CLUSTAL format seed alignment for MF_00901

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TATD_PECPW            ----MFDIGVNLTSSQFEQDREQVVIRAKQAGVSGILITGTNAQESHQAMLLAQAYPDYC
TATD_PECAS            ----MFDIGVNLTSSQFEKDREQVVIRAKLAGVSGILITGTNAQESHQAMLLAQAYPDYC
TATD_YERPY            ----MFDIGVNLTSVQFAKDYHQVVNRAKEAGVLGILITGTDADESLAAQTLAAEYPGYC
Q66FS4_YERPS          ----MFDIGVNLTSVQFAKDYHQVVNRAKEAGVLGILITGTDADESLAAQTLAAEYPGYC
TATD_SERP5            ----MFDIGVNLTSSQFAKDRPAVVERARAAGVTGLLITGTDLQESRAASELAQQHANFC
TATD_DICP7            ----MFDIGVNLTSSQFESDRDAVISRARREGVTGMLLTGTGIEESRHALRLAEGAPGYC
A0A2I5TE62_SERS3      ----MFDIGVNLTSSQFAKDREQVIIRARQAGVTGLLVTGSNASDSEHAAALTTIFPDYC
Q1R471_ECOUT          MEYRMFDIGVNLTSSQFAKDRDDVVARAFDAGVNGLLITGTNLRESQQAQKLARQYSS-C
B7UNG9_ECO27          ----MFDIGVNLTSSQFAKDRDDVVARAFDAGVNGLLITGTNLRESQQAQKLARQYSS-C
E3PAX9_ECOH1          ----MFDIGVNLTSSQFAKDRDDVVARAFDAGVNGLLITGTNLRESQQAQKLARQYSS-C
TATD_ECOLI            ----MFDIGVNLTSSQFAKDRDDVVACAFDAGVNGLLITGTNLRESQQAQKLARQYSS-C
B7L9A2_ECO55          ----MFDIGVNLTSSQFAKDRDDVVARAFDAGVNGLLITGTNLRESQQAQKLARQYSS-C
TATD_SHIF8            ----MFDIGVNLTSSQFAKDRDDVVARAFDAGVNGLLITGTNLRESQQAQKLARQYSS-C
B2TVJ0_SHIB3          MEYRMFDIGVNLTSSQFAKDRDDVVARAFDAGVNGLLITGTNLRESQQAQKLARQYSS-C
D3H4X7_ECO44          MEYRMFDIGVNLTSSQFAKDRDDVVARAFDAGVNGLLITGTNLRESQQAQKLARQYSS-C
TATD_ESCF3            ----MFDIGVNLTSSQFAKDRDDIVTRAFAAGVNGLLITGTNLRESQQAQKLARHYPH-C
Q8Z3C1_SALTI          ----MFDIGVNLTSSQFAKDRDDVVARAFAAGVKGMLLTGTNIHESQQALKLARRYPH-C
B5EZV4_SALA4          ----MFDIGVNLTSSQFAKDRDDVVARAFAAGVKGMLLTGTNIHESQQALKLARRYPH-C
A0A0H2WUR2_SALPA      ----MFDIGVNLTSSQFAKDRDDVVARAFAAGVKGMLLTGTNIHESQQALKLARRYPH-C
Q57HN2_SALCH          ----MFDIGVNLTSSQFAKDRDDVVARAFAAGVKGMLLTGTNIHESQQALKLARRYPH-C
TATD_SALTY            ----MFDIGVNLTSSQFAKDRDDVVARAFAAGVKGMLLTGTNIHESQQALKLARRYPH-C
A9MIX7_SALAR          MGASMFDIGVNLTSSQFAKDRDDVVVRAFAAGVKGMLLTGTNIHESQQTLKLARRYPH-C
S5NF05_SALBN          ----MFDIGVNLTSRQFANDRDDVVARAFAAGVKGMLLTGTNIHESQQALELAQCYPH-C
TATD_CITK8            ----MFDIGVNLTSSQFVKDRDDVVTRALAAGVSGMLLTGTNLHESQQAQKLAQRYAC-C
TATD_CITRI            ----MFDIGVNLTSSQFVKDHDEVVARAYAAGVNGLLLTGTNLYESQQAQRLAQHYPH-C
