CLUSTAL format seed alignment for MF_00902

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

I7CPH1_NATSJ          ------------------------------------------------------------
TATCT_HALVD           ------------------------------------------------------------
M1XZE0_NATM8          ------------------------------------------------------------
D3S1J6_FERPA          ------------------------------------------------------------
Q0W4Y5_METAR          ------------------------------------------------------------
Q97ZU3_SACS2          ------------------------------------------------------------
A8MCQ5_CALMQ          ------------------------------------------------------------
TATC_CENSY            ------------------------------------------------------------
Q6KZY6_PICTO          ------------------------------------------------------------
D3SVL3_NATMM          MSDESADAGETVDPDEDPANGDEEPSPSSESDAPETSEGADADADTDAETETGTDTNADS
Q9HN36_HALSA          ------------------------------MAEDSDGRHDAASEGPPWDGLQSAVRRVGG
M1XNN2_NATM8          ------------------------------------------------------------
Q8TKC1_METAC          ------------------------------------------------------------
TATC_METAR            ------------------------------------------------------------
F8A8M8_THEID          ------------------------------------------------------------
C7N7W2_SLAHD          ------------------------------------------------------------
E1QWP7_OLSUV          ------------------------------------------------------------
E3HCZ3_ILYPC          ------------------------------------------------------------
B3QTN4_CHLT3          ------------------------------------------------------------
A6LCU1_PARD8          ------------------------------------------------------------
A6L6V5_BACV8          ------------------------------------------------------------
C6X0T6_FLAB3          ------------------------------------------------------------
C7PMH2_CHIPD          ------------------------------------------------------------
C6XV03_PEDHD          ------------------------------------------------------------
G2Z214_FLABF          ------------------------------------------------------------
G8R5N0_OWEHD          ------------------------------------------------------------
A3UAJ3_CROAH          ------------------------------------------------------------
A0A6N4SQV5_CYTH3      ------------------------------------------------------------
C6VXQ9_DYAFD          ------------------------------------------------------------
C8WRE5_ALIAD          ------------------------------------------------------------
D5EP26_CORAD          ------------------------------------------------------------
B1ZP28_OPITP          ------------------------------------------------------------
D6Z185_DESAT          ------------------------------------------------------------
TATC_AKKM8            ------------------------------------------------------------
D6ZGM8_MOBCV          ------------------------------------------------------------
E8N7E5_MICTS          ------------------------------------------------------------
C7MCX3_BRAFD          ------------------------------------------------------------
C7NHS2_KYTSD          ------------------------------------------------------------
E6SAM0_INTC7          ------------------------------------------------------------
TATC_XYLCX            ------------------------------------------------------------
A6W980_KINRD          ------------------------------------------------------------
TATC_ROTMD            ------------------------------------------------------------
C5CBV5_MICLC          ------------------------------------------------------------
E1VW56_GLUAR          ------------------------------------------------------------
A9WSH2_RENSM          ------------------------------------------------------------
B2GIN3_KOCRD          ------------------------------------------------------------
D3Q548_STANL          ------------------------------------------------------------
D7GEA7_PROFC          ------------------------------------------------------------
TATC_FRACC            ------------------------------------------------------------
D2ATT8_STRRD          ------------------------------------------------------------
Q47P16_THEFY          ------------------------------------------------------------
A0LU67_ACIC1          ------------------------------------------------------------
D2S6F0_GEOOG          ------------------------------------------------------------
C6WIE9_ACTMD          ------------------------------------------------------------
C8XAP1_NAKMY          ------------------------------------------------------------
B1VDV8_CORU7          ------------------------------------------------------------
D5UPM4_TSUPD          ------------------------------------------------------------
TATC_MYCTU            ------------------------------------------------------------
Q0SIG7_RHOJR          ------------------------------------------------------------
F6EP00_HOYSD          ------------------------------------------------------------
TATC_CORK4            ------------------------------------------------------------
Q8NQE5_CORGL          ------------------------------------------------------------
C7PVW6_CATAD          ------------------------------------------------------------
G2P670_STRV4          ------------------------------------------------------------
B1W318_STRGG          ------------------------------------------------------------
D2Q3I8_KRIFD          ------------------------------------------------------------
A1SK21_NOCSJ          ------------------------------------------------------------
Q2G128_STAA8          ------------------------------------------------------------
D5SQP1_PLAL2          ------------------------------------------------------------
E8R5A8_ISOPI          ------------------------------------------------------------
Q6AN67_DESPS          ------------------------------------------------------------
D6Z4B1_DESAT          ------------------------------------------------------------
B1HXK1_LYSSC          ------------------------------------------------------------
D6XUT8_BACIE          ------------------------------------------------------------
Q8EQG3_OCEIH          ------------------------------------------------------------
D5WSC2_KYRT2          ------------------------------------------------------------
C5D4F0_GEOSW          ------------------------------------------------------------
Q5WJP1_BACSK          ------------------------------------------------------------
TATC_BACHD            ------------------------------------------------------------
C0ZK48_BREBN          ------------------------------------------------------------
E3EID4_PAEPS          ------------------------------------------------------------
C6CVH0_PAESJ          ------------------------------------------------------------
D8K211_DEHLB          ------------------------------------------------------------
E6SMD5_THEM7          ------------------------------------------------------------
E8N519_ANATU          ------------------------------------------------------------
A5URY8_ROSS1          ------------------------------------------------------------
B9L0C4_THERP          ------------------------------------------------------------
D1CCN1_THET1          ------------------------------------------------------------
C7LYQ4_ACIFD          ------------------------------------------------------------
Q7UFI8_RHOBA          ------------------------------------------------------------
B3E195_METI4          ------------------------------------------------------------
Q1AUL3_RUBXD          ------------------------------------------------------------
Q7U568_SYNPX          ------------------------------------------------------------
TATC_ORYSJ            -----------------MGSAGALLSHSPPGLGGFPPRHHHHHRLSVLRCVPLLPSPAPE
TATC_MAIZE            --------------------MGSAGALLWHTPQQLHGRGILFRQSRPLLRQRNLPLISLA
K3XJC3_SETIT          -------------------MGSAGTPLSHPRPHLHSGGVYISQSRTLPRARNLPLLSLPA
Q114K5_TRIEI          ------------------------------------------------------------
B0CFY2_ACAM1          ------------------------------------------------------------
E0UC67_GLOV7          ------------------------------------------------------------
C1A4F6_GEMAT          ------------------------------------------------------------
B3E7M3_GEOLS          ------------------------------------------------------------
E1X470_HALMS          ------------------------------------------------------------
A9EPV7_SORC5          ------------------------------------------------------------
Q67QH4_SYMTH          ------------------------------------------------------------
A9KHC2_LACP7          ------------------------------------------------------------
J9ZE06_LEPFM          ------------------------------------------------------------
Q023M6_SOLUE          ------------------------------------------------------------
TATC_DEIRA            ------------------------------------------------------------
D7BE12_MEISD          ------------------------------------------------------------
D7CQR8_TRURR          ------------------------------------------------------------
A5EVU4_DICNV          ------------------------------------------------------------
Q9PFU5_XYLFA          ------------------------------------------------------------
Q1H3X3_METFK          ------------------------------------------------------------
A9BXA9_DELAS          ------------------------------------------------------------
A1AVV9_RUTMC          ------------------------------------------------------------
TATC_HALNC            ------------------------------------------------------------
Q47AM9_DECAR          ------------------------------------------------------------
E5APW1_PARRH          ------------------------------------------------------------
Q2YAV6_NITMU          ------------------------------------------------------------
Q31E59_HYDCU          ------------------------------------------------------------
Q48AI0_COLP3          ------------------------------------------------------------
G4QJK5_GLANF          ------------------------------------------------------------
D3SCC9_THISK          ------------------------------------------------------------
H8GJD2_METAL          ------------------------------------------------------------
K0C6J4_CYCSP          ------------------------------------------------------------
D3RQL8_ALLVD          ------------------------------------------------------------
I3YA58_THIV6          ------------------------------------------------------------
F6A8L5_PSEF1          ------------------------------------------------------------
TATC_HAEIN            ------------------------------------------------------------
TATC_ECOLI            ------------------------------------------------------------
H2IVX2_RAHAC          ------------------------------------------------------------
D1BNH6_VEIPT          ------------------------------------------------------------
A8MIP1_ALKOO          ------------------------------------------------------------
E1R121_SEDSS          ------------------------------------------------------------
D2RIN1_ACIFV          ------------------------------------------------------------
C6XIZ5_HIRBI          ------------------------------------------------------------
A0A0H3LXY3_BARHE      ------------------------------------------------------------
E0TEC0_PARBH          ------------------------------------------------------------
Q28T34_JANSC          ------------------------------------------------------------
TATC_RHOCB            ------------------------------------------------------------
A1B0H6_PARDP          ------------------------------------------------------------
Q0AND8_MARMM          ------------------------------------------------------------
Q2GER9_NEOSM          ------------------------------------------------------------
B3PIX7_CELJU          ------------------------------------------------------------
Q0C0W0_HYPNA          ------------------------------------------------------------
Q3SRQ3_NITWN          ------------------------------------------------------------
B9JXD9_AGRVS          ------------------------------------------------------------
Q98LC7_RHILO          ------------------------------------------------------------
D9QLG6_BRESC          ------------------------------------------------------------
B0T1Q5_CAUSK          ------------------------------------------------------------
C7JE44_ACEP3          ------------------------------------------------------------
Q2G9D2_NOVAD          ------------------------------------------------------------
TATC_MAGMM            ------------------------------------------------------------
D5BQU2_PUNMI          ------------------------------------------------------------
I3TKT9_TISMK          ------------------------------------------------------------
Q2RTH4_RHORT          ------------------------------------------------------------
Q6MGQ9_BDEBA          ------------------------------------------------------------
B2A204_NATTJ          ------------------------------------------------------------
A5D1I5_PELTS          ------------------------------------------------------------
B0TFS8_HELMI          ------------------------------------------------------------
D5X7P7_THEPJ          ------------------------------------------------------------
B8D1R3_HALOH          ------------------------------------------------------------
Q0AZ46_SYNWW          ------------------------------------------------------------
TATC_CARHZ            ------------------------------------------------------------
TATC_KORVE            ------------------------------------------------------------
