAEARIIMKVQEQIMSPRFG
A0A6B9TE98_9ARCH      HRVRIMEGRTFRFNLTDCPPYNADFDGDEMNLHVLQSDEARAEARILMQVQENILSPRYG
M4YUS2_THEXX          HRVRVMKGRTFRFNLCVCAPYNADFDGDEMNLHVLQSEEARAEARIIMQVQENILSPRYG
A0A0X8UZD5_9ARCH      HRVVVMKGRTFRFNLTDCAPYNADFDGDEMNLHVLQSEEARAEARIIMQVQENILSPRYG
R9TC03_METII          HTVRVMPWKTFRFNLCVCPPYNADFDGDEMNLHVLQSDEARAEALILMRVQEHILSPRFG
A0A0U3F394_9CREN      HLVRILPGRTFRLNPLVCPPYNADFDGDEMNLHVPQSEEARAEARELMLVEKHILSPRYG
G0EEX9_PYRF1          HIVRVLPGKTFRLNLLVCPPYNADFDGDEMNLHVPRTEEAQAEARELMLVQFHILTPRYG
E0SPC3_IGNAA          HIIKVLPGKTFRLHLAVCPPYNADFDGDEMNLHIPQTEDARAETRLLLKVQNHILTPRYG
I0A0T4_FERFK          HQVKVLPGRTFRLNLLVCPPYNADFDGDEMNLHVPQTEEARAEAKELMLVQRHILSPRYG
A4YCQ9_METS5          HKVRVLPGRTFRLNLLVCPPYNADFDGDEMNLHVPQSEEAIAETKELMTVHRNILTPRYG
RPO1N_SACSH           HRVRVLKGLTFRLNLLVCPPYNADFDGDEMNLHVPQSEEAIAEAKEIMLVHKNIITPRYG
B8D6G9_DESA1          HVVRVLPYKTFRLNLLVCPPYNADFDGDEMNLHVPQSEEARAEARLLMLVERHILTPRYG
Q9YAU1_AERPE          HIVRVMPGKTFRLNLLVCPPYNADFDGDEMNLHVPRLEEAQAEAREIMLVEKHILTPRYG
D9Q2P3_ACIS3          HKVRVMPGRTFRLNLLVCAPYNADFDGDEMNLHVPRLEEARAEALNLLLVENHILTPRYG
S5ZUY1_9CREN          HVVRVLPYKTFRLNLLVTIPYNADFDGDEMNLHVPQSEEARAEARELMLVERHIMTARYG
Q8ZYQ8_PYRAE          HLVKVLPGRTFRLHLAVCPPYNADFDGDEMNLHVPQTEEARAEARALMLVEKHIITPRYG
E1QRA0_VULDI          HIVRVLPGRTFRLHLAVCPPYNADFDGDEMNLHVPQNEEARAEAKTLMLVQNHIITPRYG
A8MAA2_CALMQ          HIVKVLPGRTFRLHLAVCPPYNADFDGDEMNLHVPQTPEARAEARTIMLVQNFIVTPRYG
Q74M69_NANEQ          HRSVILPGKTFRLNPATTTPYNADFDGDEMNYHLVQNYEGKTEIEFLANVREHIVTPRYG
A0A218NM91_9ARCH      HRVKVMPGKTFRIQVSAAYPYNADYDGDEMNLHVPQTLEAQAEAMYMMQPKNLMLSARHG
C7DHC4_MICA2          HRVKVLPGKTLRLHVSIAYPYNADFDGDEMNLHVPQTLEAQAEARYLMQPKYLVLSPRDG
                      *   ::   *:: :     *****:****** *  :  :. :*   :   .  :::.*  

RPO1N_METTW           D-LSSGVYTTISQEHTSSQGKRLFSVRSRPPDPQEGRAPP--------------------
R9SJC4_9EURY          GPIIGAIHDHISGGYLLTRTGSEFTEEQAFQVIRKSHLKM--------------------
Q2NEK4_METST          GPIIGAIHDHITGAYLLTHASTVYPEDKAFQIIKRSKMEL--------------------
E3GYR8_METFV          GPIIGAIHDHISGAYLLTKKGTKFSEDEVFQMLMRAGVPL--------------------
D3DZI7_METRM          GPIIGAIHDHISGAYLLTRDGFTVPEDDAFQMIRKSHLLKCPYDEYLKRDLDEKEYKQQI
Q8U0M4_PYRFU          GPIIGGIQDHISGGYLLTREGAYFTRDEVEQMLMFAGVDITELPE---------------
F6BAY9_METIK          GPIIGAIHDYITGAYLLT--SSYFTKDEASIILRSGGIKDELWE----------------
D5EA57_METMS          GPIIGGIHDHISGMFLLTRNENMISKNDALELLRKSEVREL-------------------
G7WMA4_METH6          GPIIGGIHDYVTGNFLLTHGDRRISRIEVMEVLKKLHHLEI-------------------
Q0W8G9_METAR          GPIIGGLHDHVSGIYLLTKGYRLYTETDALEILSKVNVHEL-------------------
A0A650A1Z2_9EURY      ENIVGAIQDHVTAMYLLTNQNPTFNETQALDLLRATNVDTL-------------------
A0A1M5K087_9EURY      ENIIGAIQDHISGTYLLTHDNPEFTETQALDLLRATSVDEL-------------------
M1Y5V8_NATM8          ENIIGAIQDHISGLYLLTHENPQFNETQALDLLRATSIDGL-------------------
A2SSM4_METLZ          GPIIGGLHDHISGIFLLTNQLKWYTKSEFLYLLKYTAMEHL-------------------
N0BKJ3_9EURY          GPIIGGIHDHISGLYLLTRGEKKFTKEEVIYLTRRLDVGEI-------------------
D3T9X0_ACIB4          GPIIGGIHDHITAMFLLTHKNPKFTKEQAIHMLSYLDYDEL-------------------
Q6L2F9_PICTO          GPIIGAIHDHITALFLLTHNNPLFTEEETLHMTSYMDISRM-------------------
A0A6B9TE98_9ARCH      GPIIGAIHDHITGAYFLTHNNPRFDRFQAMNILFKLGDIEV-------------------
M4YUS2_THEXX          GPIIGGIHDHISGSYFLTHGNPHFGKWETMNILMKLPEIEP-------------------
A0A0X8UZD5_9ARCH      GPIIGGIHDHISGSYFLTHGDVRFNRYETMNILYKLSDVGLGGKKNMLFEELNKDGARPI
R9TC03_METII          GPIIGAIHDHITGAFLLTHKNPHFDVQDTINILSKVKFDEM-------------------
A0A0U3F394_9CREN      GPIIGGLQDYISGAYLLTTVATLLDEKDVAELLGVTGYTGE-------------------
G0EEX9_PYRF1          GVIIGGLQDYISGAYLLTSKATILTLDDVVDLLAAAKYEGE-------------------
E0SPC3_IGNAA          GIIIGAIQDYISGAYILTIKTTLLKKEDVIDLLSAAGVVKE-------------------
I0A0T4_FERFK          GPIIGGLQDYISGGYLLTSKATLLEKEDVIEVLSVTGYKEE-------------------
A4YCQ9_METS5          GPIIGSAQDYISGAYLLTVKTTLLTEDEVQTILGVANINKN-------------------
RPO1N_SACSH           GPIIGAAQDYISGAYLLTVKTTLLTKEEAQQILGVADVKID-------------------