L0M8C8_ENTBF          ----MFDIGVNLTSSQFSHDRDDVIARAQAAGVSGMLLTGTNRHESEQAQQFAQRFAG-C
TATD_ENTLS            ----MFDIGVNLTSPQFARDHDAVVARAFAAGLSGMLLTGTSLHESEQALALAQRHAR-C
TATD_ENT38            ----MFDIGLNLTSPQFANDRDDVVARAFAAGVKGLLLTGTNLHESEHAQQLAQGYER-C
R9VQW8_9ENTR          MGKNMFDIGVNLTSSQFAKDRDEIVARAQAAGVAGMLITGTNLHESQQAQQLAQRYRH-C
TATD_KLEP3            ----MFDIGVNLTSSQFSRDHDEVVARARAAGVHGMLLTGTNLPESQQAQRMASHYSG-C
R4Y4F5_KLEPR          MGAIMFDIGVNLTSSQFSRDHDEVVARALAAGVNGMLLTGTNLAESQQAQKLASRYSG-C
TATD_CROS8            ----MFDIGLNITSSQFDHDRDEMIARARAAGVSNMLFTGTSLEESEKACAFARRYEG-C
TATD_CROTZ            ----MFDIGLNITSSQFDHDRDEMIARARAAGVDSMLFTGTSLEESDRACAFARRYAG-C
A0A071LQ62_9ENTR      ----MFDIGVNLTSSQFDKDRADVVSRAQNAGVHGLLVTGTSVQESEQALACATEYKN-C
TATD_RAHSY            ----MFEIGINLTSSQFDKDRLQVVERARTAGLSGMLITGTSAQESVEAQKMADEHPDFC
H2IVX1_RAHAC          ----MFEIGINLTSSQFDKDRPQVVERARAAGLSGMLITGTSAQESVEAQKMADEHPDFC
TATD_ERWAE            ----MFDIGVNLTSTQFAKDRDKVVKRAREAGISGMLITGTNALESQQALSLARQHANYC
D2TCU2_ERWP6          MEGIMFDIGVNLTSTQFAKDRDKVVKRAREAGVSGMLITGTNALESQQALSLARQHADYC
TATD_ERWT9            ----MFDIGVNLTSTQFAKDRDKVIKRAREAGVSGMLITGTNALESQQALSLARQHPDYC
TATD_PANVC            ----MFDIGVNLTSTQFASDRQKVVKRARDAGVTGMLITGTNALESQHAQRLAEAQPGFC
TATD_PANAM            ----MFDIGVNLTSTQFASDREKVISRAREAGVTGMLITGTNALESQQAQKLAEAHQDYC
TATD_PANSA            ----MFDIGVNLTSTQFAKDREQVVARARDAGVTGLLITGTNALESQQAQRLAEWHPGYC
TATD_EDWTE            ----MLDIGVNLTNGQFSGDVPQVVARARQAGLNGMIITGTNLTESAQALHLAQAYPDFC
C5BCB0_EDWI9          ----MLDIGVNLTNSQFAGDVPQVIARARQAGLNGMIITGTNLTESAQALCLAQAYPDFC
                          *::**:*:*. **  *   ::  *   *: .::.**:.  :*  :   :      *

TATD_PECPW            WSTAGVHPHDASQWNGDIAEQVHHMANAACVVAIGECGLDFNRNFSTPEEQERAFSAQLA
TATD_PECAS            WSTAGVHPHDASQWNDAIAEQLHQMANAACVVSIGECGLDFNRNFSTPEEQEQAFSAQLA
TATD_YERPY            WSTTGVHPHHASSWQDSVEQKIRTLAATASVVAIGECGLDFNRNFSTPAQQEVAFTAQLA
Q66FS4_YERPS          WSTTGVHPHHASSWQDSVEQKIRTLAATASVVAIGECGLDFNRNFSTPAQQEVAFTAQLA
TATD_SERP5            WSTAGVHPHHASSWDERVAEQICELAARPRVAAIGECGLDFNRNFSTPEQQEAAFSAQLA
TATD_DICP7            WSTAGIHPHEASTWTDAAALSIRQLAVHPQVVAIGECGLDFNRNFSTPSEQERAFSAQLA