C1F555_ACIC5          ------------------------------------------------------------
E8X125_GRATM          ------------------------------------------------------------
I3ZCY6_TERRK          ------------------------------------------------------------
D0LGH0_HALO1          ------------------------------------------------------------
Q2IM06_ANADE          ------------------------------------------------------------
A7H6D7_ANADF          ------------------------------------------------------------
B2V5Y3_SULSY          ------------------------------------------------------------
TATC_PELCD            ------------------------------------------------------------
F2LUZ5_HIPMA          ------------------------------------------------------------
D3UFV2_HELM1          ------------------------------------------------------------
B9LA52_NAUPA          ------------------------------------------------------------
E6X1G9_NITSE          ------------------------------------------------------------
TATC_CAMJE            ------------------------------------------------------------
A0A5B9TTD1_SULMU      ------------------------------------------------------------
A8Z6M5_CAMC1          ------------------------------------------------------------
B5YKH3_THEYD          ------------------------------------------------------------
E6W513_DESIS          ------------------------------------------------------------
E4TGB2_CALNY          ------------------------------------------------------------
E6VUV0_PSEA9          ----------------------MSSDKDEVKSAAPGEPVAEPSGASSADDPSLMNADDPS
Q1MQT5_LAWIP          ------------------------------------------------------------
C8X1I2_DESRD          ------------------------------------------------------------
C6BSE0_DESAD          ------------------------------------------------------------
TATC_DESAH            ------------------------------------------------------------
A9A055_DESOH          ------------------------------------------------------------
C4XP92_DESMR          ------------------------------------------------------------
Q2LXN7_SYNAS          ------------------------------------------------------------
                                                                                  

I7CPH1_NATSJ          -----------------------------------------------------------M
TATCT_HALVD           -----------------------------------------------------------M
M1XZE0_NATM8          -----------------------------------------------------------M
D3S1J6_FERPA          ------------------------------------------------------------
Q0W4Y5_METAR          ------------------------------------------------------------
Q97ZU3_SACS2          --------------------------------------------------------MTER
A8MCQ5_CALMQ          ------------------------------------------------------------
TATC_CENSY            ------------------------------------------------------------
Q6KZY6_PICTO          ------------------------------------------------------------
D3SVL3_NATMM          ASASDSETDSGATADSDADSDADFGPDPDADSDSDSDSDSDADHPVETDGEGVVGGHEPG
Q9HN36_HALSA          GESEGGEFTRVDDDEQPSAEASEPELLPEDRHQTATPRDHEAGGPTAATQPTPGGVAAGA
M1XNN2_NATM8          --------------------------------------------MAETADGSYDADDGLV
Q8TKC1_METAC          -----------------------------------------------------MNSHNTR
TATC_METAR            --------------------------------------------------------MAAE
F8A8M8_THEID          ------------------------------------------------------------
C7N7W2_SLAHD          ------------------------------------------------------------
E1QWP7_OLSUV          ------------------------------------------------------------
E3HCZ3_ILYPC          -----------------------------------------------------------M
B3QTN4_CHLT3          ---------------------------------------------MLETEQTKVLTSGDS
A6LCU1_PARD8          ------------------------------------------------------------
A6L6V5_BACV8          ------------------------------------------------------------
C6X0T6_FLAB3          ------------------------------------------------------------
C7PMH2_CHIPD          -------------------------------------------------------MFKKI
C6XV03_PEDHD          ----------------------------------------------MSDNKKRDLIGAIK
G2Z214_FLABF          ------------------------------------------------------------
G8R5N0_OWEHD          ------------------------------------------------------------
A3UAJ3_CROAH          ---------------------------------------------------------MAK
A0A6N4SQV5_CYTH3      ---------------------------------------------------------MGK
C6VXQ9_DYAFD          ---------------------------------------------------------MSL
C8WRE5_ALIAD          ------------------------------------------------------------
D5EP26_CORAD          ---------------------------------------------------------MDD
B1ZP28_OPITP          ------------------------------------------------------------
D6Z185_DESAT          ------------------------------------------------------------
TATC_AKKM8            ----------------------------------MLLRMALCLTVSTILCAGFASNLMDI
D6ZGM8_MOBCV          ----------------------------------------------------------MP
E8N7E5_MICTS          ------------------------------------------------MTTAVAPSAASS
C7MCX3_BRAFD          ------------------------------------------------------------
C7NHS2_KYTSD          -----------------------------------------------------------M
E6SAM0_INTC7          ------------------------------------------------------------
TATC_XYLCX            ---------------------------------------MVSLTSVPPYADATPDTRASS
A6W980_KINRD          -----------------------------------------------------------M
TATC_ROTMD            ---------------------------------------------------MATPDQDVR
C5CBV5_MICLC          ----------------------------------------------------MTEVDEVA
E1VW56_GLUAR          ------------------------------------------------------MATNKD
A9WSH2_RENSM          -------------------------------------------------------MALFK
B2GIN3_KOCRD          ------------------------------------------------------------
D3Q548_STANL          -----------------------------------------------------MALSLRR
D7GEA7_PROFC          --------------------------------------------MAITVDEKAGDGSQEA
TATC_FRACC            -------------------------------------------MPGLPTPRRLVASVNYR
D2ATT8_STRRD          -----------------------------------------------------MALLKWP
Q47P16_THEFY          -----------------------------------------------------MGTGEAR
A0LU67_ACIC1          -----------------------------------------------------------M
D2S6F0_GEOOG          -----------------------------------------------MSDSTRGGAARRS
C6WIE9_ACTMD          --------------------------------------------------------MSRR
C8XAP1_NAKMY          ---------------------------------------------------MRVFGRTVP
B1VDV8_CORU7          ----------------------------------------------MSNTPQAARPARRP
D5UPM4_TSUPD          ---------------------------------------------------------MKI
TATC_MYCTU            ---------------------------------------------------MRAAGLLKR
Q0SIG7_RHOJR          ---------------------------------------------------------MRI
F6EP00_HOYSD          ------------------------------------------------------------
TATC_CORK4            ----------------------------------------------------MTQSTSVS
Q8NQE5_CORGL          -------------------------------------------------------MVKRP
C7PVW6_CATAD          -------------------------------------------------------MTTQA
G2P670_STRV4          ------------------------------------------------------MLKSAR
B1W318_STRGG          ------------------------------------------------------------
D2Q3I8_KRIFD          --------------------------------------------------------MTLV
A1SK21_NOCSJ          -----------------------------------------------------MSLSGVF
Q2G128_STAA8          ------------------------------------------------------------
D5SQP1_PLAL2          --------------------------------------MASPQITPSPAVSKSRSTPSIK
E8R5A8_ISOPI          -----------------------------------------------------MVTQEDL
Q6AN67_DESPS          ----------------------------------------------------MGHYNLEQ
D6Z4B1_DESAT          ------------------------------------------------------------
B1HXK1_LYSSC          -----------------------------------------MDPYEDGKRKFLSPLDKPQ
D6XUT8_BACIE          ------------------------------------------------------------
Q8EQG3_OCEIH          ----------------------------------------------------------MS
D5WSC2_KYRT2          ------------------------------------------------------------
C5D4F0_GEOSW          ------------------------------------------------------------
Q5WJP1_BACSK          -------------------------------------------------MTMMTPNQQTS
TATC_BACHD            ------------------------------------------------------------
C0ZK48_BREBN          ------------------------------------------------------------
E3EID4_PAEPS          ------------------------------------------------------------
C6CVH0_PAESJ          -----------------------------------------------------MSTSQDK
D8K211_DEHLB          ------------------------------------------------------------
E6SMD5_THEM7          -------------------------------------------------------MVQDP
E8N519_ANATU          ---------------------------------------------------------MKE
A5URY8_ROSS1          -----------------------------MEFTSTQLIIIVTVLTVLILLPLLVILLVRI
B9L0C4_THERP          ------------------------------------------------MVSLLDRVRGQP
D1CCN1_THET1          -----------------------------------------------------MKTDQDM
C7LYQ4_ACIFD          ------------------------------------------------------MALRRP
Q7UFI8_RHOBA          ---------------------------------------------------MASSSSVQS
B3E195_METI4          ------------------------------------------------------------
Q1AUL3_RUBXD          -----------------------------------------------------MARLRAA
Q7U568_SYNPX          ---------------------MTHSGPRPDSAASRLLAWPLERADASARSAIPSVPDSSD
TATC_ORYSJ            PLSCRHGRHLRCAAVDGGAGRETERPSPPAPQREESPSGSLGAALEDPSPQPVQNGSFGG
TATC_MAIZE            APALEPERRRRQCLRCAAVDGDGALRESGPLPQKESPSSGIGAALEDPPPGPPVENGSFG
K3XJC3_SETIT          AAPGPQRGRRRCLRCAAVNGDGRPREEGPPPPREEYPSSGLGAALEDPASGPPVENGSFG
Q114K5_TRIEI          -----------------------------MTLPEDLNKNSLAPTPTGLKNPEISSDKVED
B0CFY2_ACAM1          --------------------------------------------------MTPSDLETAP
E0UC67_GLOV7          --------------------------------------------MLPTDTQTSEHDYTPY
C1A4F6_GEMAT          ------------------------------------------------------------
B3E7M3_GEOLS          ------------------------------------------------------------
E1X470_HALMS          ------------------------------------------------------------
A9EPV7_SORC5          --------------------------------------MSQEQAAVKSGSPGAEGAPSDA
Q67QH4_SYMTH          ------------------------------------------------------------
A9KHC2_LACP7          -----------MKTKRMEKRNQ--------------------------------------
J9ZE06_LEPFM          ------------------------------------------------------------
Q023M6_SOLUE          ------------------------------------------------------------
TATC_DEIRA            ------------------------------------------------MTQLPPPEQTVL
D7BE12_MEISD          ------------------------------------------------------------
D7CQR8_TRURR          ------------------------------------------------------------
A5EVU4_DICNV          ------------------------------------------------------------
Q9PFU5_XYLFA          -----------------------------------------------------------M
Q1H3X3_METFK          ------------------------------------------------------------
A9BXA9_DELAS          ------------------------------------------------------MSDIPP
A1AVV9_RUTMC          ------------------------------------------------------------
TATC_HALNC            ----------------------------------------------MTERDSSPEADKNG
Q47AM9_DECAR          ------------------------------------------------------------
E5APW1_PARRH          ---------------MCSRARLAWRGIHRQTCGGRSVSCDPVPFPVHFFSPSQAAVSEAP
Q2YAV6_NITMU          ------------------------------------------------------------
Q31E59_HYDCU          ---------------------------------------------------------MSQ
Q48AI0_COLP3          ------------------------------------------------------------
G4QJK5_GLANF          ------------------------------------------------------------
D3SCC9_THISK          ------------------------------------------------------MSKTKP
H8GJD2_METAL          -----------------------------------------------------------M
K0C6J4_CYCSP          -----------------------------------------------------------M
D3RQL8_ALLVD          --------------------------------------------------------MSLA
I3YA58_THIV6          --------------------------------------------------------MSSA
F6A8L5_PSEF1          -----------------------------------------------------------M
TATC_HAEIN            ------------------------------------------------------------
TATC_ECOLI            ------------------------------------------------------------
H2IVX2_RAHAC          ------------------------------------------------------------
D1BNH6_VEIPT          ------------------MEPFEPKSDFEYPMQKPSFDSVVRQKRREAEQKSEQERYKVA
A8MIP1_ALKOO          ------------------------------------------------------------
E1R121_SEDSS          ------------------------------------------------------------
D2RIN1_ACIFV          ------------------------------------------------------------
C6XIZ5_HIRBI          ----------------------------------------------MTDIQTKTSNSGPE
A0A0H3LXY3_BARHE      ---------------------------------------------------------MNV
E0TEC0_PARBH          ----------------------------------------------MASSQSANWNEHSV
Q28T34_JANSC          ----------------------------------------------MTQTDAQTEADADQ
TATC_RHOCB            -----------------------------------------------------------M