B8D6G9_DESA1          GPIIGGLQDYISGAYILTSKTTLLDKDDVVDLLSSTGYKGE-------------------
Q9YAU1_AERPE          GPIIGGRQDYVSGAYLLTVKTRLFTKEEVERLLSVAGYKGD-------------------
D9Q2P3_ACIS3          GPIIGGRQDYISGAYLLTVKTTLFDREAVGRLLAAASYSGE-------------------
S5ZUY1_9CREN          APIIGGLHDYITGAYLLTRKDTLLDKKEALRLLYLGNNSEP-------------------
Q8ZYQ8_PYRAE          GAIIGARQDYIIGAYLLSHKSTFLTKKEVAFLLGAGKSQED-------------------
E1QRA0_VULDI          GPIIGARQDYITGGYLLTRKDTFVNKELLMYLLAAANYDGE-------------------
A8MAA2_CALMQ          GPIIGARQDYISGGYLLSRKGNVLTREKALFILGAVRENVQ-------------------
Q74M69_NANEQ          LAIIGATEDIITGLYLLSLKDKIPFKDAIQLIEYNCKYFGKDK-----------------
A0A218NM91_9ARCH      QPVFYAEEDEIAGAYFLTKGDTYYTKDEAALMLAYIGIFDLP------------------
C7DHC4_MICA2          QPIIFSEEDEIAGIYLLTKDNAYFSKEESCRMLSNVGIYELP------------------
                        :  .    :   .  :                                          

RPO1N_METTW           ------PDREGRE----WTVKEIFSMVLPDDLNMVYLAEICRKCDECLE-----------
R9SJC4_9EURY          ------PKRKHEN----WTGKELFSLLLPDDLNMTYKAEICQKCDVCLK-----------
Q2NEK4_METST          ------PESKGRD----WTGKEIFSLLLPDKLNLIYKAEICRKCEECKH-----------
E3GYR8_METFV          ------PKKKGRD----WTGKEIFSVLLPDDLNLVYRAEICKNCPDCKM-----------
D3DZI7_METRM          KEYNEKLKRKHRD----WTGKELFSLLLPSTLNMNYRAEICRKCEECMA-----------
Q8U0M4_PYRFU          ------PDKYDENGNPLWSGKTIFSLLLPEDLTVWYRNKLCDEPERCEALEKLIEEKLMP
F6BAY9_METIK          -------PDKIENGIPLYSGKKIFSKALPKGLNLKYRAKICKKCDECKK-----------
D5EA57_METMS          ----PEPAGYTDVGDPFWTGKQIFSQILPKDLNLEFKANVCFKCDVCKGRD-CE------
G7WMA4_METH6          ----PEPVGWNEAGEPYWTGKQIFSLILPRGLNLEFKASFCKNCDSCKREA-CD------
Q0W8G9_METAR          ----PEPYK-VENGIRYYSGKQIFSQILPKGLDMTYKAKICENCEECKGEL-CE------
A0A650A1Z2_9EURY      ----PEPDGEED-GNAYWTGRSIFSELLPDDLNLEFTSEAGDD-----------------
A0A1M5K087_9EURY      ----PEPDGTNDAGQEVWTGQTVFSELLPDDLNLEFTSSTGDD-----------------
M1Y5V8_NATM8          ----PAPDGVDDDGIEYWTGRSLFSELLPDGLDLEFTSSAGDS-----------------
A2SSM4_METLZ          ----PEPGK-VENGIPYWSNKQAFSMILPKDVNMFYKATCCRNCDPCTKNTFCP------
N0BKJ3_9EURY          ----PEPK---EDG--YWTGKQIFSMILPKDISLEYKAEICQGCAECKGED-CE------
D3T9X0_ACIB4          ----PEPH-KDENGNEFYYGKELFSLILPKDLNMEFKSKICDPSVCNNKCVHEA------
Q6L2F9_PICTO          ----PEPV-IID-GKRYYHGRDIFSLTLPPGLNVKFKSHLC--SGAKDKCEYEN------
A0A6B9TE98_9ARCH      ----PEPC-IDEKGEPYWTGKQLFSIVLPDDFRTTFKANICQNCKQCRKEECE-------
M4YUS2_THEXX          ----PEPAGTDENGEPYWTGRQLFSLVLPDNFNIKFKSSITKSLD---KDDPD-------
A0A0X8UZD5_9ARCH      ----PEPSGTDENGQPYWTGKDLFSIALPEDLNLTYRAAVCQCGGRCQGQNPGGV-----
R9TC03_METII          ----PEPN-FDENGNKYWTGYQMFSMILPDDFRITFKSSICRHCQTCLKENCD-------
A0A0U3F394_9CREN      -----MPEPAFISPKKVWTGKRLFSVFLPKDFNYSGKANIATGE-LKCDNEYCF------
G0EEX9_PYRF1          -----IPEPVILSPKKLWTGKQLVSLFLPKDFTFRGKAKISSGA-FACSDELCW------
E0SPC3_IGNAA          -----LPEPAILSPKRLWTGKQIISMFLPEDFNYHGKANISSGP-LKCEDIECF------
I0A0T4_FERFK          -----LPEPAIYSPKEFWTGKQLVSLFLPKDFTLKTKASINAGK-LKCEDEDCL------
A4YCQ9_METS5          -----LEEPAILAPKRLYTGKQIVSHFLPEDFNFHGPANISSGV-RSCKDEDCP------
RPO1N_SACSH           -----LGEPAILAPREYYTGKQVVSAFLPKDFNFHGQANVSSGP-RLCKNEDCP------
B8D6G9_DESA1          -----LPEPAILKPRALWTGKQLVSLFLPKDFNYKRNSKIGSAAALRCIDEDCP------
Q9YAU1_AERPE          -----LPEPAILKPEPLWTGKQLASIFLPEDLSFKGKSKTNAGD-LACSDELCL------
D9Q2P3_ACIS3          -----LPEPAILKPRPLWTGKQLVSLFLPSDFNFSGRAKINAGD-LKCDGEDCF------
S5ZUY1_9CREN          -----LVEPAILKPGPYWTGKQLVSMFLPKGLNYVGRASVAPSS-GKCDEEYCE------
Q8ZYQ8_PYRAE          -----PPEPAILHPVELWTGKQIISHFLPKDLNWVQPTAFKSKC---QNAYTCP------
E1QRA0_VULDI          -----IDEPAIMHPKELWTGKQVVSMLLPKDLNWVQPTAIKESC---KDPYNCY------
A8MAA2_CALMQ          -----LEEPAIMHPVELWTGKQIISTLLPKDFNFTQATSFKSTC---SDPYRCD------
Q74M69_NANEQ          --ILKLVEKAKKEGRDYLTGKEVFSALLPDDLDFEIKTKNGE------------------
A0A218NM91_9ARCH      ----------DESEKGLYNGKDIISMLFPKDFNFTGNNMKGQ------------------
C7DHC4_MICA2          ----------KAERDGSYSGKAIFSMLLPKGINFESKASRGK------------------
                                              *  :*  .                            