A0A2I5TE62_SERS3      WSTSGVHPHEASTWTDVVAEQIYSLTLRDKVVAVGESGLDFNRNFSTPSQQERAFTAQLA
Q1R471_ECOUT          WSTAGVHPHDSSQWQAVTEEAIIELAAQPEVVAIGECGLDFNRNFSTPEEQERAFVAQLR
B7UNG9_ECO27          WSTAGVHPHDSSQWQAVTEEAIIELAAQPEVVAIGECGLDFNRNFSTPEEQELAFVAQLR
E3PAX9_ECOH1          WSTAGVHPHDSSQWQAATEEAIIELAAQPEVVAIGECGLDFNRNFSTPEEQERAFVAQLR
TATD_ECOLI            WSTAGVHPHDSSQWQAATEEAIIELAAQPEVVAIGECGLDFNRNFSTPEEQERAFVAQLR
B7L9A2_ECO55          WSTAGVHPHDSSQWQAATEEAIIELAAQPEVVAIGECGLDFNRNFSTPEEQERAFVAQLR
TATD_SHIF8            WSTAGVHPHDSSQWQAATEEAIIELAAQPEVVAIGECGLDFNRNFSTPEEQERAFVAQLR
B2TVJ0_SHIB3          WSTAGVHPHDSSQWQAATEEAIIELAAQPEVVAIGECGLDFNRNFSTPEEQERAFVAQLR
D3H4X7_ECO44          WSTAGVHPHDSSQWQAATEEAIIELAAQPEVVAIGECGLDFNRNFSTPEEQERAFVAQLR
TATD_ESCF3            WSTAGVHPHDSSQWQAATEEAIIELAAQPEVVAIGECGLDFNRNFSTPEEQERAFVAQLR
Q8Z3C1_SALTI          WSTAGVHPHDSSQWSSASEDAIIALANQPEVVAIGECGLDFNRNFSTPQEQERAFQAQLQ
B5EZV4_SALA4          WSTAGVHPHDSSQWSSASEDAIIALANQPEVVAIGECGLDFNRNFSTPQEQERAFQAQLQ
A0A0H2WUR2_SALPA      WSTAGVHPHDSSQWSPASEDAIIALANQPEVVAIGECGLDFNRNFSTPQEQERAFQAQLQ
Q57HN2_SALCH          WSTAGVHPHDSSQWSPASEDAIIALANQPEVVAIGECGLDFNRNFSTPQEQERAFQAHLQ
TATD_SALTY            WSTAGVHPHDSSQWSPASEDAIIALANQPEVVAIGECGLDFNRNFSTPQEQERAFQAQLQ
A9MIX7_SALAR          WSTAGVHPHDSSQWSSASEDAIITLANQPEVVAIGECGLDFNRNFSTPQEQERAFQAQLQ
S5NF05_SALBN          WSTAGVHPHDSSQWSAVSEDAIIALANQPEVVAIGECGLDFNRNFSTPQEQERAFQAQLQ
TATD_CITK8            WSTAGVHPHDSSQWQSETEDAIVALARQPDVVAIGECGLDFNRNFSTPQEQERAFQAQLR
TATD_CITRI            WSTAGVHPHDSSEWRADTGEAIVALAALPEVVAIGECGLDFNRNFSTPQAQEHAFEAQLR
L0M8C8_ENTBF          WSTAGVHPHDSSSWNPEVEANIRKLAQQSEVVAIGECGLDFNRNFSTPAEQEAAFSAQLA
TATD_ENTLS            WSTAGVHPHDSSRWTRETEQRIRTLAQAPEVVAIGECGLDFNRNFSTPQAQEAAFSAQLA
TATD_ENT38            WSTAGVHPHDSSQWTDESAETLYKLAKTEEVVAIGECGLDFNRNFSTPVEQEAAFTAQLA
R9VQW8_9ENTR          WSTAGVHPHDSSGWTDETAETIRTLAATAEVVAVGECGLDFNRNFSTPQEQEYAFGAQLS
TATD_KLEP3            WSTAGVHPHDGSSWSPAVAEAIYTLAREPQVVAIGECGLDFNRNFSTPQEQEAAFSAQLA
R4Y4F5_KLEPR          WSTAGVHPHDGSSWTPAVAEAIYTLAGEPQVVAIGECGLDFNRNFSTPHEQEVAFSAQLA
TATD_CROS8            WSTAGVHPHDASTWNDESAARLRALAGEAQVVAIGECGLDFNRNFSTPAEQEHAFTEQLR