A1B0H6_PARDP          -----------------------------------------------------MSAKSDK
Q0AND8_MARMM          --------------------------------------------------------MAEI
Q2GER9_NEOSM          ------------------------------------------------------------
B3PIX7_CELJU          ----------------------------------------------------------MN
Q0C0W0_HYPNA          -----------------------------------------------MNQLPPKDEQPEI
Q3SRQ3_NITWN          -----------------------------------------------------------M
B9JXD9_AGRVS          ------------------------------------------------------------
Q98LC7_RHILO          ------------------------------------------------------MSVSDK
D9QLG6_BRESC          --------------------------------------------------------MTVR
B0T1Q5_CAUSK          -----------------------------------------------------------M
C7JE44_ACEP3          -----------------------------------------------------MNENETV
Q2G9D2_NOVAD          ------------------------------------------------------------
TATC_MAGMM            ------------------------------------------------------------
D5BQU2_PUNMI          ---------------------------MAKPPKKNKADNQKPEIIDETTADVEMDDDVQN
I3TKT9_TISMK          -------------------------------------------------------MATHD
Q2RTH4_RHORT          ----------------------------------------------------------MA
Q6MGQ9_BDEBA          -----------------------------------------------------------M
B2A204_NATTJ          ------------------------------------------------------------
A5D1I5_PELTS          ------------------------------------------------------------
B0TFS8_HELMI          -----------------------------------------------------------M
D5X7P7_THEPJ          ------------------------------------------------------------
B8D1R3_HALOH          ------------------------------------------------------------
Q0AZ46_SYNWW          ---------------------------------------------------------MAL
TATC_CARHZ            ------------------------------------------------------------
TATC_KORVE            ------------------------------------------------MPSPTIDPAIRA
C1F555_ACIC5          -------------------------------------------------MSDIVDRARAA
E8X125_GRATM          -------------------------------------------------MADLIDNVRAN
I3ZCY6_TERRK          -------------------------------------------------MSDVIDKAREA
D0LGH0_HALO1          --------------------------------------------------MAEPRRVIEP
Q2IM06_ANADE          --------------------------------------------MSETVPQLPPPPPPSP
A7H6D7_ANADF          --------------------------------------------MSSTAPQL--PPAGAA
B2V5Y3_SULSY          ------------------------------------------------------------
TATC_PELCD            ------------------------------------------------------------
F2LUZ5_HIPMA          ----------------------------------------------------------MK
D3UFV2_HELM1          ------------------------------------------------------------
B9LA52_NAUPA          ------------------------------------------------------------
E6X1G9_NITSE          ------------------------------------------------------------
TATC_CAMJE            ------------------------------------------------------------
A0A5B9TTD1_SULMU      ------------------------------------------------------------
A8Z6M5_CAMC1          ------------------------------------------------------------
B5YKH3_THEYD          ------------------------------------------------------------
E6W513_DESIS          ----------------------------------------------------MAPNRDDA
E4TGB2_CALNY          ------------------------------------------------------------
E6VUV0_PSEA9          LTNPDGPVITDEGLAEAREALDASSGGSGDGSGGDSPGGGSGSGSGGGSGGGSGGGSGGS
Q1MQT5_LAWIP          ---------MSDSGAIKDTDSNMLLDSSQEKFVESMHGEQEQAYLPGITPPVNNTSLIIT
C8X1I2_DESRD          ---------------------------------------------------------MSE
C6BSE0_DESAD          ------MSSAEKDSREVGQESPEEKKQAEETAAESLNPEEETAESIEFEAGLPAEKDADG
TATC_DESAH            ------------------------------------------------------------
A9A055_DESOH          ------------------------------------------------------------
C4XP92_DESMR          ------------------------------------------------------------
Q2LXN7_SYNAS          ------------------------------------------------------MPIQEL
                                                                                  

I7CPH1_NATSJ          SSAVDEDT----------AKALNTG-----RET-----------IGALLSGAQQHLQKVF
TATCT_HALVD           SSALDEDT----------QQTIAAG-----RET-----------AGAMLRAAQKDLQKVF
M1XZE0_NATM8          SSAVDDDV----------ARTVSEG-----RAH-----------LGALLRTAQKHLQKVF
D3S1J6_FERPA          -MTELTLK----------------------DVA-------------EILVAVRMKLIKVI
Q0W4Y5_METAR          --MPLLQD------------------------------------FAALFVRFRKNLLYLG
Q97ZU3_SACS2          TREVEKLE----------------------ERP-----------LIEHLRELAYRLRRIL
A8MCQ5_CALMQ          ------MQ----------------------EQP-----------LMSHIVELISRLRKAL
TATC_CENSY            ------MS----------------------EMQ-----------FGKHLDELRRRALRVV
Q6KZY6_PICTO          MENEIFNY------------------------------------LVKYSDEIRYRLIRSL
D3SVL3_NATMM          SESDDQSYPDPDEDVGGISTPPDDQ-----EMP-----------LADHIEEMILRVAVVL
Q9HN36_HALSA          SSDPDAAG----------GGIGMDAPESDEEAP-----------LGEHIEEMVTRLGIVV
M1XNN2_NATM8          GEGPESDE----------------------EMP-----------LADHIEEMVYRLGIVL
Q8TKC1_METAC          NQLPDTGNKINGSTNTYSSGVPGDF-----EEP-----------LMAHLYELRNRLAVVL
TATC_METAR            SSLPPGDM----------------------EMS-----------LSEHLRELRNRLIIVI
F8A8M8_THEID          ---MAQRT----------------------KIT-----------FLTHFEELRRRILFFL
C7N7W2_SLAHD          --MPIGPA----------------------RMP-----------LFEHLGELRMRLVRIV
E1QWP7_OLSUV          --MPIGPA----------------------RMP-----------LMDHLGELRRRLTIVV
E3HCZ3_ILYPC          EANAASDK----------------------YMH-----------IFEHLKELRKKLIISV
B3QTN4_CHLT3          NENAQPEE----------------------ELG-----------FFDHLEELRWRLLKSV
A6LCU1_PARD8          ----MQQE----------------------EMS-----------FWDHLEELRWTLFRSI
A6L6V5_BACV8          --MEQQQK----------------------ILT-----------FWDHLEELRHVLFRIA
C6X0T6_FLAB3          --MVEKK-----------------------EMS-----------FWGHIGELRGHLIRSL
C7PMH2_CHIPD          FSNNEEKA----------------------EMS-----------FFDHLEDLRWHIVRSI
C6XV03_PEDHD          EKGKTLEA----------------------EMS-----------FFDHIDVLRKHLLRSL
G2Z214_FLABF          --MEKELK----------------------EMS-----------FLDHLEDLRWLLIRIT
G8R5N0_OWEHD          -MAKGNTG----------------------EMS-----------FLQHLEILRWHLVRST
A3UAJ3_CROAH          KSVKEVAK----------------------EMS-----------FLDHLEDLRWHLIRCV
A0A6N4SQV5_CYTH3      SFVKDHSA----------------------EFS-----------VLDHIEELRWRLIRAV
C6VXQ9_DYAFD          DQDFERED----------DEDGDGK-----EMS-----------FISHLEELRWHVIRAG
C8WRE5_ALIAD          ------------------------------MSG-----------WDGHLRALRGHLIRSA
D5EP26_CORAD          AVAEARER----------------------GMS-----------FIEHLEEFRWTVARSL
B1ZP28_OPITP          MSAVDEQL----------DEEETSE-----KKS-----------FWDHLRDLRTALVRSA
D6Z185_DESAT          ---MVRRQ----------------------GHP-----------LARIIRDLRGPSFYLG
TATC_AKKM8            LRRPVNQVWDMFEESHLPAGIGLDAWSKAKEMA----------TAMTSLGASQRALFLRQ
D6ZGM8_MOBCV          AEKLPDKK----------RDARSEG-----VMS-----------VTAHLAELRRRLIWSF
E8N7E5_MICTS          RSEAPRSA----------------------PMP-----------VAAHLEEATRRAVWAA
C7MCX3_BRAFD          -------------------------------MS-----------LGEHLTELRNRLMICA
C7NHS2_KYTSD          TPRTPFRR----------KASNPEG-----RMA-----------LLDHFKELRNRLLLAA
E6SAM0_INTC7          -------------------------------MS-----------LADHLRELRNRVMLAG
TATC_XYLCX            GPAPGRRK----------------------RMP-----------LREHLAELRTRLLLVA
A6W980_KINRD          AVTTVRRR----------APKDPEG-----RMP-----------LMAHLKELRDRVFKAA
TATC_ROTMD            NRKINPEA----------------------RME-----------LKEHLREFRDRLIKAA
C5CBV5_MICLC          RRTRRRRK----------RRDNPTG-----EMP-----------LREHLTEMRNRLLKSG
E1VW56_GLUAR          KTPRSKKK----------RVKDAEG-----RMA-----------LKEHLIEARNRLFKSL
A9WSH2_RENSM          GYKSNPEG----------------------RMS-----------LKQHLIELRNRLIKAA
B2GIN3_KOCRD          -------------------------------MA-----------LKEHLREFRNRLIKSA
D3Q548_STANL          NKKPKKTK----------FQAAADG-----SMS-----------LMDHLRDLRSRLFKAC
D7GEA7_PROFC          APGKKRRRLHLLPKSWRPPEPAADG-----SME-----------LVDHLRELRYRVIVSI
TATC_FRACC            RTRTVEDS----------------------RMP-----------LTEHLRELRNRVAIAL
D2ATT8_STRRD          KPGQNGSV----------STDSAEG-----RMP-----------LMEHLRELRNRLVIVL
Q47P16_THEFY          GRYRVRRRTRTAMRTRRQRKANPEA-----RMP-----------LMEHLRELRDRLLRSM
A0LU67_ACIC1          ARRRDPEG----------------------RMP-----------LGEHLRELRARILKSL
D2S6F0_GEOOG          GLRRRRRP----------PRDP-AA-----TMT-----------LVAHLTELRNRVAKAL
C6WIE9_ACTMD          RESRKLRS----------KRHNPEG-----TMS-----------LRDHLYELRNRLGWAL
C8XAP1_NAKMY          SLRLRRGR----------PPKSPDG-----TMP-----------LMSHLHELRRRLFVAT
B1VDV8_CORU7          RHRAFRRA----------NQRPTDG-----AMS-----------IVEHIQELRRRLIIAV
D5UPM4_TSUPD          PFDPRRRR----------AVVNPDG-----TMS-----------IVEHLFELRARLLWSL
TATC_MYCTU            LNPRNRR-----------SRVNPDA-----TMS-----------LVDHLTELRTRLLISL
Q0SIG7_RHOJR          PFDPRHSK----------RRTNPDG-----TMS-----------LVDHLYELRTRLLLSV
F6EP00_HOYSD          -------------------------------MP-----------LVEHLYELRTRLLVSL
TATC_CORK4            KGGRVSRK----------AKKNPDG-----TMS-----------IVDHLRELRTRLLRAL
Q8NQE5_CORGL          RRVISKK-----------KKKSPTG-----EMS-----------IVEHIKEFRRRLLIAL
C7PVW6_CATAD          SANGTRPQGKSKPSKIVKVPKDPEG-----RMP-----------LGDHIRELRTRLFRAS
G2P670_STRV4          TKEKDPEG----------------------RMP-----------LAEHLRELRNRLLKSV
B1W318_STRGG          -MLKSARK----------QEKDDEG-----RMP-----------LLDHLRELRNRLLKAV
D2Q3I8_KRIFD          RIGRRKER----------RPEDDEG-----RMT-----------LREHIAELRNRLLIAV
A1SK21_NOCSJ          DYFSGRPR----------HPVGADG-----RMA-----------LSDHLRELRARLLKSV
Q2G128_STAA8          -------------------------------MS-----------FV--------------
D5SQP1_PLAL2          TKDLFDDS----------------------TMT-----------FGEHLEVLRVHVFRAM
E8R5A8_ISOPI          FAEEEQMV----------------------AMS-----------FGDHLEELRVRLLLAI
Q6AN67_DESPS          TIPMLERS----------------------LAL-----------FRPHHLELRKRIIRIG
D6Z4B1_DESAT          ----MSAL----------------------ASH-----------FTPHLRELRRRLLTVI
B1HXK1_LYSSC          AEPPLPMEALVEIQAVKMEDQQVAEEPIIPVTS-----------LLEHLSDLRKQIIKGL
D6XUT8_BACIE          --MADQDQ----------------------SMN-----------LLDHLDELRKRLMIVV
Q8EQG3_OCEIH          TPEDQYTS----------NTDGTEK-----EMN-----------VVGHLSELRNRLIVTA
D5WSC2_KYRT2          -MEAPQDQ----------------------PKT-----------FVEHLAELRKLLIQTL
C5D4F0_GEOSW          ----MDDK----------------------EMS-----------VYEHLGELRKRLIIVL
Q5WJP1_BACSK          KKKKRKGR----------KGRVPMQ-----DMS-----------IMDHAEELRRRIFVVL
TATC_BACHD            ----MNER----------------------DMS-----------LMDHIAELRRRILIIV
C0ZK48_BREBN          -------------------------------MT-----------LVEHLTELRKRIIWVL
E3EID4_PAEPS          --MTPSEH----------------------EMP-----------LMEHLGELRRRIIYVL
C6CVH0_PAESJ          ASGQSFDR----------ARIREEG-----LMP-----------LFEHLGELRKRIIYML
D8K211_DEHLB          -MTTEEES----------------------RLP-----------ITQHFTEMRQRFIRAL
E6SMD5_THEM7          GEEAGGGI----------------------WPS-----------LAEHLSELRLRIIYSG
E8N519_ANATU          DERMAADK----------------------EMA-----------IWDHINELRSRLLKAL
A5URY8_ROSS1          FIKDDVPA----------DGEEAVS-----SLTEFTSIGDVWRAFVPHLLELRDRLVKSL
B9L0C4_THERP          APQPNEPE--------------PEPEEFYKEMT-----------LQEHLEELRTRLIYAL
D1CCN1_THET1          YIPDNQGE----------GEEYEGP-----EMT-----------LTEHLAELRSRLIRAG
C7LYQ4_ACIFD          RRRRLDPN----------------------AMT-----------TVEHLRELRRRLIRAI
Q7UFI8_RHOBA          SSAQWYPPSPGGLKLVEALTRPKDDLFDNSTMT-----------FGEHLEELRGSLVKAI
B3E195_METI4          MTTMKYYE----------------------EKP-----------FLEHLEDLRWVIIKSL
Q1AUL3_RUBXD          LTRPRDEA----------------------RMT-----------IIEHLDELRSRIIKVG
Q7U568_SYNPX          GPVLKPPPPIRISGGTDPSALPNEV-----EMP-----------LVDHLEELRQRVLRSL
TATC_ORYSJ            ITEDEEQSSLYNFLYPSKELLPDDK-----EMS-----------IFDHLEELRDRIFVSV
TATC_MAIZE            GPSQEEQSALYTFLYPSKDLLPDDK-----EMS-----------IFDHLEELRDRIFISV
K3XJC3_SETIT          GLSQEEDQSALYNFLYPSKELLPDDK----EMS-----------IFDHLEELRERIFISV
Q114K5_TRIEI          ITSPDLEDPRNSEADDNLDKVPDEV-----EMS-----------IFEHLEELRMRIFSSL
B0CFY2_ACAM1          SKAPTDAD------------IQPDDGLNDVEMS-----------LFEHLEELRFRIFYAL
E0UC67_GLOV7          LDEIPDEV----------------------EMS-----------IFDHLEELRMRIFYAL
C1A4F6_GEMAT          ----MAGS----------T----PG-----EMP-----------FLEHLEELRWRLFKCA
B3E7M3_GEOLS          -MNREKEN----------------------VAS-----------FIEHLTELRKRLIIIV
E1X470_HALMS          ------MK----------------------EMS-----------LVEHLEELRSTMVRVL
A9EPV7_SORC5          AEDPGEDK----------------------PMS-----------FWEHLDELRKRLVRSL
Q67QH4_SYMTH          ----MQDK----------------------ELT-----------LVEHLTELRERIIKSL
A9KHC2_LACP7          -GYMDSKE----------L----GE-----SKT-----------LMEHLLDFRKVLIFST
J9ZE06_LEPFM          --MPVDPK----------------------ASP-----------LWGHIVELRQRVLRSL
Q023M6_SOLUE          ----------------------------MLRMS-----------FLGHLEELRSRIIKSL
TATC_DEIRA            KPAPPELA----------------------SAP-----------LFDHLEELRRRLILSV
D7BE12_MEISD          ------MR----------------------EAP-----------LIEHLEELRSRIIWSL
D7CQR8_TRURR          -------------------------------MT-----------LIEHFEELRTRLFIAL
A5EVU4_DICNV          -------------------------------MP-----------LVEHLIELRRCVIHAL
Q9PFU5_XYLFA          TSSDDLES----------------------ESS-----------LIEHLIELRARLIRML
Q1H3X3_METFK          ---MEQDG------------------------------------FLSHFYELRTRFIRII
A9BXA9_DELAS          KDDELAGT----------------------EQP-----------FVQHLMELRDRLLYCI