RPO1N_METTW           -----MDWENDAYVVIENGQLITGVIDEKAYGAFA-GKILDQIVKEYGSDAAKEFLDSAT
R9SJC4_9EURY          -----EKCENDAYVVIKNGQLLYGAIDEKAYGSAS-GQILDTITKEYGPAAAKEFLDRST
Q2NEK4_METST          -----ENCEHDAYVVISNGQLLQGVVDDKGYGSGS-GKILDSIVKQFGPSEARYFLDHAT
E3GYR8_METFV          -----KNCENDAYVLIENGELKSGVIDEKGIGAFS-GKILDRIVKEYGPDKACEFLNAVT
D3DZI7_METRM          -----EACEYDSYVVIKDGQLTHGAIDEAAYGSFS-GKILDNIVKEYGPAYAKEFLDRST
Q8U0M4_PYRFU          DPEEVRKLAYDGFVYIQNGKLLSGAIDKKAYGRED-GIILDLIVREYGVERARQFLDQVT
F6BAY9_METIK          -----EDCPHDAYVVIKNGELIKGVVDKNGFGAEA-GIILDTIVKEFGSEEARKFLDSST
D5EA57_METMS          ---------YDAYVVVENGELVTGTIDEKAIGAFK-GKILDSIVKRYGTTEAAQFVDDMT
G7WMA4_METH6          ---------DDAYVVIRDGKILTGTIDAAAVGAFK-GKITDRVIKEYGPTVGAGFIDGMT
Q0W8G9_METAR          ---------KDAFVRISDGELKTGTIDEKAIGAFS-GKILDRIIKTYDEHTASNFLDNVT
A0A650A1Z2_9EURY      -------------VVIEDGQLVEGTIDDSAVGAFG-GDVVDSIAKIYDKTRARIFINEVS
A0A1M5K087_9EURY      -------------VVIEDGQLVQGTIDEDAVGAFG-GEVVDTLTKVYSETRARVFINEVA
M1Y5V8_NATM8          -------------VTVEDGQLVEGTIDEDAVGAFG-GEIVDTICKVYGNTRARVFVNEVA
A2SSM4_METLZ          ---------NDAFVRIVDGELISGTIDKKSVGAMD-GAILNRIIRLHGTQRAKEYIDDLT
N0BKJ3_9EURY          ---------HDAYVIIKKGELIKGTIDEKSVGAFK-GIIIDEIMRKYGPEETRKFIDNMT
D3T9X0_ACIB4          -------CPIDAYVVIRNGKLVAGTIDENAIGSMK-GKLLDRIAKR-GSKEAREFIDNMT
Q6L2F9_PICTO          -------DPNDIYVVIRDGKLIHGTIDDEAVGPFS-GVIVDKIFRKYGPDAAARFLDNVT
A0A6B9TE98_9ARCH      ---------YDAYVKIRDGQLLCGTIDVKGIGNSK-GKILDRIARDYGSDRAAKFINQVT
M4YUS2_THEXX          ---------FDGLVIIRNGQLLEGTIDESAIGNSK-GKILEKIARDYGSDRAAKFLNEVT
A0A0X8UZD5_9ARCH      -------CPTDGFVRIRNGKLITGTIDEKGIGNSK-GKILEKIARDYGSDRAARFLYDAT
R9TC03_METII          ---------MDAYVKIRDGQHLCGTIDENAIGAFK-GKILNKIAHDYGSTAAKDFLNNVT
A0A0U3F394_9CREN      ---------HDSFVVVRNGELVQGVLDKKSIGHEQPKSLMFWLVYEYGPEKAREIYDTAF
G0EEX9_PYRF1          ---------NDSYIVIKNGELLEGVFDKKAIGAEQTESVLHQLTKEYGFDYVRRLMDTLF
E0SPC3_IGNAA          ---------WDSYVVVRKGKLLMGVLDKKTIGAEQQDSLLYWLAKEYGVEYVALFMDHVF
I0A0T4_FERFK          ---------NDSYIVIKKGKMHTGVIDKKSIGAQQPESFYHWITKEYGSDYARYISDVMF
A4YCQ9_METS5          ---------HDSYVVIKKGKLLEGVFDKKALGNQQAESILHWLVREYDEDYVLWLMDNLF
RPO1N_SACSH           ---------HDSYVVIKNGILLEGVFDKKAIGNQQPESILHWLIKEYSDEYGKWLMDNLF
B8D6G9_DESA1          ---------HDSLVIIRNGVLLEGVLDKASIGREEPESLVHWLIKEYGEDYGRMFMDRVY
Q9YAU1_AERPE          ---------HDSYIVITNGKLLEGVLDKKAIGAEEPNNLLHIIALEYGNSKARQLLDSFY
D9Q2P3_ACIS3          ---------FDSYVVIRRGRLLEGVFDKNTIGAEQPESVLHYIALEYGNAAARQLLDTMY
S5ZUY1_9CREN          ---------NDGYILIKDGKLLLGVFDKQAIGAEKHGTVLHEIVREYGVEKARELMDGMF
Q8ZYQ8_PYRAE          ---------TDEWIIVINGNLVKGVLDKKSIGAEQVDSLWHRIARDYSPEVARRWLDSSL
E1QRA0_VULDI          ---------TDEYIVVVNGYMATGVLDKKSIGAEQVDSLWHVVVKRYGNDYARKWVDSVL
A8MAA2_CALMQ          ---------TDEYIVVVNGYLATGVLDKKSIGAEQVDSLLHVLVKRYGNEFGRRWIDSMF
Q74M69_NANEQ          -------------FVIKNGILLKGVIDKEIVGVEK-GKLIRELFERYGPEFTFKWLSDVT
A0A218NM91_9ARCH      -------------VIIKNGKLIEGILDARMIGEKG-STLISKLFIDYGPDFIERFILNLT
C7DHC4_MICA2          -------------VVIKNGVLEEGIIDDKIIGKEG-AKLIRKLFVDYGPEVTEQFILRVN
                                   . :  *    * .*    *      .   :    .            