TATD_CROTZ            WSTAGVHPHDASTWNDESAARLRALASEPEVVAIGECGLDFNRNFSTPAEQEHAFTEQLR
A0A071LQ62_9ENTR      WATAGVHPHDASTWSETVAERIYRLAGQDKVVAVGECGLDFNRNFSSPLDQERAFSAQLA
TATD_RAHSY            WSTAGVHPHQASHWNAQVEAGIRELAVLPNVVAIGECGLDFNRNFSPADRQEAAFTAQLA
H2IVX1_RAHAC          WSTAGVHPHQASAWNTQVEAGIRELAVLPNVVAIGECGLDFNRNFSPADLQEAAFTAQLA
TATD_ERWAE            WSTAGVHPHHASEWSAETAATLRRLAESPLVVAIGECGLDFNRNFSQPEQQVYAFNAQLA
D2TCU2_ERWP6          WSTAGVHPHHASEWSAETAATLRRLSESPHVVAIGECGLDFNRNFSEPEQQAWAFNAQLA
TATD_ERWT9            WSTAGVHPHHASEWSGETAATLRRLAESPQMVAIGECGLDFNRNFSDPEQQAYAFNAQLA
TATD_PANVC            WSTAGVHPHHASEWSTEIASTLRRLAEKPEVVAIGECGLDFNRNLSAHEQQEYAFDAQLA
TATD_PANAM            WSTAGVHPHHASEWSADVANTLRRLAEKKDVVAIGECGLDFNRNLSAHQQQEYAFDAQLA
TATD_PANSA            WSTAGVHPHHASAWSAETANTLRRLAESEQVVAIGECGLDFNRNFSAHDQQEYAFDAQLQ
TATD_EDWTE            WATAGVHPHDAHRWNENSAADLEPLLRSPAVVAVGECGLDFARNFSTPAQQEAAFEAQLA
C5BCB0_EDWI9          WATAGVHPHDAHRWNENSTAALEPLLHSPTVVAVGECGLDFARNFSTPAQQEAAFEAQLT
                      *:*:*:***..  *       :  :     :.::**.**** **:*    *  **  :* 

TATD_PECPW            IAAELSMPVFLHCRDAHPRFISLLTPWLGQLPAAVVHCFTGNRQELDACLAVGLTIGITG
TATD_PECAS            IAAELSMPVFLHCRDAHPRFISLLTPWLSQLPAAVVHCFTGNRHELDECLAAGLMIGITG
TATD_YERPY            LAAELSLPVFLHCRDAHERFIDLLVPWLDKIPAAVVHCFTGNSDELDACLALGLSIGITG
Q66FS4_YERPS          LAAELSLPVFLHCRDAHERFIDLLVPWLDKIPAAVVHCFTGNSGELDACLALGLSIGITG
TATD_SERP5            LAAELSMPVFLHCRDAHARFAALLAPWLDKLPAAVVHCFTGTAEELESCLSLGLSVGITG
TATD_DICP7            IAADLGMPVFMHCREAHSRFMMLLRPWLEKLPAAVLHCFTGTRDELDECLQAGLSIGITG
A0A2I5TE62_SERS3      IAAERSLPVFLHCRDAHSRFISLLTPWLDKLPAAVVHCFTGTRHELDDCLNAGLMVGITG
Q1R471_ECOUT          IAAELNMPVFMHCRDAHERFMTLLEPWLDKLPGAVLHCFTGTREEMQACVACGIYIGITG
B7UNG9_ECO27          IAAELNMPVFMHCRDAHERFMTLLEPWLDKLPGAVLHCFTGTREEMQACVARGIYIGITG
E3PAX9_ECOH1          IAADLNMPVFMHCRDAHERFMTLLEPWLDKLPGAVLHCFTGTREEMQACVAHGIYIGITG
TATD_ECOLI            IAADLNMPVFMHCRDAHERFMTLLEPWLDKLPGAVLHCFTGTREEMQACVAHGIYIGITG
B7L9A2_ECO55          IAADLNMPVFMHCRDAHERFMTLLEPWLDKLPGAVLHCFTGTREEMQACVARGIYIGITG
TATD_SHIF8            IAAELNMPVFMHCRDAHERFMTLLEPWLDKLPGAVLHCFTGTREEMQACVARGIYIGITG