A1AVV9_RUTMC          ----MTNK----------------------EMT-----------FVQHLVELRNILLHSI
TATC_HALNC            LADVVEET----------------------GMAG----------FLGHLVELRNRLLKGV
Q47AM9_DECAR          MSEAPEDS------------------------------------FISHLVELRDRLLRSL
E5APW1_PARRH          HNPQNEDT----------------------EET-----------FISHLIELRTRVIRAA
Q2YAV6_NITMU          --MSADET------------------------------------FISHLVELRARLLRAC
Q31E59_HYDCU          SALPPNDQ----------------------EMT-----------LVQHLLELRNSVTKGI
Q48AI0_COLP3          -MSTPPTP----------------------VAS-----------LFDHLLELRNRLLRSI
G4QJK5_GLANF          --MTTQSS------------------------------------FITHLVELRSRVLKAL
D3SCC9_THISK          EVEPSPEA----------------------TET-----------LLTHLIELRDRVLRMF
H8GJD2_METAL          KNNPNDGQ----------------------EMP-----------FLGHLIELRNRLLRGV
K0C6J4_CYCSP          SDIDPNDQ----------------------ETS-----------FVSHLVELRTRLIHAI
D3RQL8_ALLVD          MQPDDPGA----------------------EQP-----------FISHLVELRDRLIRML
I3YA58_THIV6          IPPDDPGA----------------------EQP-----------FISHLAELRDRLIRML
F6A8L5_PSEF1          SRMPDNDQ----------------------EMP-----------LVSHLAELRTRLLRCV
TATC_HAEIN            --MSNVDE----------------------SQP-----------LITHLVELRNRLLRCV
TATC_ECOLI            ---MSVED----------------------TQP-----------LITHLIELRKRLLNCI
H2IVX2_RAHAC          ---MAVED----------------------TQP-----------LISHLIELRKRLLNAI
D1BNH6_VEIPT          TQHIPEDVEDEPVYTAIEQKMMDEAR----ELS-----------LVGHLSELRKRLIIIA
A8MIP1_ALKOO          -MMADNDL----------------------RLT-----------IVEHLGELRKRLIIAA
E1R121_SEDSS          ---MSNDL----------------------RMT-----------FFEHLSELRKRLFYIA
D2RIN1_ACIFV          -------------------------------MT-----------WVEHMEELRRRILKSL
C6XIZ5_HIRBI          GHEDVEAS----------------------RAP-----------LMDHLKELRTRLVRVL
A0A0H3LXY3_BARHE      KKDEVDAN----------------------MAP-----------LLEHLIELRQRIIAAL
E0TEC0_PARBH          AEKDIEAS----------------------RAP-----------LLSHLIELRSRLIVCV
Q28T34_JANSC          IEDELEGS----------------------AAP-----------LVEHLAELRTRLIRSV
TATC_RHOCB            TADHIDET----------------------AAP-----------LIEHLAELRTRILYAL
A1B0H6_PARDP          NPDSIDDS----------------------SAP-----------LIEHLAELRTRLIWSV
Q0AND8_MARMM          EHDEVEAS----------------------RAP-----------LIEHLIELRSRLVVIM
Q2GER9_NEOSM          -------------------------------MA-----------FDSHLSELRYRMIVSI
B3PIX7_CELJU          DHSSVDLS----------------------RAP-----------LLSHLVELRKRLLLCL
Q0C0W0_HYPNA          LDDEVESS----------------------RAP-----------LLTHLIELRGRLIKIL
Q3SRQ3_NITWN          SDEDIEAS----------------------KAP-----------LMDHLIELRSRLIKAL
B9JXD9_AGRVS          MSDDIEDK----------------------PQP-----------LIEHLIELRTRLIWSL
Q98LC7_RHILO          EKDEIEKS----------------------SAP-----------LIEHLIELRRRLIWSL
D9QLG6_BRESC          DEDEIEAS----------------------RAP-----------LMDHLIELRGRLVWCV
B0T1Q5_CAUSK          TNAIGHEP----------EDEIEAS-----RAP-----------LMDHLIELRMRLIICV
C7JE44_ACEP3          GEDPIHDQ----------------------PMP-----------LIEHLLELRRRLLWAG
Q2G9D2_NOVAD          MISDIDET----------------------QAP-----------LLDHLLELRTRLLRCV
TATC_MAGMM            -MNLDVEQ----------------------KAP-----------LVEHLIELRNRLMISV
D5BQU2_PUNMI          DDASSHDDYETNIDDDTQTYDDGEV-----KMS-----------LVAHLTELRNRLGIAI
I3TKT9_TISMK          DDDEVENS----------------------KAP-----------LLEHLIELRNRLIYSV
Q2RTH4_RHORT          PADATRDE----------DSDLEDK-----KMP-----------LIDHLIELRSRLLWST
Q6MGQ9_BDEBA          RREELDSK----------------------AQS-----------LYEHLSDLRKCLINCV
B2A204_NATTJ          --MSEQRD----------------------KMS-----------FTDHLGELRQRLIWIV
A5D1I5_PELTS          --MAKKTE----------------------EMS-----------IIEHLEELRRVLIISI
B0TFS8_HELMI          TESNHDEK----------------------TMP-----------LTEHLEELRVVLIWVL
D5X7P7_THEPJ          ----MDEK----------------------RMP-----------ILKHLEELRRVLIISF
B8D1R3_HALOH          -------M----------A----EV-----EMS-----------FVEHLEELRKRILISI
Q0AZ46_SYNWW          LKDLTPEE----------------------KQT-----------IIEHLEELRKSLIISI
TATC_CARHZ            ----MEDK----------------------PMT-----------LFEHLEALRKVIIISV
TATC_KORVE            RLSQEALK----------------------GMS-----------FLEHLEELRRRIIWTF
C1F555_ACIC5          VSERAELP----------------------GMS-----------LMEHLEELRRRIIRAG
E8X125_GRATM          VADRADLP----------------------GMT-----------LMEHLDELRKRLIRAV
I3ZCY6_TERRK          VQERAELP----------------------GMS-----------LMEHLTELRARLIRSS
D0LGH0_HALO1          EPVLDDGA----------------------TMP-----------FTEHLRELRVRLRNAI
Q2IM06_ANADE          SPEPEGEV----------------------KLS-----------FLDHLRDLRVRMVRAM
A7H6D7_ANADF          APEPENEV----------------------RLT-----------FMEHLRDLRKRLTHAI
B2V5Y3_SULSY          --MDNQLP----------------------EAP-----------LTEHLAELRTRLIRIV
TATC_PELCD            ------MV----------------------DAS-----------LIDHLDELRRRLMIAG
F2LUZ5_HIPMA          KRIKKDPN----------------------NMT-----------LLEHIEELRIRLLWIV
D3UFV2_HELM1          ----MFED------------------------------------LKPHIQDLRKRLMIAV
B9LA52_NAUPA          ------------------------M-----LEE-----------IKPHIAELRSRLIKIV
E6X1G9_NITSE          -----MFE----------------------SMK-------------PHLAELRQRLAISV
TATC_CAMJE            ------------------------M-----FEE-----------LRPHLIELRKRLFISV
A0A5B9TTD1_SULMU      ----MFDE------------------------------------LKPHLAELRKRLSISL
A8Z6M5_CAMC1          ----MFEE------------------------------------LRPHLIELRKRLFISI
B5YKH3_THEYD          ---MEEQK-----------------------MS-----------LIEHLSELRKRILVCL
E6W513_DESIS          AEQLNDDQ----------------------VMP-----------LTAHLEELRTRLVRSF
E4TGB2_CALNY          --MKPIDT----------------------EQP-----------LMAHLEELRKRLIRIL
E6VUV0_PSEA9          GPDAGEQPEAKDPDAAADDEAEKGT-----QMS-----------LLDHLGELRVRLTRSF
Q1MQT5_LAWIP          ASGNGGNNNGGGIPPTMSDDDEKPY-----GMP-----------LLEHLSELRKRLTKCI
C8X1I2_DESRD          SAAETATQ----------QETADEG-----RMG-----------LIDHLNDLRKSIVRSV
C6BSE0_DESAD          LAVSEDDSAADEDAEDDDELDEEEA-----PMT-----------FLEHLEELRRRFVRIM
TATC_DESAH            --MSREEE----------------------KSP-----------FTEHLGELRDRLVRSF
A9A055_DESOH          --MSDDEK----------------------QVP-----------LTEHLEELRKRLIRCA
C4XP92_DESMR          ------MK----------------------EAP-----------LLEHLVELRQRLVRCL
Q2LXN7_SYNAS          PMTLPADE----------------------KLP-----------LTSHLEELRKRLIHVF
                                                                                  

I7CPH1_NATSJ          IVFLVGF--VGS--FY--------AL---RVVVW-----------------DF-------
TATCT_HALVD           IVFLVGF--LGT-FYA---------L---RLYVW-----------------EF-------
M1XZE0_NATM8          IVFLIGF--LGI--FT--------VL---RLYIW-----------------DI-------
D3S1J6_FERPA          GIIAVVW--ALS--YV---------FV--ADHVI-----------------EK-------
Q0W4Y5_METAR          LYILLVS--VIA--FP---------F---TGDVI-----------------MR-------
Q97ZU3_SACS2          IALAITF--MIY--FM---------LGLELVRVY--------------------------
A8MCQ5_CALMQ          YTILISF--ILV--FA---------F---KYSIIRIDPPGILIIVPTPSIDDS-------
TATC_CENSY            VITGAVTAFLLA--FH---AEPAELW---GATVY-----------------YP-------
Q6KZY6_PICTO          TVFGIFF--AIF--LM---------FQIRYISLF-----------------NY--RFLFI
D3SVL3_NATMM          LFASAGT--AIG--LL--------GASQAIEHIW----------------FNV-------
Q9HN36_HALSA          AIAALVS--IVV--FP---------V---TKPLI-----------------TW-------
M1XNN2_NATM8          VVMAIIS--GIV--FP---------F---GERII-----------------NF-------
Q8TKC1_METAC          VWLFLSM--LVA--YP---------F---SEKGM-----------------ML-------
TATC_METAR            AVTLLLM--LAI--FP---------F---SAGLV-----------------DA-------
F8A8M8_THEID          SFLFFAW--IVL--FS---------Q---FHRLT-----------------AL-------
C7N7W2_SLAHD          VVLFVAM--CVF--YL---------A---TPTII-----------------HL-------
E1QWP7_OLSUV          VSVLVTA--IVV--YA---------A---TPTLI-----------------DI-------
E3HCZ3_ILYPC          ISFAIFV--VVA--FA---------I---HNQIV-----------------DL-------
B3QTN4_CHLT3          VALGLMA--IVC--AF---------F---ADFLV----------------NDV-------
A6LCU1_PARD8          LALFVFA--IAG--FS---------V---MPWLF----------------DNV-------
A6L6V5_BACV8          VAVVFLM--LVA--FL---------F---KDELF-----------------AI-------
C6X0T6_FLAB3          IAIVLGA--VVV--GL---------N---VNWIM----------------DHV-------
C7PMH2_CHIPD          IALIVVS--IFG--FV---------Y---TKEIL----------------DDV-------
C6XV03_PEDHD          LVVVLFT--IGA--FW---------F---SDFIF----------------NDL-------
G2Z214_FLABF          IAVIVIA--CLS--YF---------I---IDFIF----------------EDV-------
G8R5N0_OWEHD          VAILIGA--TLA--FL---------N---KHILF-----------------DI------I
A3UAJ3_CROAH          IAVLICA--TAA--FL---------S---YKFLF-----------------DV------V
A0A6N4SQV5_CYTH3      VIILVFT--VVA--FI---------Y---MPYIF----------------HTI-------
C6VXQ9_DYAFD          ASILIFA--IIA--FI---------Y---IQEIY-----------------HYV------
C8WRE5_ALIAD          LVYAALF--AAT--VA---------W---LPVLV-----------------RY-------
D5EP26_CORAD          IAFVIGV--VVV--LV---------F---NRDIA-----------------EL-------
B1ZP28_OPITP          IAIGIAL--VVC--LL---------I---ADKLV-----------------LL-------
D6Z185_DESAT          LGLVAAT--AAF--TV---------V---SPRAL-----------------IL-------
TATC_AKKM8            VSPSQAD--LTEAALVLRGAQPLPED---RKQVF-----------IREGSPST-------
D6ZGM8_MOBCV          VGIALAT--IGG--WF---------L---YEFAL-----------------AH-------
E8N7E5_MICTS          VAIALGA--IAG--WF---------L---YEPVM-----------------DL-------
C7MCX3_BRAFD          IAVVLLA--VVG--WF---------A---FDWVF-----------------AA-------
C7NHS2_KYTSD          AAVFVGL--CVG--WY---------Y---YEEIA-----------------DF-------
E6SAM0_INTC7          GAVLAGA--VLG--WI---------Y---YDRII-----------------NQ-------
TATC_XYLCX            GGLVVGA--VVG--WL---------L---YDPLL-----------------VL-------
A6W980_KINRD          VFLLIGS--VAG-WFLWRGWNYSWGA---FDGVF-----------------QY-------
TATC_ROTMD            IATIIAA--IIGTVFL-------------YQPFI-----------------EM-------
C5CBV5_MICLC          LAVALGM--VVG--FL---------V---YQPVM-----------------AE-------
E1VW56_GLUAR          IALTLGT--IAG--FF---------V---YDWLL-----------------AL-------
A9WSH2_RENSM          LGLVLGA--IAG--WF---------F---YDPLF-----------------AA-------
B2GIN3_KOCRD          VATVLGA--VLG--FM---------V---YEPFM-----------------QY-------
D3Q548_STANL          LGLVAGV--LVG--MY---------F---ADIIQ-----------------EF-------
D7GEA7_PROFC          LAVLAVA--LCC--FI---------F---YNQLT-----------------AV-------
TATC_FRACC            LAFAIAG--VVC--FI---------F---EPRIF-----------------DW-------
D2ATT8_STRRD          LAMVVGI--VVG--FV---------F---FDPIW-----------------TF-------
Q47P16_THEFY          LSIGVGL--VVG--FL---------V---FDPVW-----------------EF-------
A0LU67_ACIC1          LAILVGA--GVS--YA---------F---FNPIW-----------------SI-------
D2S6F0_GEOOG          LALLVAT--AVA--FW---------W---YEHGL----------------GDF-------
C6WIE9_ACTMD          LFLTIGS--VFG--FI---------W---WSWRI----------LGAPSLGDI-------
C8XAP1_NAKMY          LGILLGT--VVG--FI---------WFGHGIPAI-----------GLPSLSEI-------
B1VDV8_CORU7          IAILIGT--ILG--YL---------W---YGTNV--G--------PLRSLGEI-------
D5UPM4_TSUPD          AAIVVTS--IVG-FYW---------Y---SHGPF-----------GLPSTGHL-------
TATC_MYCTU            AAILVTT--IFG-FVW---------Y---SHSIF-----------GLDSLGEW-------
Q0SIG7_RHOJR          LAIVVTT--AVG-FFW---------Y---SHQIL-----------GIESLGEL-------
F6EP00_HOYSD          AAVIVTT--ALA-FFW---------Y---SYQVF-----------GLESLGEL-------
TATC_CORK4            AAIAVTT--IIG--FI---------W---YEHGIPAWAIGPLHVPRLPSLGEI-------
Q8NQE5_CORGL          AGILVGT--IIG--FI---------W---YDFSF----------WQIPTLGEL-------
C7PVW6_CATAD          VGIVLGA--IVG--WF---------V---HEWVI-----------------QL-------
G2P670_STRV4          LAICVVT--IVA--MF---------F---YMDIA-----------------KF-------
B1W318_STRGG          LAIVVVM--IVA-AFY-------------QKEIY-----------------EF-------
D2Q3I8_KRIFD          LAIVLMS--VVG--YI---------F---YDQAL-----------------DF-------
A1SK21_NOCSJ          LFLVLTF--AVA-LFF---------FDRPDDGLL-----------------GL-------
Q2G128_STAA8          ITVIVVY--VSS--FW---------W---MTPFI-----------------TY-------
D5SQP1_PLAL2          IGLVIAV--CFS--LY---------A---GEYIV-----------------AF-------
E8R5A8_ISOPI          IGLFVGM--IIT--LL-----PPLNL---GMAIM-----------------RA-------
Q6AN67_DESPS          IAIVLCS--AVA--YI---------F---SEQIA-----------------RA-------
D6Z4B1_DESAT          GAIVLAS--AVV--YW---------F---VEDLV-----------------RH-------
B1HXK1_LYSSC          TVFILFF--IVV--FS-------------TINIW--------------------------
D6XUT8_BACIE          GAFLIFF--IGI--FI---------F---VRDIY-----------------DW-------
Q8EQG3_OCEIH          VIFIILF--IIG--FL---------N---VKDIY-----------------WF-------
D5WSC2_KYRT2          IVFVIAL--GVA--FS---------Y---VDRVL-----------------VW-------
C5D4F0_GEOSW          VFFVIAL--IAS--FF---------F---VEPVI-----------------LY-------
Q5WJP1_BACSK          AFFIVAL--IGG--FF---------L---AVPVI-----------------TF-------
TATC_BACHD            VFFVIAL--VVG--FF---------L---ATPMI-----------------TY-------
C0ZK48_BREBN          AVFIVAL--IVG--FF---------L---AGPLV-----------------DY-------
E3EID4_PAEPS          IVFVLAL--AGG--LF---------A---AGSVY-----------------NW-------
C6CVH0_PAESJ          IVIVAGL--IIG--LV---------I---AEPAY-----------------NF-------
D8K211_DEHLB          AGVGVGT--GLA--LF---------F---GFDII-----------------EL-------
E6SMD5_THEM7          LAVAAGT--AVG--FV---------Y---AQPVM-----------------TW-------
E8N519_ANATU          FSLIVTT--LLS--FM---------F---SQYAI-----------------EI-------
A5URY8_ROSS1          VAIAIGT--MIG--FW---------I---VNSPV-----------------LLGEALPVF
B9L0C4_THERP          LAVAVGF--VIG--LA---------L---AFPTM-----------------RL-------
D1CCN1_THET1          LGVVVGM--AIS--FL---------F---VQHIV-----------------QA-------