RPO1N_METTW           KLAI-AGIMHAGFTTSTNDEEIPEEAKERIEAHLRNAEARVDQLIEAYENGELEPLPGRS
R9SJC4_9EURY          DMAI-CGIMKTGITTSTNDEEIPEEAQERIKEHLQKAEEKVDLLVKTYENDELEALPGRS
Q2NEK4_METST          KLAVFGGVMQRGFTTGTADEEIPKEAEERIKELLEKSDRKVEQLIQAYEDNELEALPGRS
E3GYR8_METFV          KLAI-AVIMKKGFTTSLRDEDIPKEAKEKIKEHLKKSEEKVNQLIKAYENGELEALPGRT
D3DZI7_METRM          DLAI-CGIMKTGITTSTNDEEIPEEAIEVIDAHLDNAEQKVDKLIETYEMGELQPLPGRS
Q8U0M4_PYRFU          KLTI-WVITHKGFTTGIDDEDLPEEARDRIREIIREAEERVNKLIEAYKRGELEPLPGKS
F6BAY9_METIK          KMAI-RAIMIKGFTTGIDDEDIPEEAEKEIQKILDKAEEEVNEIIRKYENGELEPLPGRS
D5EA57_METMS          RLAI-RGVMRTGLSFGISDEDIPREAKLNIDEELERAENEVAELIQAYEAKELEPLPGRT
G7WMA4_METH6          QMAI-RGIMLAGFSFGIDDEDIPKDAEDQIEDVLNAARENVTKLIDAYKAGELEPLPGRT
Q0W8G9_METAR          RLAI-RAITARGFSYGISDTDIPAESTAQITEILLNSGKQVRKLIEAHDHGELEPLPGRT
A0A650A1Z2_9EURY      TLAV-RTIMHFGFSISIDDESIPPNAAEQVDEAIDNAYERVQELITTYEQGDLESLPGRT
A0A1M5K087_9EURY      SLAM-RAIMHFGFSLGIDDESIPPEATEQVDEAIDSAYERVQELISTYEAGDLESLPGRT
M1Y5V8_NATM8          TLAM-RSIMHFGFSIGIDDESIEREAEEQIAEAIDNANERVETLIETYRNGELESLPGRT
A2SSM4_METLZ          KLSI-RAIMLYGFSYGINDTDLGKEEYKQIRDVLDTAEHDVANRINIFEQGHLEPMPGRT
N0BKJ3_9EURY          QLSI-RAIMNAGFSFGISDEEIPEEAVAQIREVLDEAEKKVDELIEQYKQGNLEPMPGRS
D3T9X0_ACIB4          RLAV-GVISYRGFTSGIDDEDIPEEAIIQIHEIIKESIKKTDELIELYKQGLLQPAPGRS
Q6L2F9_PICTO          RLAI-GFISYRGFSTGIRDYDIPEDAISRIDEIANATIEKIDKLVDAYRKGQLQPAPGRS
A0A6B9TE98_9ARCH      RIAL-GALMNHGFSTGIGDEDIPEEAALQINNNTQECINKVTELVESYQDGTLEQMPGRS
M4YUS2_THEXX          RLAL-GTIMNHGFSTGISDEDIPAEDLRQISTSSDDAIAKVDELIESFHDQTLEASQGGT
A0A0X8UZD5_9ARCH      RLAL-GAVMNHGFSTGISDEDIPEEAANQIRENSKECIQQVDELVESFRDGTLEQMPGRS
R9TC03_METII          KLAI-GAIMARGFTTGIDDEDIPAEATRQIEEMLADSVTKVSELVEAYREGILEQLPGRS
A0A0U3F394_9CREN      KMFL-KFTEKKGFTTRYDDVKLPEEAKKEIEKAIEEAYAEVDKLIEDYQNGLLEPLPGRT
G0EEX9_PYRF1          KMFL-RYIEKHGFTMTLEDVALPPEAKEHIREILKEAEKKVQELIEQYREGRLEPVPGRT
E0SPC3_IGNAA          RMFI-RVLEKRGFTLRLDDVAIDENTRKEILEIIKEAFSKVEELVKQYVEGKLEVVPGRS
I0A0T4_FERFK          KMFI-RYIEKHGFTMSLDDVEISEEAREEIRKILKKAEDDVNELIRMMEEGRLEPLPGRT
A4YCQ9_METS5          KVFL-RYIELHGLTMTLSDVTIPEEATKKIAERAQEARKKVNELIESYEKGQLEVIPGRT
RPO1N_SACSH           RVFI-RFVELQGFTMRLEDVSLGDDVKKEIYNEIDRAKVEVDNLIQKYKNGELEPIPGRT
B8D6G9_DESA1          KMFI-RMSEKYGLTMSYTHLTLPEEARNRLSEIIAGKKKEVEELISKYKRGELLARPGKT
Q9YAU1_AERPE          RMFI-RMLELRGLTISLHDIDLPDRAKQEIEELIREYKGRVYSIIEEYRKGTLEPIPGRS
D9Q2P3_ACIS3          RMFI-RMLELRGFSISISDIEIPKEARDKIAKMTEEAKEDVMKLIEQYRNGTLEIIPGRT
S5ZUY1_9CREN          KVFV-EYLDKYGFTMGVDSVEIPPEAERDVQEIVREAEKRVQELIEQYRSGELQPMPGKT
Q8ZYQ8_PYRAE          RLFL-RFLDLRGFTFGMDSIYIPPEAYREIDNIIKASLEKVDKLIDDFRSGHLEAMPGFT
E1QRA0_VULDI          RALL-RFLDLRGFTMGIDSLEMPRESYNELEKLYEESERKVFDYIQRFREGKLEAEPGLT
A8MAA2_CALMQ          RLII-RYIDIRGFTMALDSLNLPEDAMKKLDEVKNTYIKEAYELLDKYYKGALEAEPGKT
Q74M69_NANEQ          RLSV-NYLTREQLTISFSDIDIPKEVKEQIRKIIEKAKKEVDNLIERYKKGEIKPLPGRT
A0A218NM91_9ARCH      KISL-RAIYKRGLTVSVKDYIVSNEMISERDRIIKEVEDKANKITEEYNDRTLESLPGYT
C7DHC4_MICA2          KLAL-RVAYLHGLTISVKDYYNSEQVNREKAEIIKDAETKAYELMKSYKDGKLEPLPGYT
                         :        ::                                      :    * :