B2TVJ0_SHIB3          IAAELNMPVFMHCRDAHERFMTLLEPWLDKLPGAVLHCFTGTREEMQACVARGIYIGITG
D3H4X7_ECO44          IAAELNMPVFMHCRDAHERFMTLLEPWLDKLPGAVLHCFTGTREEMQACVARGIYIGITG
TATD_ESCF3            IAAELNMPVFMHCRDAHERFITLLEPWLEKLPGAVLHCFTGTREEMQACVARGIYIGITG
Q8Z3C1_SALTI          IAAELQMPIFMHCRDAHERFLALLDPWLDSLPGAILHCFTGSRQQMQACVDRGLYIGITG
B5EZV4_SALA4          IAAELQMPIFMHCRDAHERFLALLDPWLDSLPGAILHCFTGSRQQMQDCVDRGLYIGITG
A0A0H2WUR2_SALPA      IAAELQMPIFMHCRDAHERFLALLDPWLDSLPGAILHCFTGSRQQMQACVDRGLYIGITG
Q57HN2_SALCH          IAAELQMPIFMHCRDAHERFLALLDPWLDSLPGAILHCFTGSRQQMQACVDRGLYIGITG
TATD_SALTY            IAAELQIPIFMHCRDAHERFLVLLDPWLDSLPGAILHCFTGSRQQMQACVDRGLYIGITG
A9MIX7_SALAR          IAAELQMPIFMHCRDAHERFLALLDPWLDSLPGAILHCFTGSRQQMQACVDRGIYIGITG
S5NF05_SALBN          IAAELQMPIFMHCRDAHERFLTLLDPWLDSLPGAVLHCFTGTRQQMQACVDRGIYIGITG
TATD_CITK8            IAAELQMPVFMHCRDAHARFLALLEPWLDKLPGAVLHCFTGTREEMQECIDRGLYIGITG
TATD_CITRI            IAAELQMPVFMHCRDAHTRFLALLDPWLDKLPGAVLHCFTGTRQEMQECLERGLYIGITG
L0M8C8_ENTBF          LAAELSMPVFMHCRDAHARFLALLDPWLDKLPGGVLHCFTGTREEMQACVDRGLYIGITG
TATD_ENTLS            LAAECGMPVFLHCRDAHERFMALLTPWLDKLPGAVLHCFTGTRDELQDCLRHGLYIGITG
TATD_ENT38            IAAELEMPVFMHCRDAHERFLTLLEPWRDKLPGAVLHCFTGSRQEAVECLNRGLYLGITG
R9VQW8_9ENTR          LAAELNMPVFLHCRDAHERFLALLDPWLDKLPGAVLHCFTGSAQEARECLDRGIYLGITG
TATD_KLEP3            LAAELAMPVFLHCRDAHDRFLALLKPWLEKIPGAVLHCFTGSRSEVQECLDLGLFIGITG
R4Y4F5_KLEPR          LAAELSMPVFLHCRDAHDRFLTLLKPWLEKIPGAVLHCFTGSRSEVQECLDLGLFIGITG
TATD_CROS8            LAAELALPVFLHCRDAHARFLALLDPWLDKLPGAVLHCFTGTEQEARETMARGLYLGITG
TATD_CROTZ            LAAALALPVFLHCRDAHARFLALLDPWLDKLPGAVLHCFTGTEQEARECLARGMYLGITG
A0A071LQ62_9ENTR      IAAECELPVFLHCREAHDRFMVLLKPWLSKLPAVVLHSFTGTRQEADECLAHGMYLGVTG
TATD_RAHSY            LAKELQLPVFLHCRDAGERFATLLKPWLSDLPGGVVHCFTGTRQELELYLSLGLSIGITG
H2IVX1_RAHAC          LAKELQLPVFLHCRDAGERFAALLKPWLSGLPGGVVHCFTGTRQELELYLSLGLSIGITG
TATD_ERWAE            LAAELSLPVFLHCREAHERFITILKPWLPSLKAAVLHCFTGARAELESCLAEGLSIGITG
D2TCU2_ERWP6          LAAELSMPVFLHCREAHERFISILKPWLPRLKAAVLHCFTGTRAELESCLAEGLSIGITG
TATD_ERWT9            LAAELSLPVFLHCREAHERFISILKPWLPKLKAAVLHCFTGTRPELESCLAEGLFIGITG