C7LYQ4_ACIFD          VAVTIGA--IAA--YA---------V---YPHLL-----------------SV-------
Q7UFI8_RHOBA          IWLLIGL--AVG--LM---------F---ANRVV-----------------RF-------
B3E195_METI4          LALGGGS--LIC--FI---------E---TKPLM-----------------AI-------
Q1AUL3_RUBXD          VVFVAAA--VVA--WF---------F---REDIF-----------------YF-------
Q7U568_SYNPX          LAVVVSA--LVC--LL---------A---VKPLV-----------------RL-------
TATC_ORYSJ            LAVGAAI--LGC--FA---------Y---SKDLI-----------------RI-------
TATC_MAIZE            LAVGAAI--LGC--FA---------F---SKDLV-----------------IF-------
K3XJC3_SETIT          LAVGAAI--LGC--FA---------F---SKDLI-----------------LL-------
Q114K5_TRIEI          IGAIVGI--LCC--FI---------F---VKPIV-----------------KF-------
B0CFY2_ACAM1          IAVAIAI--VGC--FF---------K---VNLIV-----------------KV-------
E0UC67_GLOV7          IAVLVGV--IGC--FI---------F---VRPLV-----------------QI-------
C1A4F6_GEMAT          VAIAIGV--IGA--FS-----LLYTK---RIDIV-----------------GI-------
B3E7M3_GEOLS          FSVVIGM--GIA--WN---------F---SGPVL-----------------TF-------
E1X470_HALMS          IILAVSF--IAC--YA---------F---ADIIS-----------------EV-------
A9EPV7_SORC5          LVFFAAC--VVG--WE---------V---REELL-----------------HF-------
Q67QH4_SYMTH          IAVAIGF--FAA--VF---------L---SQPVF-----------------QH-------
A9KHC2_LACP7          AVIVLFF--LVI--WL--------CC---SEWLL-----------------NI-------
J9ZE06_LEPFM          FWLALFM--GVS--FP---------F---SDRAL-----------------KY-------
Q023M6_SOLUE          MGVAVAF--AVS--LI---------Y---TNALW-----------------DF-------
TATC_DEIRA            VFLAVGM--VIA--FT---------Y---RVQLI-----------------EL-------
D7BE12_MEISD          VAWGITT--SLA--FT---------F---RVQLL-----------------DW-------
D7CQR8_TRURR          GAWVVGM--GVA--FV---------F---RTELL-----------------AW-------
A5EVU4_DICNV          VAYVAVF--VAL--LP---------F---NHKIY-----------------QL-------
Q9PFU5_XYLFA          IGLGLVV--SAL--LP---------F---SKVLY-----------------RW-------
Q1H3X3_METFK          AGMLVPL--LAI--LP---------F---ANELH-----------------GF-------
A9BXA9_DELAS          YGIGLAIAVLAV--WP---------G---PNGLI-----------------DF-------
A1AVV9_RUTMC          IAILIIF--IGI--FP---------F---ANEIY-----------------SF-------
TATC_HALNC            LAVLVLF--LIL--FP---------F---RNELF-----------------TM-------
Q47AM9_DECAR          IAIAVVLGILCI--YP---------G---PGEIY-----------------DI-------
E5APW1_PARRH          VSVLVVF--VSL--VY---------W---APDIF-----------------RL-------
Q2YAV6_NITMU          AGILLGF--LPC--AY---------Y---ARELY-----------------SL-------
Q31E59_HYDCU          LAILVLF--IIL--FP---------F---ANDLY-----------------LY-------
Q48AI0_COLP3          LGVLIVF--CCL--VY---------F---AQDIY-----------------QY-------
G4QJK5_GLANF          ASVLVIF--MAL--AY---------W---AQDLY-----------------GI-------
D3SCC9_THISK          IAILVVF--LVL--FP---------F---ANPIY-----------------TW-------
H8GJD2_METAL          IFVLVVF--LAL--SY---------Y---ANDIY-----------------AL-------
K0C6J4_CYCSP          IGLLVVF--LPL--AP---------F---ANDIY-----------------SL-------
D3RQL8_ALLVD          IAIGVMV--LVL--LP---------F---ANGLY-----------------AY-------
I3YA58_THIV6          IAIGVVI--LLL--FP---------F---ANDIY-----------------TY-------
F6A8L5_PSEF1          AAIFLIF--ACL--FY---------F---AQKIY-----------------TL-------
TATC_HAEIN            ICVVLVF--VAL--VY---------F---SNDIY-----------------HF-------
TATC_ECOLI            IAVIVIF--LCL--VY---------F---ANDIY-----------------HL-------
H2IVX2_RAHAC          ICIIVVF--LAL--VY---------F---ANDIY-----------------QL-------
D1BNH6_VEIPT          VAVIVGT--CIS--YY---------Y---VDLLL-----------------EI-------
A8MIP1_ALKOO          IAIIAGS--LAS--YN---------Y---VDKII-----------------EI-------
E1R121_SEDSS          ISIVLFS--GIG--YY---------F---VEPAV-----------------EV-------
D2RIN1_ACIFV          LAVGIGM--VAA--FF---------F---MDPIM-----------------AF-------
C6XIZ5_HIRBI          IAVGVCS--LIA--FI---------F---AQHMF-----------------DF-------
A0A0H3LXY3_BARHE      IACFIAF--IIC--FL---------V---KDYIL-----------------NF-------
E0TEC0_PARBH          AAVVIAF--VIC--FA---------F---SYQLY-----------------NL-------
Q28T34_JANSC          LAFVVGI--IVM--FT---------V---AEPIL-----------------NF-------
TATC_RHOCB            SAYVVAV--VLC--YI---------I---WHPVF-----------------TF-------
A1B0H6_PARDP          LAFVVAM--VLC--YT---------V---WNPIY-----------------NF-------
Q0AND8_MARMM          GFLLVGF--IGC--FI---------F---SETLY-----------------QW-------
Q2GER9_NEOSM          IFFLTTF--CFC--YY---------F---SEEIY-----------------KF-------
B3PIX7_CELJU          MAFVLAF--IAC--YL---------V---AEQIY-----------------QF-------
Q0C0W0_HYPNA          LALGTAT--IFA--FF---------F---ADQIY-----------------NL-------
Q3SRQ3_NITWN          IGFGVAF--VAC--FF---------F---ARQIY-----------------NI-------
B9JXD9_AGRVS          GAFFLAF--IVC--FF---------F---AKHLF-----------------NL-------
Q98LC7_RHILO          GGFFVAF--LVC--FF---------F---AKKLF-----------------NL-------
D9QLG6_BRESC          VAFILAF--ILC--FF---------F---AAQLQ-----------------VE-------
B0T1Q5_CAUSK          AALFIGF--GVC--FA---------F---ADQIF-----------------LF-------
C7JE44_ACEP3          AAFILCF--ALC--YH---------Y---AGDIY-----------------LF-------
Q2G9D2_NOVAD          YALIVAF--AVC--FY---------F---ADDIF-----------------AI-------
TATC_MAGMM            GAIIVGF--ILC--YS---------F---SEQIF-----------------EF-------
D5BQU2_PUNMI          AAFIILF--LIC--VAPIPGTDNSSI---AYHVF-----------------IF-------
I3TKT9_TISMK          VALLIAF--GVC--YM---------F---AEDIF-----------------GF-------
Q2RTH4_RHORT          VFFLVAF--FAC--FA---------Y---AQEIY-----------------NI-------
Q6MGQ9_BDEBA          WILLIAT--GIC--YG---------F---SEKIF-----------------DF-------
B2A204_NATTJ          LAFLIAT--GIA--FY---------F---SETLL-----------------DI-------
A5D1I5_PELTS          LGTFVLA--VAA--YF---------Y---IDKIL-----------------AV-------
B0TFS8_HELMI          VAAVAGT--VVA--YN---------W---NQELI-----------------AL-------
D5X7P7_THEPJ          LSIIPTS--VVC--WF---------Y---RKELL-----------------HL-------
B8D1R3_HALOH          SLVLIFS--IAS--YF---------F---VPDII-----------------KF-------
Q0AZ46_SYNWW          IAIIAAA--VFC--FY---------Y---NEEIL-----------------SV-------
TATC_CARHZ            IAIVIGS--IIA--YN---------Y---VDYFL-----------------NI-------
TATC_KORVE            VYIAAGF--GVC--WW---------W---HEQIY-----------------DF-------
C1F555_ACIC5          LAIIIGF--FVA--YG---------F---HAQIY-----------------NF-------
E8X125_GRATM          IALLCGF--GVA--YI---------F---HVRLF-----------------GY-------
I3ZCY6_TERRK          IALVLCF--FVA--YI---------F---HEKLF-----------------AI-------
D0LGH0_HALO1          LGLIGGF--SVC--YF---------F---KEEIA-----------------LL-------
Q2IM06_ANADE          LGIAIGMGLVGG-------------F---VPQIV-----------------DH-------
A7H6D7_ANADF          LGVLVGMLAVGG-------------F---VDGIF-----------------HW-------
B2V5Y3_SULSY          LAVIIGT--VVA--FT---------K---ANYLF-----------------EI-------
TATC_PELCD            GAWLLGA--LIC--YA---------F---SQQLF-----------------QA-------
F2LUZ5_HIPMA          GGILVAL--VGM--FS---------Y---SQKVI-----------------EI-------
D3UFV2_HELM1          GTLIVVF--IAC--FN---------F---WREIF-----------------EY-------
B9LA52_NAUPA          VTFFILF--ILA--FV---------V---WKDIF-----------------LW-------
E6X1G9_NITSE          LAVFVGF--IIA--FT---------F---HNAIL-----------------GW-------
TATC_CAMJE            ACIVVMF--IVC--FA---------L---RSYIL-----------------DI-------
A0A5B9TTD1_SULMU      LVILVMF--LIC--FA---------F---WQPIL-----------------AW-------
A8Z6M5_CAMC1          VSVFVCF--GIC--FT---------F---WNPLL-----------------AW-------
B5YKH3_THEYD          IALIIAF--IFT--FS---------Y---SEYIF-----------------KL-------
E6W513_DESIS          IAIGVCF--AVV--YF---------F---SKEIM-----------------LF-------
E4TGB2_CALNY          IALTIVF--SLC--YW---------K---SVYLF-----------------QF-------
E6VUV0_PSEA9          IAIAVGM--VAC--YG---------F---AEQMF-----------------NI-------
Q1MQT5_LAWIP          IVIGVVF--ITC--YS---------I---SDILF-----------------HY-------
C8X1I2_DESRD          VAALVGM--VAC--YA---------F---AQKLF-----------------DY-------
C6BSE0_DESAD          IACGIGF--LAC--YS---------F---AKPLF-----------------SL-------
TATC_DESAH            IAVGVGF--VIA--YC---------F---KERLF-----------------DI-------
A9A055_DESOH          IAIGVGF--AIS--YA---------F---KEKLF-----------------AV-------
C4XP92_DESMR          IAVGVGF--ALS--YS---------F---AERLL-----------------DV-------
Q2LXN7_SYNAS          IALGIGF--TLC--YM---------F---KDWLF-----------------FV-------
                                                                                  

I7CPH1_NATSJ          LKATAKAKMGQQV-----------------------------------------------
TATCT_HALVD           FRGVTKAQMDASV-----------------------------------------------
M1XZE0_NATM8          LKQDLNAH----------------------------------------------------
D3S1J6_FERPA          VENDLL------------------------------------------------------
Q0W4Y5_METAR          MSNDLLPQQ---------------------------------------------------
Q97ZU3_SACS2          LPYPFFGLKYVLAEVPVLYPSLFDSISVQLTQLFIYNEL---------------------
A8MCQ5_CALMQ          LSVSVINFFIHATV----------------------------------------------
TATC_CENSY            VPDPLHNMAAQITDHMRAALV---------------------------------------
Q6KZY6_PICTO          YPDPFHNIGAQFLFIIKDHVL---------------------------------------
D3SVL3_NATMM          FPYEIENVP---------------------------------------------------
Q9HN36_HALSA          MWNYVL------------------------------------------------------
M1XNN2_NATM8          LWYSVL------------------------------------------------------
Q8TKC1_METAC          VWKEFIS-----------------------------------------------------
TATC_METAR            VLAHAV------------------------------------------------------
F8A8M8_THEID          FLWPYERAF---------------------------------------------------
C7N7W2_SLAHD          LFEPISEYL---------------------------------------------------
E1QWP7_OLSUV          MIDPIRSAL---------------------------------------------------
E3HCZ3_ILYPC          FIKFYSSI----------------------------------------------------
B3QTN4_CHLT3          LIGPLKRSS---------------------------------------------------
A6LCU1_PARD8          VMAPCSSDFIVYREMCKISSHFSFLPDF--------------------------------
A6L6V5_BACV8          VLAPKNADFIIYRFFCRIADFMAMPSL---------------------------------
C6X0T6_FLAB3          FFGPTKNDFFTFRVVNHYSRELLGY---DSIIL---------------------------
C7PMH2_CHIPD          IFGPTNPTFPSYVALCKLGNLVGLGD----------------------------------
C6XV03_PEDHD          IMGPKNPDFWTYRMMCKMAAAWPNLIGSDF------------------------------
G2Z214_FLABF          IFAPIRTDFITYKLFCELTTYLHT------------------------------------
G8R5N0_OWEHD          IFGPKQPDFVTYRMFCEFTAWLT-------------------------------------
A3UAJ3_CROAH          LLGPKKADFVTYDILCQLAQLVHLDDSF--------------------------------
A0A6N4SQV5_CYTH3      ILAHAYPDFWTYRMLCRIDNSL--------------------------------------
C6VXQ9_DYAFD          IVAPSRPDFWTYRMLCKLSEITGYEDLCVK------------------------------
C8WRE5_ALIAD          AMRPVH------------------------------------------------------
D5EP26_CORAD          MQMPLHKAYGSAEV----------------------------------------------
B1ZP28_OPITP          LEYPLQRMNVFEKAKPTVTFKIGGTQLGPYEVKPDEFPGL--------------------
D6Z185_DESAT          LQNHLSQE----------------------------------------------------
TATC_AKKM8            AVRDLAEALYSKGAVLAD------------------------------------------
D6ZGM8_MOBCV          ITAPMKDV----------------------------------------------------
E8N7E5_MICTS          VRTPIAQIAA--------------------------------------------------
C7MCX3_BRAFD          LQRPFRLA----------------------------------------------------
C7NHS2_KYTSD          LMQPVVD-VAE-------------------------------------------------
E6SAM0_INTC7          LIQPLKDVAAQ-------------------------------------------------
TATC_XYLCX            LTRPLHLAA---------------------------------------------------
A6W980_KINRD          LQRPLLDYAA--------------------------------------------------
TATC_ROTMD            ISAPLQQIN---------------------------------------------------
C5CBV5_MICLC          LFRPVKEI----------------------------------------------------
E1VW56_GLUAR          LIAPVKA-----------------------------------------------------
A9WSH2_RENSM          ISEPLVRLA---------------------------------------------------
B2GIN3_KOCRD          ITEPLQRL----------------------------------------------------
D3Q548_STANL          INAPYCDWDKQNWLDKGHS-----------------------------------------
D7GEA7_PROFC          AFHPIQQAIEVYRAK---------------------------------------------
TATC_FRACC            LKAPYCDLPASKRFS---------------------------------------------
D2ATT8_STRRD          ITEPYCSLPVSHLL----------------------------------------------
Q47P16_THEFY          LQQPFCSLSAE-------------------------------------------------
A0LU67_ACIC1          LRRPYCQVHQPHSIATTAN-----------------------------------------
D2S6F0_GEOOG          IRAPYCN-L---------------------------------------------------
C6WIE9_ACTMD          IISPYCGIPLEDRFNQ--------------------------------------------
C8XAP1_NAKMY          LTGPYCAVPSTERYDFGS------------------------------------------
B1VDV8_CORU7          LREPYCK-L---------------------------------------------------
D5UPM4_TSUPD          LTGPYCDLPATSRAEITR------------------------------------------
TATC_MYCTU            LRHPYCALPQSARADIS-------------------------------------------
Q0SIG7_RHOJR          LRGPYCSLPASSRADLSN------------------------------------------
F6EP00_HOYSD          LRGPYCALPPESRADLT-------------------------------------------
TATC_CORK4            LKEPYCSLPPSARATFSA------------------------------------------
Q8NQE5_CORGL          LRDPYCSLPAESRWAMSD------------------------------------------
C7PVW6_CATAD          LENTVCNDMSVHGVGQPTPQC---------------------------------------