RPO1N_METTW           LEETLEMKIMQVLGE-AKDKSGEIAESYFDMDE--------------NHAVIMALTGARG
R9SJC4_9EURY          LEETLEMRIMQVLGE-ARDKSGEIAESYFDMS---------------NHSVVMARTGARA
Q2NEK4_METST          LRETLEMKIMQVLGE-ARDNTGVIAERYFTTS---------------NSAVIMALTGARG
E3GYR8_METFV          LRETLETRIMQVLGE-ARDKTGEIAESYLDMDE--------------NHAMIMALTGARG
D3DZI7_METRM          AEETLEMRIVQVLGE-ARDAAGDIAAGYLTMGKQSPDDSYDHVMAVENHSVVMAKTGARA
Q8U0M4_PYRFU          LEDTLESLIMAVLAE-ARDNAGAVAEKYLGMD---------------NHTVIMAKTGARG
F6BAY9_METIK          LEESREAYIMKILGK-ARDEAGAVAERYLSKD---------------NHAALMARTGARG
D5EA57_METMS          LAETIELKIMQSLGK-ARDHTGTIAGNHLGLE---------------NSAVIMAKSGARG
G7WMA4_METH6          LDETLEMRIMQTLGK-ARDNAGSIAGRYLGID---------------NSGVVMAVSGARG
Q0W8G9_METAR          LEETLEMRIMQELAK-ARDGAGGIAGKFLGSQED-------------NSAVIMARSGARG
A0A650A1Z2_9EURY      IDETLEMKIMQTLGQ-ARDSAGDIAEDHFAED---------------NPAVVMADSGARG
A0A1M5K087_9EURY      IDETLEMKIMQTLGK-ARDSAGEIAEDHFADD---------------NPAVIMARSGARG
M1Y5V8_NATM8          VDETLEMKIMQTLGK-ARDSAGDIADDHFGDD---------------NPAVVMAQSGARG
A2SSM4_METLZ          PEETLEMQVMKELGK-ARDRTGDIASRHLGFE---------------NSAVVMAVSGARG
N0BKJ3_9EURY          IEETLEMKIMQELGR-ARDKAGNIASKYLGMD---------------NSAVIMAVSGARG
D3T9X0_ACIB4          VEETLEMEIMRVLAH-ARDEAGKIASKHLGLE---------------NSSVIMARSGARA
Q6L2F9_PICTO          IEDTLEVEILAETGS-VRDESGKIASSYLGLN---------------DPSVIMARSGARA
A0A6B9TE98_9ARCH      LRETLEVSVMGVLGN-ARDEAGKIAGKHLGMN---------------NPAVIMAKAGARG
M4YUS2_THEXX          AETTLENQIMKVLGD-ARTTAGNIAGSKLGMS---------------NPAVIMAKTGARG
A0A0X8UZD5_9ARCH      VRETLEVRAQGILSG-ARDQAGKIAGNYLGMT---------------NPAVIMAKTGARG
R9TC03_METII          LDETLEVEVMKLLGR-ARDEAGQIAGRHLGME---------------NPAVIMARSGARA
A0A0U3F394_9CREN      LEETLELLIMDVLAK-ARDKAGEIAAKYLSPL---------------NNAVIMARAGARG
G0EEX9_PYRF1          LEETLELKIIEALTD-ARRKIEQYVADVLDPF---------------NNVFIMARTGARG
E0SPC3_IGNAA          LEESLEIKILEILAE-ARDKAGEVAVNRLDPF---------------NNAFIMARTGARG
I0A0T4_FERFK          IEETLETKIMERLSK-ARDDAGEYAANNLDIF---------------NNAFIMARTGARG
A4YCQ9_METS5          LEESLESYILDALDK-LRNEAGEIATTYLDPF---------------NNAYIMARTGARG
RPO1N_SACSH           LEESLENYILDTLDK-LRSTAGDIASKYLDPF---------------NFAYVMARTGARG
B8D6G9_DESA1          VEETLEDEIIDILSKKLLDSVAEVITPYFTLV---------------NPVVIMARTGARG
Q9YAU1_AERPE          LEESLEIKIMEVLDE-LRKRVQEVASNNLDPF---------------NDVFVMARTGARG
D9Q2P3_ACIS3          LEESLELKIIQRLQK-LRDDAGKTAIGYMNPF---------------NNAFIMARTGARG
S5ZUY1_9CREN          RKETLEDLIMNVLAE-ARTRAGEIVSRHLGLL---------------NHAVIMARTGARG
Q8ZYQ8_PYRAE          VEETFENKVTEILSK-VREDAAVVVEKYIDKN---------------SEGYLMAKTGARG
E1QRA0_VULDI          VEETLENDITIELSR-VREAAARVAEKYINKD---------------GEAYIMAKTGARG
A8MAA2_CALMQ          IEETLEDKLAETLSK-IREEASKIVDDYMNKE---------------SEVYIMAKTGARG
Q74M69_NANEQ          IEETLEIEILKVLNK-ARDEVGEVIEKHVDPT---------------KGTMILAKSGARG
A0A218NM91_9ARCH      RKQTMTTLLFAQLSE-ARDIAGKYLNRTMNTT---------------NNAFLLASIGARG
C7DHC4_MICA2          KKQTLEMLLQAQLSQ-ARNTASKALSKVLDEK---------------NNAYLMASIGARG
                         :                        .                      ::*  ***.