TATD_PANVC            LAAELNMPVFLHCREAHARFAAVLEPWLPKLAGAVIHCFTGTRDELEACLAMGLSVGITG
TATD_PANAM            LAAELNMPVFLHCREAHERFAAVLEPWLPKLPAAVIHCFTGTREELTACLDMGLSVGITG
TATD_PANSA            LAAELQLPVFLHCREAHDRFAAILQPWLPKLVGAVAHCFTGTREELEACLAMGLSIGITG
TATD_EDWTE            LAAQIGKPVFLHCREAHARFIALLRPWLSRLPGAVLHCFTGTRDELDACLSLGLYIGITG
C5BCB0_EDWI9          LAARIGKPVFLHCREAHARFIALLRPWLSSLPGAVLHCFTGTRDELDACLSLGLYIGITG
                      :*     *:*:***:*  **  :* **   : . : *.***   :    :  *: :*:**

TATD_PECPW            WVCDERRGLELRALLPHIPADRLLVETDAPYLLPRDLRPKPASRRNEPCYLPHIIRQIAE
TATD_PECAS            WVCDERRGLELRALLPHIPADRLLVETDAPYLLPRDLRPKPASRRNEPCYLPHIIRQIAE
TATD_YERPY            WVCDERRGLDLRALLPRIPVQQLLLETDAPYLLPRDLNPKPASRRNEPCFLPHIVQQVAA
Q66FS4_YERPS          WVCDERRGLDLRALLPRIPVQQLLLETDAPYLLPRDLNPKPASRRNEPCFLPHIVQQVAA
TATD_SERP5            WVCDERRGLELRALLPQIPADRLLLETDAPYLLPRDLLPKPTSRRNEPCFLPHIVRQVAA
TATD_DICP7            WVCDERRGLALRALLEYIPDDRLLLETDAPYLLPRDLHPKPTSRRNEPCFLPHIVRQVAA
A0A2I5TE62_SERS3      WVCDERRGLELRALLEYIPDDRLLLETDAPYLLPRDLHPKPASRRNEPCFLPHIVRQVAT
Q1R471_ECOUT          WVCDERRGLELRELLPLIPAEKLLIETDAPYLLPRDLTPKPSSRRNEPAHLPHILQRIAH
B7UNG9_ECO27          WVCDERRGLELRELLPLIPAEKLLIETDAPYLLPRDLTPKPSSRRNEPAHLPHILQRIAH
E3PAX9_ECOH1          WVCDERRGLELRELLPLIPAEKLLIETDAPYLLPRDLTPKPSSRRNEPAHLPHILQRIAH
TATD_ECOLI            WVCDERRGLELRELLPLIPAEKLLIETDAPYLLPRDLTPKPSSRRNEPAHLPHILQRIAH
B7L9A2_ECO55          WVCDERRGLELRELLPLIPAEKLLIETDAPYLLPRDLTPKPSSRRNEPAHLPHILQRIAH
TATD_SHIF8            WVCDERRGLELRELLPLIPAEKLLIETDAPYLLPRDLTPKPSSRRNEPAHLPHILQRIAH
B2TVJ0_SHIB3          WVCDERRGLELRELLPLIPAEKLLIETDAPYLLPRDFTPKPSSRRNEPAHLHHILQRIAH
D3H4X7_ECO44          WVCDERRGLELRELLPLIPAEKLLIETDAPYLLPRDLTPKPSSRRNEPAYLPHILQRIAH
TATD_ESCF3            WVCDERRGLELRELLPLIPAEKLLIETDAPYLLPRDLTPKPTSRRNEPAYLPHILQRIAQ
Q8Z3C1_SALTI          WVCDERRGLELRELLPFIPAEKLLIETDAPYLLPRDLTPKPTSRRNEPAYLPHILERIAL
B5EZV4_SALA4          WVCDERRGLELRELLPFIPAEKLLIETDAPYLLPRDLTPKPTSRRNEPAYLPHILERIAL
A0A0H2WUR2_SALPA      WVCDERRGLELRELLPFIPAEKLLIETDAPYLLPRDLTPKPTSRRNEPAYLPHILERIAL
Q57HN2_SALCH          WVCDERRGLELRELLPFIPAEKLLIETDAPYLLPRDLTPKPTSRRNEPAYLPHILERIAL