G2P670_STRV4          LMQPVLDAVGCGGVSLSDLSGQG-------------------------------------
B1W318_STRGG          LLAPIQESVGC-------------------------------------------------
D2Q3I8_KRIFD          LKRPFDAGVKDLIAS---------------------------------------------
A1SK21_NOCSJ          VLGPYNDARGM-------------------------------------------------
Q2G128_STAA8          ITRAHVS-----------------------------------------------------
D5SQP1_PLAL2          IRQPIDAALVRNNMMEFVQAEPQMSSGDFFSYLSNSFWALWGYENKT-------------
E8R5A8_ISOPI          MQEPAQSALQRHFARSAAERAQNADEMAARLEPMTAII----------------------
Q6AN67_DESPS          CITPLQEAS---------------------------------------------------
D6Z4B1_DESAT          LSGPLVRID---------------------------------------------------
B1HXK1_LYSSC          --FPFV------------------------------------------------------
D6XUT8_BACIE          FTKDLDMT----------------------------------------------------
Q8EQG3_OCEIH          FVND--------------------------------------------------------
D5WSC2_KYRT2          LEIPAVRA----------------------------------------------------
C5D4F0_GEOSW          LQRTDE------------------------------------------------------
Q5WJP1_BACSK          LQNSPQ------------------------------------------------------
TATC_BACHD            LQGAPT------------------------------------------------------
C0ZK48_BREBN          LKQEPI------------------------------------------------------
E3EID4_PAEPS          LIRSGS------------------------------------------------------
C6CVH0_PAESJ          LMEQEP------------------------------------------------------
D8K211_DEHLB          LEGPAGD-----------------------------------------------------
E6SMD5_THEM7          LIQR--------------------------------------------------------
E8N519_ANATU          LARPIG------------------------------------------------------
A5URY8_ROSS1          LVRHLA------------------------------------------------------
B9L0C4_THERP          IIR---------------------------------------------------------
D1CCN1_THET1          LLELI-------------------------------------------------------
C7LYQ4_ACIFD          LTEPLCTVEHE-------------------------------------------------
Q7UFI8_RHOBA          IQEPLKQAIIEYNADRDLKEMGLPDRKEDPQVSRFYEFLTSNSLVADVVYTL--------
B3E195_METI4          LLKPLKSAGED-------------------------------------------------
Q1AUL3_RUBXD          LLAPAEDS----------------------------------------------------
Q7U568_SYNPX          LEVP--------------------------------------------------------
TATC_ORYSJ            LEAPVS------------------------------------------------------
TATC_MAIZE            LEAPVT------------------------------------------------------
K3XJC3_SETIT          LEAPVT------------------------------------------------------
Q114K5_TRIEI          LEVP--------------------------------------------------------
B0CFY2_ACAM1          LERP--------------------------------------------------------
E0UC67_GLOV7          LEMP--------------------------------------------------------
C1A4F6_GEMAT          LAQPIQPYL---------------------------------------------------
B3E7M3_GEOLS          VEKPLTGKTYLTEIKKKVYAKVKEQAPRLYTYYKLDQEIST-------------------
E1X470_HALMS          LLSPLRSALKS-------------------------------------------------
A9EPV7_SORC5          LTVPFVQAWREQSL----------------------------------------------
Q67QH4_SYMTH          IMEQAK------------------------------------------------------
A9KHC2_LACP7          VAKPLI------------------------------------------------------
J9ZE06_LEPFM          LGA---------------------------------------------------------
Q023M6_SOLUE          VCQPAVAALK--------------------------------------------------
TATC_DEIRA            VKVPLTYSELYT------------------------------------------------
D7BE12_MEISD          LKKPLDVFNATS------------------------------------------------
D7CQR8_TRURR          LQAPL-------------------------------------------------------
A5EVU4_DICNV          FAWPVLSNLL--------------------------------------------------
Q9PFU5_XYLFA          LATPIISQL---------------------------------------------------
Q1H3X3_METFK          FVTPLLNQL---------------------------------------------------
A9BXA9_DELAS          IAHPIKAHM---------------------------------------------------
A1AVV9_RUTMC          IAAPIINVL---------------------------------------------------
TATC_HALNC            LADPLSRHM---------------------------------------------------
Q47AM9_DECAR          LAAPLTKAL---------------------------------------------------
E5APW1_PARRH          LAHPLMANL---------------------------------------------------
Q2YAV6_NITMU          LAQPLLEKL---------------------------------------------------
Q31E59_HYDCU          ISEPLSRFL---------------------------------------------------
Q48AI0_COLP3          VAQPLLATM---------------------------------------------------
G4QJK5_GLANF          LAAPLVATI---------------------------------------------------
D3SCC9_THISK          LADPLMQHL---------------------------------------------------
H8GJD2_METAL          LAGPLMKYM---------------------------------------------------
K0C6J4_CYCSP          VAQPLLTHM---------------------------------------------------
D3RQL8_ALLVD          VAAPLLAQL---------------------------------------------------
I3YA58_THIV6          IAGPLIAQL---------------------------------------------------
F6A8L5_PSEF1          VSAPLRQYL---------------------------------------------------
TATC_HAEIN            VAAPLTAVM---------------------------------------------------
TATC_ECOLI            VSAPLIKQL---------------------------------------------------
H2IVX2_RAHAC          VASPLIKQM---------------------------------------------------
D1BNH6_VEIPT          LLK---------------------------------------------------------
A8MIP1_ALKOO          LVRP--------------------------------------------------------
E1R121_SEDSS          LKKP--------------------------------------------------------
D2RIN1_ACIFV          LTR---------------------------------------------------------
C6XIZ5_HIRBI          LMLPFDKAKAEFGAAN--------------------------------------------
A0A0H3LXY3_BARHE      LILPYQWAMKISGGN---------------------------------------------
E0TEC0_PARBH          LTLPFVDAVDRL------------------------------------------------
Q28T34_JANSC          VSQPLADVL---------------------------------------------------
TATC_RHOCB            LTHPICEAL---------------------------------------------------
A1B0H6_PARDP          LTRPICHAL---------------------------------------------------
Q0AND8_MARMM          LLLPYRDAASIVRGV---------------------------------------------
Q2GER9_NEOSM          LLKPLAEVANQ-------------------------------------------------
B3PIX7_CELJU          LMQPLVDILGE-------------------------------------------------
Q0C0W0_HYPNA          LVAPFASM----------------------------------------------------
Q3SRQ3_NITWN          LIWPFVWVAG--------------------------------------------------
B9JXD9_AGRVS          LVIPYKWAVIWA------------------------------------------------
Q98LC7_RHILO          LVVPFKWATKWAGLD---------------------------------------------
D9QLG6_BRESC          LIKPFQAAAAVHADAVARGTHGNPLDLLAIAVGMKPLP----------------------
B0T1Q5_CAUSK          LVNPFTVAQKLLAAQHLGGHHGPFDLLLALVGLKDI------------------------
C7JE44_ACEP3          LARPLGEIM---------------------------------------------------
Q2G9D2_NOVAD          LARPLVVAF---------------------------------------------------
TATC_MAGMM            LAAPLHEILG--------------------------------------------------
D5BQU2_PUNMI          LQAPLADVMEA-------------------------------------------------
I3TKT9_TISMK          LVEPLAKVL---------------------------------------------------
Q2RTH4_RHORT          LVLPLARVMERV------------------------------------------------
Q6MGQ9_BDEBA          VREPIRPYL---------------------------------------------------
B2A204_NATTJ          ITVPADN-----------------------------------------------------
A5D1I5_PELTS          LLEPLT------------------------------------------------------
B0TFS8_HELMI          LTKPMG------------------------------------------------------
D5X7P7_THEPJ          LTRPVD------------------------------------------------------
B8D1R3_HALOH          LTKPV-------------------------------------------------------
Q0AZ46_SYNWW          IISPLS------------------------------------------------------
TATC_CARHZ            LLQPVT------------------------------------------------------
TATC_KORVE            MQRPIMKAL---------------------------------------------------
C1F555_ACIC5          MQQPITTAL---------------------------------------------------
E8X125_GRATM          IQKPLN------------------------------------------------------
I3ZCY6_TERRK          VTAPID------------------------------------------------------
D0LGH0_HALO1          MLRPYQSVWATMQSKHTGD-----------------------------------------
Q2IM06_ANADE          LMKPVRDAL---------------------------------------------------
A7H6D7_ANADF          LMAPVRAAL---------------------------------------------------
B2V5Y3_SULSY          LKMPLLKVN---------------------------------------------------
TATC_PELCD            VSAPLRQAL---------------------------------------------------
F2LUZ5_HIPMA          AVKPLKDAL---------------------------------------------------
D3UFV2_HELM1          IKKPIEGAFDGQ------------------------------------------------
B9LA52_NAUPA          IAKPAFEAM---------------------------------------------------
E6X1G9_NITSE          ITKPLNNALIQVGKIVEKREMGTWKISGNEHNATLAPSKSPALLSDHAQSAEKLHRTLAE
TATC_CAMJE            LKAPLIAVL---------------------------------------------------
A0A5B9TTD1_SULMU      MIAPLKAVL---------------------------------------------------
A8Z6M5_CAMC1          MSEPLKQVL---------------------------------------------------
B5YKH3_THEYD          LLFPLNYTPQFSLKEGMVFVPDQK------------------------------------
E6W513_DESIS          LQQPVLAAF---------------------------------------------------
E4TGB2_CALNY          IKKPLILYM---------------------------------------------------
E6VUV0_PSEA9          LMQPMITVFQQRMAEKPMLPIGFYDDLRGALTKILGDQGFQHMDKIDLFVDALQKSLVQV
Q1MQT5_LAWIP          LALPLITVM---------------------------------------------------
C8X1I2_DESRD          LMLPLYKAL---------------------------------------------------
C6BSE0_DESAD          LMAPLVAVL---------------------------------------------------
TATC_DESAH            LTAPLIAAM---------------------------------------------------
A9A055_DESOH          LIRPLVAVM---------------------------------------------------
C4XP92_DESMR          LLKPLMDVM---------------------------------------------------
Q2LXN7_SYNAS          VTRPLIAVM---------------------------------------------------
                                                                                  

I7CPH1_NATSJ          AGST---D----------------------------------------------------
TATCT_HALVD           SGNV---S----------------------------------------------------
M1XZE0_NATM8          -PDI---V----------------------------------------------------
D3S1J6_FERPA          PEGA---K----------------------------------------------------
Q0W4Y5_METAR          KYSGELYQ----------------------------------------------------
Q97ZU3_SACS2          PKGV---K----------------------------------------------------
A8MCQ5_CALMQ          PKGV---E----------------------------------------------------
TATC_CENSY            PEGV---E----------------------------------------------------
Q6KZY6_PICTO          PEDT---K----------------------------------------------------
D3SVL3_NATMM          PPHV--------------------------------------------------------
Q9HN36_HALSA          PGGE-AID----------------------------------------------------
M1XNN2_NATM8          PGGDIARP----------------------------------------------------
Q8TKC1_METAC          PELD--------------------------------------------------------
TATC_METAR            PSYV---K----------------------------------------------------
F8A8M8_THEID          PDQK--LG----------------------------------------------------
C7N7W2_SLAHD          PHDA--DG----------------------------------------------------
E1QWP7_OLSUV          PEGS---S----------------------------------------------------
E3HCZ3_ILYPC          PSGG-ENK----------------------------------------------------
B3QTN4_CHLT3          PNTV--------------------------------------------------------
A6LCU1_PARD8          CNDTFHVN----------------------------------------------------
A6L6V5_BACV8          CPEVFYVK----------------------------------------------------
C6X0T6_FLAB3          PDHF---A----------------------------------------------------
C7PMH2_CHIPD          KLCITPVP----------------------------------------------------
C6XV03_PEDHD          CITHIDAK----------------------------------------------------
G2Z214_FLABF          DDGGMCVT----------------------------------------------------
G8R5N0_OWEHD          GVGLMCLT----------------------------------------------------
A3UAJ3_CROAH          CFEELPFR----------------------------------------------------
A0A6N4SQV5_CYTH3      CVDTLNFT----------------------------------------------------
C6VXQ9_DYAFD          ALNF---K----------------------------------------------------
C8WRE5_ALIAD          ELHL---A----------------------------------------------------
D5EP26_CORAD          AKDN--------------------------------------------------------
B1ZP28_OPITP          PGSD--NP-----------------------------------------NVTYHVGSAKI
D6Z185_DESAT          ------------------------------------------------------------
TATC_AKKM8            GTGRGALK----------------------------------------------------
D6ZGM8_MOBCV          AGAN--------------------------------------------------------
E8N7E5_MICTS          ERNA---S----------------------------------------------------
C7MCX3_BRAFD          AAQGLKAD----------------------------------------------------