RPO1N_METTW           AMLNLTQITACVGQQSVHGGRITRGYD--NRTLPHFKKGELGAKSRGFVHSSYKEDSILL
R9SJC4_9EURY          SMLNLTQITACVGQQSVRGGRIHRGYS--ERTLPHFRKNELGAKAKGFVHSSYKDGLDPI
Q2NEK4_METST          SMLNLTQIATCVGQQAVRGGRINRGYI--NRTLPHFRKGDVGSKASGFVHSSYKKGLDPL
E3GYR8_METFV          SMLNLTQMSACVGQQSIRGERVQRGYY--GRTLPHFKKGDMGARARGFVYNSYRKGLDPL
D3DZI7_METRM          SMLNLAQITACVGQQSVRGGRITRGYL--ARPLPHFRKHELGARAKGFVHSSYKEGLDPV
Q8U0M4_PYRFU          KILNITQMAALLGQQSIRGKRLYRGFR--GRVLSHFKPGDLGARAKGFVVNSYKSGLTPQ
F6BAY9_METIK          SLLNITMMSACVGQQSVRGQRIFRGYR--NRVLPHFKKGSLDAKSHGFVRSSYKKGLSPI
D5EA57_METMS          SMLNLTQMAACVGQQAVRGERIRRGYE--GRTLPHFDRGDLGADAHGFVKSSYKSGLNPT
G7WMA4_METH6          SMLNLTQMAACVGQQSVRGERIRRGYE--GRTLPHFRRGDLGAEAHGFVQSSYKEGLNPT
Q0W8G9_METAR          NFLNLTQMAGCVGQQSVRGERIMRGYT--DRTLPHFKAGDRGADARGFVESSYKKGLNPT
A0A650A1Z2_9EURY      SMLNLTQMAGCVGQQAVRGERINRGYE--NRTLSHFKPNDLSADAHGFVEHSYREGLDPK
A0A1M5K087_9EURY      SMLNLTQMTGCVGQQAVRGERINRGYE--DRTLAHYEADDLSAEAHGFVENSYRSGLTPE
M1Y5V8_NATM8          SMLNLTQMAGCVGQQAVRGERINRGYE--DRTLSHFKPNDLSSEAHGFVENSYRNGLTPR
A2SSM4_METLZ          SMLNIAQMAGCIGQQAVRGERIVRGYE--DRTLPHFKRSDKGADAHGFVRNSYKSGLNPT
N0BKJ3_9EURY          SMLNLTQMAACIGQQSVRGERIKRGYTYTNRTLSHFKPGDLGSRARGFVRSSYKEGLNPI
D3T9X0_ACIB4          SMLNLSQMAGSIGQQSVRGQRLHRGYQ--DRTLPHFKRGDLGALARGFVESSYKKGLSPT
Q6L2F9_PICTO          KMLNIAEVAGMVGQQSVRGGRLNRGYS--GRTLPHFKENDLGAYARGFVKSSYRSGLSPT
A0A6B9TE98_9ARCH      SMLNLSQMAGCVGQQAVRGERLSRGYW--NRTLPHFEKGDLGAYARGFCSNSYKSGLSPT
M4YUS2_THEXX          SMTNLSQMAGCVGQQTVRGERISRGYW--QRTLPHFPREDLGAYAKGFCKDSYKLGLTPT
A0A0X8UZD5_9ARCH      SMLNLSQMAGCVGQQSVRGERIARGYW--DRTLPHFHKGDLGAYAKGFCLDSYKSGLTPT
R9TC03_METII          SMLNLSQMAGCIGQQAVRGERLSRGYW--NRTLPHFKKGDLGAEAKGFVQNSYKSGLTPT
A0A0U3F394_9CREN      NILNLTQMAAMLGQQSVRGERIKRGYR--KRTLPHFKWGDIRPDARGFVKHSFYEGLTPT
G0EEX9_PYRF1          NELNITQMAAILGQQTVRGERISRGYR--GRYLPHFKPGDLGPAARGFVYHGFYDGLTPT
E0SPC3_IGNAA          NVLNLTQMSATLGQMTVRGERIWRGYM--GRPISSYGQNDLGPLARGFVVNSFYSGLSPT
I0A0T4_FERFK          NILNLTQMSATLGQQSIRGERINRGYR--NRPLPHFKENDKSPASRGFVYNSFRTGLNPV
A4YCQ9_METS5          SVLNITQMAAMLGQQSVRGERIKRGYA--TRTLPHFKPGDITPEARGFIYSSFRSGLNPI
RPO1N_SACSH           SVLNITQMAAMLGQQSVRGERIKRGYM--TRTLPHFKPYDISPEARGFIYSSFRTGLKPT
B8D6G9_DESA1          NPVNLTQMAALLGQQTVRGKRLTRGYL--GRALSHFKPEDLGPEARGFIASGFVHGLNPV
Q9YAU1_AERPE          SDVNISQMAAMLGQQAVRGRRIRRGLR--NRVLAHFKENDIEPEAWGFVRSSFRKGLRPT
D9Q2P3_ACIS3          SDINITQMAAMLGQQTVRGRRIVRGFR--TRTLPHFRPGDLSPEARGFVVSNFRDGLKPH
S5ZUY1_9CREN          SMLNLTQMAAIVGQQSVRGKRIERGYS--GRTLSHFPVNDLSPQAKGFVQSSFRRGLSPE
Q8ZYQ8_PYRAE          SIVNIVQMVATLGQQTIRGERIRRGFR--TRTLPHFPVGDIGAFSGGFVRNCFRCGLTPV
E1QRA0_VULDI          SIVNITQMVAMIGQQTIRGERFKRGFT--GRTTAHFEPGDLGPMAKGFVRNNFKVGLTPV
A8MAA2_CALMQ          SLLNAAQMTAALGQQTIRGERYRRGFT--DRTLPHFLPGDKGPEARGFVKSNFRDGLSPI
Q74M69_NANEQ          KLLNLIQVVGLVGQQSISGRRMEEGYK--DRVLPHFKKGDKSAKARGFVEHGFADGLDPI
A0A218NM91_9ARCH      SIMNVIQMSMLLGQQSVRGKRPSRGYS--GRVLPYFRKNDKDPRAKGFVTSCFFEGLTPT
C7DHC4_MICA2          NILNMVQMSMFLGQQSVRGGRPTRGYS--GRVLPYFKKNDKNPEAKGFVTSCFFDGMEPR
                         *   :   :** :: * *  .*     *  . :   .  . : **    :  .    