TATD_SALTY            WVCDERRGLELRELLPFIPAEKLLIETDAPYLLPRDLTPKPTSRRNEPAYLPHILERIAL
A9MIX7_SALAR          WICDERRGLELRELLPFIPAEKLLIETDAPYLLPRDLTPKPTSRRNEPAYLPHILERIAL
S5NF05_SALBN          WVCDERRGLELRELLPFIPAEKLLIETDAPYLLPRDLTPKPTSRRNEPAYLPHILERIAR
TATD_CITK8            WVCDERRGLELRELLPFIPAEKLLIETDAPYLLPRDLTPKPASRRNEPAHLAHILARVAH
TATD_CITRI            WVCDERRGLALRELLPLIPTEKLLIETDAPYLLPRDLSPKPASRRNEPAYLPHILQRIAH
L0M8C8_ENTBF          WVCDERRGLELRELLPFIPAERLLIETDAPYLLPRDLSPKPKSRRNEPAFVTHILTQIAH
TATD_ENTLS            WVCDERRGLALRDMLPLIPANRLMVETDAPYLLPRDMTPKPGSRRNEPAYLAHIMARIAH
TATD_ENT38            WVCDERRGLELRELLPVIPADRLLVETDAPYLLPRDMKPKPASRRNEPAYLGHIVERIAH
R9VQW8_9ENTR          WVCDERRGLELREVVPLIPAGQLLIETDAPYLLPRDLKPKPASRRNEPALLGHILATVAV
TATD_KLEP3            WVCDERRGLELRELLPAIPAERLLLETDAPYLLPRDLKPRPASRRNEPAYLPHILASVAS
R4Y4F5_KLEPR          WVCDERRGLELRELLPAIPAERLLLETDAPYLLPRDLKPKPASRRNEPAYLPHILASVAA
TATD_CROS8            WVCDERRGLELRALLPVIPADRLLLETDAPYLLPRDLAPRPKSRRNEPCWLPHILKQVAQ
TATD_CROTZ            WVCDERRGLELRALLPIIPADRLLLETDAPYLLPRDLTPKPASRRNEPCWLPHILTQVAQ
A0A071LQ62_9ENTR      WVCDERRGLDLRELLPVIPASQLFLETDAPYLLPRDLLPKPRSRRNEPCLLPHIFQQVAR
TATD_RAHSY            WVCDERRGLELRDMLPLIPADRLMLETDAPYLLPRDMENKPKNRRNEPAFLPHIVKQVAL
H2IVX1_RAHAC          WVCDERRGLELREMLPLIPADRLMLETDAPYLLPRDMENKPKNRRNEPAFLPHIVKQAAL
TATD_ERWAE            WICDERRGQELRELVPLIPADRLLLETDAPWLLPRDMRPRPPSRRNEPCFLPHIVQQVAL
D2TCU2_ERWP6          WICDERRGQELRELVPLIPVDRLLLETDAPWLLPRDMRPRPPSRRNEPCFLPHIVQQVAL
TATD_ERWT9            WICDERRGQELRELMPLIPADRLLLETDAPWLLPRDMRPRPPSRRNEPCFLPHIVQQVAL
TATD_PANVC            WVCDERRGLELRELLPLIPADRLLLETDAPYLLPRDMRPRPTSRRNEPCFLPHIVNQVAT
TATD_PANAM            WVCDERRGIALREMLPLIPAERLLLETDAPYLLPRDMRPRPTSRRNEPCFLPHILQQVAN
TATD_PANSA            WVCDERRGMELRELLPLIPAERLLLETDAPWLLPRDMHPRPTSRRNEPCFLPHIVQQVAL
TATD_EDWTE            WICDERRGMPLRALLPHIPAERLLLETDAPYLLPRDIQPKPKSRRNEPCFLPHIAEQAAR
C5BCB0_EDWI9          WICDERRGMPQRALLPHIPAERLLLETDAPYLLPRNIQPKPKSRRNEPCFLPHIAEQVAR
                      *:******   * ::  **  :*::*****:****::  :* .*****. : **    * 

TATD_PECPW            WRGEDATWLGQITDENARRIFRLA----
TATD_PECAS            WRGEDATWLGQTTDENARRVFRLA----