C7NHS2_KYTSD          ERGT---E----------------------------------------------------
E6SAM0_INTC7          RGEAGLVN----------------------------------------------------
TATC_XYLCX            ATQHKDIA----------------------------------------------------
A6W980_KINRD          SAGYEDVK----------------------------------------------------
TATC_ROTMD            IETGRRAN----------------------------------------------------
C5CBV5_MICLC          ANQGHTAA----------------------------------------------------
E1VW56_GLUAR          AGGS--------------------------------------------------------
A9WSH2_RENSM          KERHFDAG----------------------------------------------------
B2GIN3_KOCRD          ADSGRTAT----------------------------------------------------
D3Q548_STANL          AASYDGCN----------------------------------------------------
D7GEA7_PROFC          NPGA---E----------------------------------------------------
TATC_FRACC            PDGLAAND----------------------------------------------------
D2ATT8_STRRD          REGE--------------------------------------------------------
Q47P16_THEFY          VRGSDHCG----------------------------------------------------
A0LU67_ACIC1          GCGD--------------------------------------------------------
D2S6F0_GEOOG          PADL---R----------------------------------------------------
C6WIE9_ACTMD          NQEC---Q----------------------------------------------------
C8XAP1_NAKMY          ADQC---K----------------------------------------------------
B1VDV8_CORU7          PSEV---R----------------------------------------------------
D5UPM4_TSUPD          GGEC---R----------------------------------------------------
TATC_MYCTU            ADGE--CR----------------------------------------------------
Q0SIG7_RHOJR          DGSC---R----------------------------------------------------
F6EP00_HOYSD          SGGADGCR----------------------------------------------------
TATC_CORK4            DNEC---R----------------------------------------------------
Q8NQE5_CORGL          SEEC---R----------------------------------------------------
C7PVW6_CATAD          KNGL--------------------------------------------------------
G2P670_STRV4          SKGHDCAY----------------------------------------------------
B1W318_STRGG          KNGV--VT----------------------------------------------------
D2Q3I8_KRIFD          KNGGKEPE----------------------------------------------------
A1SK21_NOCSJ          LGEKVQTR----------------------------------------------------
Q2G128_STAA8          ------------------------------------------------------------
D5SQP1_PLAL2          PAST---DTQELKQELEQLQTEKTSPSKSIDLQLSAYELLSQLHQVAPESLPAPKEELKG
E8R5A8_ISOPI          PADQLISQ-------------------------------LRLIAPSLNLPDPSTLQGRSL
Q6AN67_DESPS          PLVY---K----------------------------------------------------
D6Z4B1_DESAT          PELS---R----------------------------------------------------
B1HXK1_LYSSC          TRGH---S----------------------------------------------------
D6XUT8_BACIE          ------------------------------------------------------------
Q8EQG3_OCEIH          -IDL---E----------------------------------------------------
D5WSC2_KYRT2          GLGR--------------------------------------------------------
C5D4F0_GEOSW          AKEL---T----------------------------------------------------
Q5WJP1_BACSK          AADM---P----------------------------------------------------
TATC_BACHD            AQDL---P----------------------------------------------------
C0ZK48_BREBN          ADGV---P----------------------------------------------------
E3EID4_PAEPS          AKAF---Q----------------------------------------------------
C6CVH0_PAESJ          AKGL---Q----------------------------------------------------
D8K211_DEHLB          MAEQ--------------------------------------------------------
E6SMD5_THEM7          GPDV---R----------------------------------------------------
E8N519_ANATU          GIKN--------------------------------------------------------
A5URY8_ROSS1          PPGT---Q----------------------------------------------------
B9L0C4_THERP          MSGI--ER----------------------------------------------------
D1CCN1_THET1          KPHT--------------------------------------------------------
C7LYQ4_ACIFD          PHCV--------------------------------------------------------
Q7UFI8_RHOBA          PSGS---VPVATGDMVEPPEATGTAVESEPDEKNSPDVEAEAGESAALDIPERITTAELM
B3E195_METI4          PQKV--------------------------------------------------------
Q1AUL3_RUBXD          LHGR--------------------------------------------------------
Q7U568_SYNPX          AQGI---H----------------------------------------------------
TATC_ORYSJ            VQGV---R----------------------------------------------------
TATC_MAIZE            AQGV---R----------------------------------------------------
K3XJC3_SETIT          VQGV---R----------------------------------------------------
Q114K5_TRIEI          AQGV---K----------------------------------------------------
B0CFY2_ACAM1          AQGV---K----------------------------------------------------
E0UC67_GLOV7          AQGV---K----------------------------------------------------
C1A4F6_GEMAT          --RQ---P----------------------------------------------------
B3E7M3_GEOLS          PEKM---R----------------------------------------------------
E1X470_HALMS          GEGE--------------------------------------------------------
A9EPV7_SORC5          AGNP---S----------------------------------------------------
Q67QH4_SYMTH          AEGV---Q----------------------------------------------------
A9KHC2_LACP7          DRNI---T----------------------------------------------------
J9ZE06_LEPFM          KAGV---P----------------------------------------------------
Q023M6_SOLUE          TLGY---K----------------------------------------------------
TATC_DEIRA            TGKV---Q----------------------------------------------------
D7BE12_MEISD          NIKA---E----------------------------------------------------
D7CQR8_TRURR          PEGL---T----------------------------------------------------
A5EVU4_DICNV          PNQQ--------------------------------------------------------
Q9PFU5_XYLFA          PAGQ---S----------------------------------------------------
Q1H3X3_METFK          PAGG---Q----------------------------------------------------
A9BXA9_DELAS          PPDA---K----------------------------------------------------
A1AVV9_RUTMC          PENT---N----------------------------------------------------
TATC_HALNC            PAGS---T----------------------------------------------------
Q47AM9_DECAR          PEGT---K----------------------------------------------------
E5APW1_PARRH          PKGG---K----------------------------------------------------
Q2YAV6_NITMU          PQGG---Q----------------------------------------------------
Q31E59_HYDCU          PEGT---S----------------------------------------------------
Q48AI0_COLP3          PEGS---Q----------------------------------------------------
G4QJK5_GLANF          PEGA---S----------------------------------------------------
D3SCC9_THISK          PEGT---S----------------------------------------------------
H8GJD2_METAL          PANS---S----------------------------------------------------
K0C6J4_CYCSP          PEGT---S----------------------------------------------------
D3RQL8_ALLVD          PDGN---T----------------------------------------------------
I3YA58_THIV6          PEGN---T----------------------------------------------------
F6A8L5_PSEF1          PEGA---T----------------------------------------------------
TATC_HAEIN            PKGA---T----------------------------------------------------
TATC_ECOLI            PQGS---T----------------------------------------------------
H2IVX2_RAHAC          PLGA---S----------------------------------------------------
D1BNH6_VEIPT          PAGK--------------------------------------------------------
A8MIP1_ALKOO          ADGL---E----------------------------------------------------
E1R121_SEDSS          AQGL---T----------------------------------------------------
D2RIN1_ACIFV          SAGT--------------------------------------------------------
C6XIZ5_HIRBI          AIDG--------------------------------------------------------
A0A0H3LXY3_BARHE      PEGI---R----------------------------------------------------
E0TEC0_PARBH          GQGD--------------------------------------------------------
Q28T34_JANSC          RNRGEDAR----------------------------------------------------
TATC_RHOCB            AARGQACQ----------------------------------------------------
A1B0H6_PARDP          ETRGQECG----------------------------------------------------
Q0AND8_MARMM          PVEELDLT----------------------------------------------------
Q2GER9_NEOSM          PERVAGLN----------------------------------------------------
B3PIX7_CELJU          EPGR---R----------------------------------------------------
Q0C0W0_HYPNA          AEDVRGSK----------------------------------------------------
Q3SRQ3_NITWN          PENS---K----------------------------------------------------
B9JXD9_AGRVS          HLDVSKAE----------------------------------------------------
Q98LC7_RHILO          PHKV---E----------------------------------------------------
D9QLG6_BRESC          AGGLAAVE----------------------------------------------------
B0T1Q5_CAUSK          PATD--TK----------------------------------------------------
C7JE44_ACEP3          RQQGEQPH----------------------------------------------------
Q2G9D2_NOVAD          PPGQ--GK----------------------------------------------------
TATC_MAGMM            PQAK--------------------------------------------------------
D5BQU2_PUNMI          RGGG---R----------------------------------------------------
I3TKT9_TISMK          GHDK---R----------------------------------------------------
Q2RTH4_RHORT          GGSQ---R----------------------------------------------------
Q6MGQ9_BDEBA          PGGG--------------------------------------------------------
B2A204_NATTJ          ------------------------------------------------------------
A5D1I5_PELTS          SSGN---K----------------------------------------------------
B0TFS8_HELMI          DLGI---K----------------------------------------------------
D5X7P7_THEPJ          RLHY---K----------------------------------------------------
B8D1R3_HALOH          --GT---R----------------------------------------------------
Q0AZ46_SYNWW          GLGE---G----------------------------------------------------
TATC_CARHZ            ALKM---K----------------------------------------------------
TATC_KORVE            AANHLDQK----------------------------------------------------
C1F555_ACIC5          AAHHMPTQ----------------------------------------------------
E8X125_GRATM          DLGM---K----------------------------------------------------
I3ZCY6_TERRK          ALHY---P----------------------------------------------------
D0LGH0_HALO1          PSETPFQE----------------------------------------------------
Q2IM06_ANADE          PAGR--QQ----------------------------------------------------
A7H6D7_ANADF          PPNQ--QV----------------------------------------------------
B2V5Y3_SULSY          PNLK--------------------------------------------------------
TATC_PELCD            PEGS---S----------------------------------------------------
F2LUZ5_HIPMA          PAGS---K----------------------------------------------------
D3UFV2_HELM1          VQGM--------------------------------------------------------
B9LA52_NAUPA          KDTS---S----------------------------------------------------
E6X1G9_NITSE          ASQATQNP--------------------------KLQKLLSQAASAAEELARNSRILRKA
TATC_CAMJE            PEVA---K----------------------------------------------------
A0A5B9TTD1_SULMU      PEGS---N----------------------------------------------------
A8Z6M5_CAMC1          PAGS---N----------------------------------------------------
B5YKH3_THEYD          LQNT---K----------------------------------------------------
E6W513_DESIS          PPGA--------------------------------------------------------
E4TGB2_CALNY          PPNS---S----------------------------------------------------
E6VUV0_PSEA9          AQEG---H----------------------------------------------------
Q1MQT5_LAWIP          PADT---K----------------------------------------------------
C8X1I2_DESRD          PEGS---T----------------------------------------------------
C6BSE0_DESAD          PPDS---T----------------------------------------------------
TATC_DESAH            GEGQ---K----------------------------------------------------
A9A055_DESOH          GDKG---Q----------------------------------------------------
C4XP92_DESMR          PAGS---K----------------------------------------------------
Q2LXN7_SYNAS          PKNS---F----------------------------------------------------
                                                                                  

I7CPH1_NATSJ          ------------------------VIT--RTPFEVI-LLQAKIGMVTGIIVAIPALLFFS
TATCT_HALVD           ------------------------IIA--QTPFDVI-LLQAKIGLVVGVLFALPPFIYVS
M1XZE0_NATM8          ------------------------VVA--ITPFEVI-LLQAKIGLVSGLIIMLPALAYFG
D3S1J6_FERPA          ------------------------LIT--QAPLELL-MLKIKISLIFGFLAALPYIVYLS
Q0W4Y5_METAR          ------------------------LIQ--TQPLELM-MLELKLSVIAGVIAALPVVFFYA
Q97ZU3_SACS2          ------------------------LII--INLFDPL-FASFYISLYLAIFTTIPIIVREI
A8MCQ5_CALMQ          ------------------------IIT--ISPFDPL-LAAAQISLFLAVIIALPIILWEV
TATC_CENSY            ------------------------LIQ--TTPGQAF-FAQVYIAALVGVTVSTPVAVREL
Q6KZY6_PICTO          ------------------------LLV--IKPTDGV-MADFYSCMSLSLIISMPYIAYQL
D3SVL3_NATMM          -----------------------------YHPLELW-LTRIKVSALLGIMVGLPVFVYQC
Q9HN36_HALSA          ------------------------PRV--YQPLELI-ITQVKVASLAGLVVALPAFVYES
M1XNN2_NATM8          ------------------------RVY---HPLGLI-LARLKVATLAGFVVGLPVFVYQT