RPO1N_METTW           EF----MGGREGLVDTAIRTAQSGYMQRRLVNALQDLTVDE--------NGRVV-DNRGV
R9SJC4_9EURY          EFYFHAMGGREGLVDTAIRTAQSGYMQRRLVNALEDLKASS--------NGRVT-DNRGM
Q2NEK4_METST          EFFFHAMGGREGLVDTAIRTAQSGYMQRRLVNALHDLSVHE--------DGTVR-DNRGA
E3GYR8_METFV          EFFFHAMGGREGLVDTAIRTAQSGYMQRRLINALQDLHVER--------NGKVV-DSSGT
D3DZI7_METRM          EFFFHAMGGREGLVDTAIRTAQSGYMQRRLVNALEDLNVRS--------DGLVT-DNKNQ
Q8U0M4_PYRFU          EYFFHAMGGREGLVDTAVRTAQSGYMQRRLINALQDLKVEY--------DGTVR-SPEGI
F6BAY9_METIK          EYFFHAMGGREGLVDQAVRTAQSGYMQRRLINALQDLRAEY--------DGTVR-DSRGT
D5EA57_METMS          EYFFHSVGGREGLVDTAVRTSQSGYLQRRLVNALQDLEVQY--------DRSVR-ETRGV
G7WMA4_METH6          EFFFHAIGGREGLVDTAIRTSQSGYLQRRLINALQDLEVQY--------DGTVK-ETRGI
Q0W8G9_METAR          EFFFHAMGGREGLVDTAVRTSQSGYLQRRLVNALQDLEVKH--------DGTVR-ETRGV
A0A650A1Z2_9EURY      EFFFHAMGGREGLVDTAVRTSKSGYLQRRLINALSELETQY--------DGTVR-DTSDT
A0A1M5K087_9EURY      EFFFHAMGGREGLVDTAVRTSKSGYLQRRLINALSELETQY--------DGTVR-DTSGT
M1Y5V8_NATM8          EFFFHAMGGREGLVDTAVRTSKSGYLQRRLINALSELEAQY--------DGTVR-DTSDT
A2SSM4_METLZ          EFFFHAIGGREGLVDTAVRTSQSGYLQRRMINALQDLKVAY--------DGTVR-STGGK
N0BKJ3_9EURY          EFFFHAVGGREGLVDTAVRTSQSGYLQRRLINALQDLKVDY--------DGTVKEQTSNV
D3T9X0_ACIB4          EYFFHSMGGREGLVDTAVRTSRSGYMQRRLINALEDLKVIE--------DGKVV-DTAGN
Q6L2F9_PICTO          EYFFHSIGGREGLVDIAVRTSRSGYMQRRLINAFEDLKADE--------DRRVE-DTLGS
A0A6B9TE98_9ARCH      EFFFHAMGGREGLVDTAVRTSRSGYMQRRLVSALEDLKLTS--------DGTVR-NTIGT
M4YUS2_THEXX          EFFFHAMGGREGLVDTAVRTSRSGYMQRRLISALEDLKLTS--------DGTIR-NTVGA
A0A0X8UZD5_9ARCH      EFFFHAMGGREGLVDTAVRTARSGYMQRRLISALEDLKLTTENAATVYHDGRIT-NTVGT
R9TC03_METII          EFFFHSMGGREGLVDTAVRTSRSGYMQRRLINALEDLKLKQ--------DGTVR-NTADM
A0A0U3F394_9CREN      EVFFHAAGGREGLVDTAVRTSQSGYMQRRLINALQDLKVDY--------DGMVK-GAKGE
G0EEX9_PYRF1          EVFFHAAGGREGLVDTAVRTSQSGYMQRRLINALQDLRVEY--------DGTVR-LPDGT
E0SPC3_IGNAA          EMFMHAAGGREGLVDTAVRTSQSGYMQRRLINALQDLYVEY--------DGTVR-DSTNS
I0A0T4_FERFK          ELFYHAAGGREGLVDTAVRTSQSGYMQRRLINALLDVRIEY--------DGSAR-LPDGT
A4YCQ9_METS5          ETFFHAAGGREGLVDTAVRTSQSGYMQRRLINALSDLRVEY--------DGTVR-TLYGE
RPO1N_SACSH           ELFFHAAGGREGLVDTAVRTSQSGYMQRRLINALSDLRAEY--------DGTVR-SLYGE
B8D6G9_DESA1          EMFFHAAAGREGLIDTAVRTSQSGYMQRRLINALQDLRVEY--------DGSVR-LTTGE
Q9YAU1_AERPE          EVFFHAAAGREGLVDTAVKTSQSGYMQRRLINALQDIVVTY--------DGTVR-DLYGN
D9Q2P3_ACIS3          EVFFHAAGGREGLVDTALKTSQSGYMQRRLINALQDLHVAY--------DGTVR-DSQDN
S5ZUY1_9CREN          EFFFHAISGREGLVDTAVRTAQSGYMYRRLQSAMQDFYVSY--------DGTVR-NSEGL
Q8ZYQ8_PYRAE          EYFFHAAAGRDGLIDTAVRTAQSGYMQRRLINALQDVYVAY--------DGTVR-FGGAM
E1QRA0_VULDI          EFFFHAAGGRDGLVDTAVRTAQSGYMQRRLINALQDIYVAY--------DGTVR-NASGS
A8MAA2_CALMQ          EYFFHAGGGRDGLVETAVRTSQSGYAQRRLINAMQDIYVAY--------DGTVR-DSQDA
Q74M69_NANEQ          EFFFHAASGKDALMDTTLRTPKSGYLYRRLVSVLRDLYVEN--------DRTVR-DTFGN
A0A218NM91_9ARCH      DFFEHAMGARDSAATKSLVTAVSGYMYRRLVNAMMDFYISE--------DKSVR-GSGME
C7DHC4_MICA2          QMFMHAMGSRDSAMTKSLVTAVSGYMQRRLINAMQDFYVDK--------DLSVR-DASGA
                      :      ..::.    :: *. ***  **: ..: :.            :          

RPO1N_METTW           IIQTRFGEDGVDPAKSDYGKI--VDLDKLVQEIRLKSGK---------------------
R9SJC4_9EURY          VVQTLFGEDGVDPAKSDHGHV--ANLDKLIDEMRVKK-----------------------
Q2NEK4_METST          IIQFKYGEDGINPAKSDYGIV--ANLDRLIEEMRLEANSNAK------------------
E3GYR8_METFV          LIQRKYGEDGVDPAKSDYEKA--VDLDRLAEEIRLKAGK---------------------
D3DZI7_METRM          VIQTVFGEDGIDPAKSDFGKV--ANLDKLIDEMRIKDEGK--------------------
Q8U0M4_PYRFU          IVQFKYGEDGVDPMKSWRGKT--VDVDRIIVRTLLKMRGNNKAKV---------------
F6BAY9_METIK          IIQFVYGEDGVDPSKADHGKA--VDIDKIITKVKAKYEE---------------------
D5EA57_METMS          IVQFKYGEDGIDSTKSDYSSE--ETVHNIVRSVTGKEVK---------------------
G7WMA4_METH6          IVQFSYGEDGVDASKRDYASP--ENVHRIVQRVLGRAGR---------------------
Q0W8G9_METAR          VVQFLYGEDGVDPMKSDYGEG--VNIPSIVDSVLNGGDSK--------------------
A0A650A1Z2_9EURY      VVQFEFGEDGTSPVDVSSSDDFDIDVESIADRIIDAEFDDDAAKAEFLEREALPTNLSEH
A0A1M5K087_9EURY      IVQFEFGEDGTSPVKVSSNEDSPIDIEQITDRIVDAEFGSEEEKERFLGRREAPTNLSEY