TATD_YERPY            WRQEDPNWLGQKTDENARRVFRLV----
Q66FS4_YERPS          WRQEDPNWLGQKTDENARRVFRLV----
TATD_SERP5            WRQEDPEWLGQKIDENARRLFRLE----
TATD_DICP7            WRKQDAVALGRVVDDNARRIFRLGQKGE
A0A2I5TE62_SERS3      WRDQDASLLGERVDENARRVFRLA----
Q1R471_ECOUT          WRGEDAAWLAATTDANVKTLFGIAF---
B7UNG9_ECO27          WRGEDAAWLAATTDANVKTLFGIAF---
E3PAX9_ECOH1          WRGEDAAWLAATTDANVKTLFGIAF---
TATD_ECOLI            WRGEDAAWLAATTDANVKTLFGIAF---
B7L9A2_ECO55          WRGEDAAWLAATTDANVKTLFGIAF---
TATD_SHIF8            WRGEDAAWLAATTDANVKTLFGIAF---
B2TVJ0_SHIB3          WRGEDAAWLAATTDANVKTLFGIAF---
D3H4X7_ECO44          WRGEDAAWLAATTDANVKTLFGIAF---
TATD_ESCF3            WRGEDAACLAATTDTNVKTLFGISF---
Q8Z3C1_SALTI          WRGEDPQWLAAMTDANARTLFEVVF---
B5EZV4_SALA4          WRGEDPQWLAAMTDANARTLFEVVF---
A0A0H2WUR2_SALPA      WRGEDPQWLAAMTDANARTLFEVVF---
Q57HN2_SALCH          WRGEDPQWLAAMTDANARTLFEVVF---
TATD_SALTY            WRGEDPQWLAAMTDANARTLFEVVF---
A9MIX7_SALAR          WRDEDPQWLAAMTDANARTLFEVVF---
S5NF05_SALBN          WRGEDPQWLAAMTDANARTLFEVVF---
TATD_CITK8            WRGEDPQWLAATTDANVKTLFGIAF---
TATD_CITRI            WRGEDPQQLAAATDANAEKLFGITLKSA
L0M8C8_ENTBF          WRGEEAQWLESVTDNNVKTLFNITF---
TATD_ENTLS            WRGEDAQWLSGETDNNVRTLFGVAM---
TATD_ENT38            WRGEERQRLDAQTDENVRRLFGITF---
R9VQW8_9ENTR          LRGEEVQWLGSVTDQNVRRLFGVDF---
TATD_KLEP3            WRGEETQWLEAQTDANVRTLFGIDVNGV
R4Y4F5_KLEPR          WRGEEAQWLEAQTDANVRALFGVDINGV
TATD_CROS8            WRGEDPAWLEATTDANAARLFLKNASPA
TATD_CROTZ            WRGEDPAWLEAATDANAARLFLKNASPA
A0A071LQ62_9ENTR      WRNEDPNELEAATDNNVRRVFNLSF---
TATD_RAHSY            WRGEDPQWLADITDDNARKLFALSARR-
H2IVX1_RAHAC          WRGEDPQWLADITDDNARKLFALPLRR-
TATD_ERWAE            LRGDDVDELAAQTALNARALFGL-----
D2TCU2_ERWP6          LRGDDVDELAAQTALNARTLFSL-----
TATD_ERWT9            LRGDDAGELAAQTALNARRLFNL-----
TATD_PANVC            WRGESAEELATRIDQNARTLFRLA----
TATD_PANAM            WRGENVEMLARQVDHNARKLFGLI----
TATD_PANSA            WRNEAAETLGAQVDHNARQLFRLA----
TATD_EDWTE            WRQQDANWLKQVTENNARQLFRLA----
C5BCB0_EDWI9          WRQQDASWLRQVTENNARQLFRLA----
                       * :    :      *.  :*