M1Y5V8_NATM8          VVQFEFGEDGTSPVQVSSNTDFDIDIEAIADRVVDSEFDSPAEREAFLGIEEPATNISEH
A2SSM4_METLZ          IIQFVYGEDGTDPAKSASGLP--VDVKGIAESVLKEEI----------------------
N0BKJ3_9EURY          IVQFKYGEDGVDPMKSFRGKA--VDVKRIIKEVLGEEVAEAKEE----------------
D3T9X0_ACIB4          VVQFIYGEDGVDPTRSSGGEN--VNMDEILTDVLGDKYLLRRRK----------------
Q6L2F9_PICTO          IIQFKYGEDGIDPTRSDEGET--IDIDYLAYDELGDEQ----------------------
A0A6B9TE98_9ARCH      VVQFKYGEDGVDPARTVRGKA--IDLDDLFAEVLGDQADELLHIDTKDVGGD-YGSLEK-
M4YUS2_THEXX          IVQFKYGEDGVDPARSVRGKA--IDIDDLFFEVLGEDAEKLVDVNAKENQGDSYGEREKD
A0A0X8UZD5_9ARCH      IVQFKYGEDGIDPSKAVRGDA--VNLNDLFAEVLGEDADKLLNVDKKENEGDDYGSREK-
R9TC03_METII          VIQLKYGEDGVDPTRSASGEA--VDIDDILTEVLGDEAEIISQIEEKK--QTGYATMEQ-
A0A0U3F394_9CREN      VYQTIYGDDGVDPMRSAHGESV--DVKHVIEKVTGVRLD---------------------
G0EEX9_PYRF1          LVQIKYGEDGVDPMKSAHGKAV--NVDRVIERVIGWRT----------------------
E0SPC3_IGNAA          IIQFVYGEDGADPAKAPHGNIV--NVERIIERVIGWKM----------------------
I0A0T4_FERFK          VVQFKYGYDQVDPAKSDHGKAV--NVDRIIERVVGWRE----------------------
A4YCQ9_METS5          MIQTLYGGDGVHPMQSAHGKTI--DVDRVLERVVGWKR----------------------
RPO1N_SACSH           VIQVAYGDDGVFPMYSAHGKTV--DVNRIFERVVGWKT----------------------
B8D6G9_DESA1          IVQLLYGEDGVDPMKSDHGKSV--NVDRVIEKIFGGGL----------------------
Q9YAU1_AERPE          LIQLKYGEDGVDPMKTYHGKPV--DVKRIIQRVKASKAETV-------------------
D9Q2P3_ACIS3          IIQFRYGEDGVDPQKTYHGKAV--NVDRLIEKVKQGGA----------------------
S5ZUY1_9CREN          VIQYRYGEDGVDPSRSDHGKPV--DVDKLIKKVLAMRGERHE------------------
Q8ZYQ8_PYRAE          LLQYLYGEDGVDVSRSDHGKV----VDIKSLKMWIR------------------------
E1QRA0_VULDI          IIQTKYAEDGIDVSKSDHGRLN---LDEIFRRAGIGR-----------------------
A8MAA2_CALMQ          IIQFKYGEDGIDVSKSDHGRLN---IDEIIRRVMTSG-----------------------
Q74M69_NANEQ          IYQFIWGEDGIAVQKSEGGKL---NVEKIFKEQ---------------------------
A0A218NM91_9ARCH      LIQPLYGGDGIDPMYVNVEPSK--------------------------------------
C7DHC4_MICA2          LIQTLYGGDGVDPTMELAKNE---------------------------------------
                      : *  :. *                                                   

RPO1N_METTW           -------------------------------
R9SJC4_9EURY          -------------------------------
Q2NEK4_METST          -------------------------------
E3GYR8_METFV          -------------------------------
D3DZI7_METRM          -------------------------------
Q8U0M4_PYRFU          -------------------------------
F6BAY9_METIK          -------------------------------
D5EA57_METMS          -------------------------------
G7WMA4_METH6          -------------------------------
Q0W8G9_METAR          -------------------------------
A0A650A1Z2_9EURY      ADERW-----LAEGDD---------------
A0A1M5K087_9EURY      AGPGLDKAGGVGVGDD---------------
M1Y5V8_NATM8          GESWRSAGGQEVESDD---------------
A2SSM4_METLZ          -------------------------------
N0BKJ3_9EURY          -------------------------------
D3T9X0_ACIB4          -------------------------------
Q6L2F9_PICTO          -------------------------------
A0A6B9TE98_9ARCH      -DEMEYIEDEEGE-EYDDLDMDFDG---GGE
M4YUS2_THEXX          LDAIEYDNDFDSDGDEDSTDYESDGDDYGGE
A0A0X8UZD5_9ARCH      -DLEGFDDDSDYDSDEDSLDSDGDSDYEGGE
R9TC03_METII          -DLMEAVAEDDLEMEEPEYDLGGGGED----
A0A0U3F394_9CREN      -------------------------------
G0EEX9_PYRF1          -------------------------------
E0SPC3_IGNAA          -------------------------------
I0A0T4_FERFK          -------------------------------
A4YCQ9_METS5          -------------------------------
RPO1N_SACSH           -------------------------------
B8D6G9_DESA1          -------------------------------
Q9YAU1_AERPE          -------------------------------
D9Q2P3_ACIS3          -------------------------------
S5ZUY1_9CREN          -------------------------------
Q8ZYQ8_PYRAE          -------------------------------
E1QRA0_VULDI          -------------------------------
A8MAA2_CALMQ          -------------------------------
Q74M69_NANEQ          -------------------------------
A0A218NM91_9ARCH      -------------------------------
C7DHC4_MICA2          -------------------------------