Q8TKC1_METAC          ------------------------MAV--YSPLEWI-FARLKLCLVFALAVSIPQFFYQL
TATC_METAR            ------------------------ITT--YAPMEMF-KARLTMCFIGAITVGFPLLVYEA
F8A8M8_THEID          ------------------------LVF--TSLPEAI-MAALKSTFFMALAISIPFFVFQA
C7N7W2_SLAHD          ---------------------TYTLNV--LDVFGSF-TIRFKVALWASVVATMPIILWQI
E1QWP7_OLSUV          ------------------------LTV--LTVLGGF-TIRFKVALFFGLIIAAPIVIWEI
E3HCZ3_ILYPC          ------------------------LFV--NSIVEGM-TTKIKISLITGLILSMPLHLYNI
B3QTN4_CHLT3          ------------------------IQN--LVPYGQV-TLYVQVILFAALVLSFPVLIYQI
A6LCU1_PARD8          ------------------------IVN--IKLASQF-FTHMTSSFWLALLLTFPYLMWEI
A6L6V5_BACV8          ------------------------MIN--TQLAAQF-ITHMSVSFYTGFLLASPYVIYQL
C6X0T6_FLAB3          ------------------------VQQ--KKLFQQF-NVMMSVSIFGGMVVAFPYIVWEL
C7PMH2_CHIPD          ------------------------IVFQNHILVGQV-MLQFKLAFIFGLVVAFPYIFWEF
C6XV03_PEDHD          ------------------------IIN--TEMAGQF-TLQINACVMVGIILGIPYILFEL
G2Z214_FLABF          ---------------------EMPFIIQSTDMGGQF-SVFIWTCITCGFILGFPYILWEI
G8R5N0_OWEHD          -------------------EMPFEILN--TKMAGQF-STHIWVSLIAGFILAFPYVIWEV
A3UAJ3_CROAH          ------------------------IQS--RKVAGQF-SAHIWMSITAGFIVAFPYIIYQF
A0A6N4SQV5_CYTH3      ------------------------LLS--REMSGQF-TIHLKSAFIVGFIAGFPFIVWEI
C6VXQ9_DYAFD          ------------------------MQF--IGMGDAF-TMSMTSSVITGLLFAFPYAFWEI
C8WRE5_ALIAD          ------------------------LIV--TSLDEVV-VQDLKLALSLAFFAGLPYFLFEA
D5EP26_CORAD          ------------------------LIT--YKAMGVI-SVFFQIALLGGLTLSMPFVLYFL
B1ZP28_OPITP          GEHQVATLVPEPTPPESLGALRVRLHN--LSPADAF-FIAFHVAIYGAIIVSAPFWIYFM
D6Z185_DESAT          ------------------------LAY--FTVTDPF-LAHVRLGLALAMFTLVPFFVYWF
TATC_AKKM8            ------------------------MMSA-FQPGEAF-MLTIKLSLYAGVVISFPLLLYFL
D6ZGM8_MOBCV          ------------------------LNF--QTIGAAF-DLKIRVSLWLGVLLASPWWIFQL
E8N7E5_MICTS          ------------------------LNF--DSVTGAF-DLHLRVALVAGFVLSSPVWLYQL
C7MCX3_BRAFD          ------------------------LNF--QGVGTGL-NVKLQMSAYVGLLLSSPVIMLQT
C7NHS2_KYTSD          --------------------LSINFGA--GGVTQPF-TIKAKIAAVVGVILASPIWLWQF
E6SAM0_INTC7          ------------------------INF--GTMTDAF-AIKLTVALFVGLILASPVWLMQI
TATC_XYLCX            ------------------------LNF--TALGSPL-DTRIKVSLFLAVMVTCPWWLYQV
A6W980_KINRD          ------------------------LNF--TQVGQAF-DLAVKGAIWCGVIASSPFWIYQL
TATC_ROTMD            ------------------------LNY--GSVASPF-DQLLKVGMYIGLVIASPVWLYQA
C5CBV5_MICLC          ------------------------VAY--DTVASPF-DLMLKVSMFIGLILSSPVWLYQI
E1VW56_GLUAR          ------------------------VVF--TAVMSPF-DIMIKVALFVGLIVSSPVWLYQL
A9WSH2_RENSM          ------------------------VNF--AGVATAF-DLRVQAAFFLGTIISSPIWIYQI
B2GIN3_KOCRD          ------------------------INY--SSVGGSF-NTMVEVAVVLGLIFASPVWLYQL
D3Q548_STANL          ------------------------FNV--VGPLDNF-LLRLKIGLFAGIILSAPIWLYHL
D7GEA7_PROFC          ------------------------VEITTTNVTGGF-TLFMKVPFIAGFILSCPVWLYQL
TATC_FRACC            ----------------------CTLYF--FGILDAF-TIRLKISMIAAVVVSSPVWLYQL
D2ATT8_STRRD          ------------------------CTFAIRGVFEAF-FVNLKVAAMFAMVLSSPVWLYQI
Q47P16_THEFY          ------------------------LNF--TGIFDGF-NLRFKVAVIVGLLVSSPVWLYQL
A0LU67_ACIC1          ------------------------LVF--SSVFDPI-IWHLKVAAIGGILLASPIWLYQL
D2S6F0_GEOOG          --------------FTEGSEQECGLLI--TDVLGGV-FIRLKVSFLCGAVLSAPFWLYQL
C6WIE9_ACTMD          ------------------------LLQ--TQPFEAF-MIQLKVGAAAGAVLTSPLWLNQL
C8XAP1_NAKMY          ------------------------LLA--TGPFSAL-ELQLKSALIAGVVLSVPIWLYQL
B1VDV8_CORU7          --------------FGAATGE-CRLLA--TGPFEMF-LLRLKVGFIAGIVLSAPVWIGQI
D5UPM4_TSUPD          ------------------------LLA--TGVFDQF-NLRLKVAVATGIVLACPMWLYQI
TATC_MYCTU            ------------------------LLA--TAPFDQF-MLRLKVGMAAGIVLACPVWFYQL
Q0SIG7_RHOJR          ------------------------LLA--TGPFEQF-MLRFKVALTAGVVLACPIWLYQL
F6EP00_HOYSD          ------------------------LLA--TGPFEQF-MLRLKVAVTAGIVVACPVWLYQI
TATC_CORK4            ------------------------LLA--TSPFEMF-MLRMKMGGLAGLVMACPIWLIEI
Q8NQE5_CORGL          ------------------------LLA--TGPFDPF-MLRLKVAALVGMVLGSPVWLSQL
C7PVW6_CATAD          ------------------------VTI--TGPTAGL-ALSLKVSLMVGMLLASPVWLYQL
G2P670_STRV4          ------------------------FTV--NGLLSPF-TIMLKVSFTTGLVVATPIWLYQL
B1W318_STRGG          ---------------TVDGKSCALLKT--DTLIGPF-TNALKVALMSGVLLATPVWLYQL
D2Q3I8_KRIFD          ------------------------LTF--NSVTSPF-TFQIKISLVFGLMLASPIWLYEL
A1SK21_NOCSJ          ------------------------AYV--AGATGPL-MLQLKLCGVAAIVASSPYWLYQI
Q2G128_STAA8          ------------------------LHA--FSFTEMI-QIYVMIIFFIAFCFISPVMFYQL
D5SQP1_PLAL2          KSITVKVMSDTFSTLRKAAENSVRPIA--LNVQEAF-MTYLKVGFVSGLVFASPWVIYQL
E8R5A8_ISOPI          EVALAYPESAFIKAVARTVEPRNALIS--LSPLETV-TIFLMVCLVAGLVLASPWVFHQI
Q6AN67_DESPS          ------------------------LVY--TNLPEAF-LAYIKLALLIGLICSMPYCIYQS
D6Z4B1_DESAT          ------------------------LVY--TALPEAL-LSYLKLSLLLGVILALPVAVYQV
B1HXK1_LYSSC          ------------------------LII--LGPLEVV-KFYMTISTTLSFGLAMPFLVHFL
D6XUT8_BACIE          ------------------------LAV--LGPLDII-IIYFMLAAVLALALTVPVLILQI
Q8EQG3_OCEIH          ------------------------LTA--ISPTEII-WVYFSMAGLVAIIGTIPILAYQV
D5WSC2_KYRT2          ------------------------PMV--LGAGEVV-RVYFMLAGVTALGVTLPFLLLQI
C5D4F0_GEOSW          ------------------------MNA--FRLTDPI-KIYFQFAFVLAFVLTAPVLLYQI
Q5WJP1_BACSK          ------------------------FNA--FRLTDPL-RVYMNFAVITALVLIIPVILYQL
TATC_BACHD            ------------------------MNA--FKLTDPL-RVYMTFAFTSAFILVFPIILYQL
C0ZK48_BREBN          ------------------------IVS--LHPSDAL-RVYMQVAFLVGAVITLPVALYHV
E3EID4_PAEPS          ------------------------LNA--FSFWDGI-GIYMKIAMIIGIAVALPFACYQL
C6CVH0_PAESJ          ------------------------LHA--FSLWDGI-GIYMKFAFVIALLLAIPFTAYQL
D8K211_DEHLB          ------------------------LVA--IEMLEMI-SLYFRVSLTAGFILAMPWVLYQL
E6SMD5_THEM7          ------------------------LVA--LAPAEAF-LVTLRIAVLLGLGLASPVLVYQA
E8N519_ANATU          ------------------------VVS--IEVTENV-GVFMRVSLLSGFILALPYILYQI
A5URY8_ROSS1          ------------------------LQG--IDTGEVF-FAYMRMALVVGITLAMPFVLYQI
B9L0C4_THERP          ------------------------LYA--ITPTESF-ITYTKVALYLGIGFAMPMIVYQL
D1CCN1_THET1          ------------------------PLA--TGITEKF-TTYMKVAFIGGIAIAMPLIVYQL
C7LYQ4_ACIFD          ------------------------LYV--TGPIDGF-AIRLKVAAVAGLFLASPIVLWEL
Q7UFI8_RHOBA          KSMGTIPNPDELVPMIQLRRSERGLSS--LKIEEPF-MIWVKAGLIVGAVLASPMIFYHL
B3E195_METI4          ------------------------LRV--LGVVDPF-SVQLQLSLLGGLVLSLPFILYFV
Q1AUL3_RUBXD          ------------------------LNF--TSVTEAV-FADIKLALYTAFVFTIPVFLYQA
Q7U568_SYNPX          ------------------------FLQ--LAPGEFL-FVSLKVAGYAGLTLALPYVLFQL
TATC_ORYSJ            ------------------------FLQ--LSPGEFF-FTTLKVSGYCGLLLGSPVILYEI
TATC_MAIZE            ------------------------FLQ--LSPGEFF-FTTLKVSGYCGLLLGSPIILYEI
K3XJC3_SETIT          ------------------------FLQ--LSPGEFF-FTTLKVSGYCGLLLGSPIILYEI
Q114K5_TRIEI          ------------------------FIQ--LAPGEYF-FVTIKVAAYGGLLLASPFILYQI
B0CFY2_ACAM1          ------------------------FLQ--LAPGEYF-FVSLKVAAYSGILVASPFILYQI
E0UC67_GLOV7          ------------------------FLQ--LAPGEFF-FVSLKVAGYSGIVVASPFILYQV
C1A4F6_GEMAT          ------------------------LMV--THVGDLF-DIVMNASITLGVIAASPVVVWQV
B3E7M3_GEOLS          -----------------------PLNY--SAPLEPF-FIQCKISMLLGFVFALPVVFLQL
E1X470_HALMS          ------------------------VIY--LGLLDKV-LSQFQVAFWSSVIVSSPLWFWQV
A9EPV7_SORC5          ------------------------LHF--GAPAAAF-VAYFKLSMIGGAAMASPFIFYQL
Q67QH4_SYMTH          ------------------------LIQ--YNFADTF-ITQIKLALILGLVLAFPVVLYQV
A9KHC2_LACP7          ------------------------IVY--TAIAESF-SAQMKVSFLFAVILAFPFVLGKL
J9ZE06_LEPFM          ------------------------LVF--TTPTEAF-WVTLKVSLFMGAVLGYPFVLYEI
Q023M6_SOLUE          ---------------------EQNLVQ--IEPMEAFNVIWFKLPVLCAIFLASPWVLYQV
TATC_DEIRA            ------------------------LVT--TKLASQL-LLSFNLAFWAGLTLALPFIVWQI
D7BE12_MEISD          ------------------------LIV--LNITEPF-LTAFKVAAFGGLAFALPFIVYQI
D7CQR8_TRURR          ------------------------LTA--FGILEPF-IVSMQISAFFGLALAAPVIVGQI
A5EVU4_DICNV          ------------------------MLA--YQPIDIF-LTPIKVCLFLALLLTMPWILYQI
Q9PFU5_XYLFA          ------------------------VIS--TQPAGAV-FAPLKLTFFLGLFIAMPWVLYQG
Q1H3X3_METFK          ------------------------MIA--TSVTSPF-LIPLKIAFYVAVAVSLPHTLYQV
A9BXA9_DELAS          ------------------------LIA--VGVFTPF-FVPLKVLMMVGVLAVLPWIMYQM
A1AVV9_RUTMC          ------------------------IIA--INVISPF-LTPLKMSLIIAVYVAMPYLLYQI
TATC_HALNC            ------------------------MIA--VEVASPF-FIPLKLTALTAVFIAIPFLLYQL
Q47AM9_DECAR          ------------------------MVA--IGVITPF-MVPLKVTAMVAFIMALPFILYQA
E5APW1_PARRH          ------------------------MIV--TDVTGSF-FVPMKVTMLVAFVIALPVVLYQI
Q2YAV6_NITMU          ------------------------MIA--TEVVTPF-FVPMKVAMMAAFIITLPHTLYQI
Q31E59_HYDCU          ------------------------MIA--TGVASPF-LTPFKLSLVLAIYLAMPFLLFQI
Q48AI0_COLP3          ------------------------MIA--TDVASPF-FAPFKLTLVLSLFIAMPFVLYQV
G4QJK5_GLANF          ------------------------MIA--TSVASPF-FAPFKLTMVLSFFIAIPYVLYQI
D3SCC9_THISK          ------------------------MIA--IDVAAPF-LIPFKLVLLLAVVISIPYLLYQV
H8GJD2_METAL          ------------------------MIA--IEVASPF-FTPFKLALVVAIFISIPYLLYQF
K0C6J4_CYCSP          ------------------------MVA--IEVISPF-LTPLKLTLMLSVFISIPWVFYQV
D3RQL8_ALLVD          ------------------------MIA--TQVASPF-LTPFKLALIAAVFLSMPYLLYQL
I3YA58_THIV6          ------------------------MIA--TQVISPF-LTPFKLALVAAVFLAMPYLLYQL
F6A8L5_PSEF1          ------------------------MIA--TDVASPF-LTPFKLTMIVALFLAMPVILHQV
TATC_HAEIN            ------------------------MIA--TNIQTPF-FTPIKLTAIVAIFISVPYLLYQI
TATC_ECOLI            ------------------------MIA--TDVASPF-FTPIKLTFMVSLILSAPVILYQV
H2IVX2_RAHAC          ------------------------MIA--TDVASPF-FTPIKLTMIVSVFVSAPFILYQV
D1BNH6_VEIPT          ------------------------LYY--MRPTEAF-FTYMKVSVVGGLVIAAPIILHQI
A8MIP1_ALKOO          ------------------------FIY--LSPPELF-ISYIKISLVVGIVVSAPIVLFQI
E1R121_SEDSS          ------------------------FVY--LTPPELF-LAYIKISVTMGIIASVPVILFQI
D2RIN1_ACIFV          ------------------------LYF--LKPAEAF-MTYFKVLAVVGLLLASPVWFYQL
C6XIZ5_HIRBI          ------------------------VIF--TDAFEIL-FIKLRLAILAGLAVAFPFVAWQI
A0A0H3LXY3_BARHE      ------------------------LQS--TQVWETF-LTKMKLAAFGATILSFPYTAFQF
E0TEC0_PARBH          ------------------------IAQLNYPPLGLF-FARIKLSIFAGLMAAFPIIAWQL
Q28T34_JANSC          ------------------------LIF--TAPQEKF-FVLIRISIIMGFAVSFPVIAHQL
TATC_RHOCB            ------------------------LSL--IKLQEGF-FVAINIAMLGGFALAFPMIGFQL
A1B0H6_PARDP          ------------------------LIL--LKLQEGF-FVAIQISFLGGFVLAFPIIAYQL
Q0AND8_MARMM          ------------------------ANF--FAPLEFF-FVRLKLSLVGSVIIIFPVIAWQI
Q2GER9_NEOSM          --------------------SSFTLIY--TGLTETF-VVYLKVAFLGALLVSSPFFIWQV
B3PIX7_CELJU          ------------------------MIY--TGLHEAF-ITYLKLAFFAALFITLPLILIQL
Q0C0W0_HYPNA          ------------------------LEFIFTAPMEFF-FAKLKLALFAGVFLAFPVIAWQV
Q3SRQ3_NITWN          ------------------------FIY--TALLEYF-ITQLKLALFGAAFISFPIVATQI
B9JXD9_AGRVS          ------------------------LIY--TAPQEFF-FTQVKVAMFSAMVIAFPVIAAQI
Q98LC7_RHILO          ------------------------LIY--TAPQEFF-FTQVKLAMFGGMVIAFPLIATQI
D9QLG6_BRESC          ------------------------LIA--TAPLEQL-FTKMKIAGFGAIVLAFPIIAYQL
B0T1Q5_CAUSK          ---------------------ALGLVY--TAALEFF-FTKLKLAGFGAVVLTFPVLAWQL
C7JE44_ACEP3          ------------------------LIY--TALYEAF-FTYIRVAFFGAAFLSFPVVAMQA
Q2G9D2_NOVAD          ------------------------LIY--TKLYEAF-FVELKVSMFAAFFISFPVIANQL
TATC_MAGMM            ------------------------MIY--TALHEAF-FTQIKVSFFAGLFLAMPVLFTQM
D5BQU2_PUNMI          ------------------------MIF--TALHEGF-FTQIKVGFFTALCVTFPIMSMQI
I3TKT9_TISMK          ------------------------LIY--TGLTEAF-FTYVKVSFYAALFISFPIIASQL
Q2RTH4_RHORT          ------------------------MIY--TALTEAF-FTYVKVGAFGAIVLSFPLIATQI
Q6MGQ9_BDEBA          ------------------------LIY--TGPLDKF-IAHLKLSFVCGILLSCPFWLYQV
B2A204_NATTJ          ------------------------LHY--ISPAEAF-LSQLKLAIIAGLVFSLPVTLYQL
A5D1I5_PELTS          ------------------------IIF--TGVTEAF-FVKIKLSVFIGFLAALPVILWQV
B0TFS8_HELMI          ------------------------PVI--VRPAEGF-FASIKVSFFAGLIVASPVILWKI
D5X7P7_THEPJ          ------------------------LVY--IGPTEAF-IANIKIAVIGGIILASPVIMWQV
B8D1R3_HALOH          ------------------------LVY--LAPTEAF-FTQLKVAFFSGLLLAFPFIIYQI
Q0AZ46_SYNWW          ------------------------LVV--IGVTEAF-FIKLKLAFYAGFALAFPVVAWAI
TATC_CARHZ            ------------------------LVF--INVTEAF-MTKLKIAIILGIILASPIILWQI
TATC_KORVE            ------------------------LVY--LNPTEPF-NMYLKMAFIAGLFVASPFVLYQV
C1F555_ACIC5          ------------------------LVY--HNPIDPF-NMYLKISLMVGCIFASPFVLFQL
E8X125_GRATM          ------------------------LAF--THPTDPL-NLYIKTALVGGAIIASPFILYQL
I3ZCY6_TERRK          ------------------------LNY--THPTDPL-NLYLKTSLYGGAIISAPFILYQI
D0LGH0_HALO1          ----------------------ASMYF--TSMLEPF-WAFFTNSLWAGLFVASPIVFYQI
Q2IM06_ANADE          ------------------------LVY--TSAIEPM-MVYIKVAMYGGVFVAAPWVLWQL
A7H6D7_ANADF          ------------------------LHY--TSSIEPL-MVYLKVAVYGGVFVAAPWVLYQL
B2V5Y3_SULSY          ------------------------LYF--LSPTEPF-FTAFKISFLAGFILVSPFVFYQI
TATC_PELCD            ------------------------LVF--IHATEPF-FTYIKLSAMAGLLLSLPVIFWQL
F2LUZ5_HIPMA          ------------------------IIF--TGVTEAF-WVRVEAALVAAIIVSIPFTFYQI
D3UFV2_HELM1          ------------------------LIQ--TAPAEGI-IVALKVSFFVALGLSIPVIFWQI
B9LA52_NAUPA          ----------------------SEMIF--TNLVEPF-MTAIRISLYTAFFASLPVLLYHT
E6X1G9_NITSE          LVKEENLTRQAVNQNLREKSFNGMITT--HQVGGAF-FVALKVSFFAGILMAMPVILWQL
TATC_CAMJE            -----------------------HVNV--IEVQEAL-FTAMKVSFFAAFIFSLPVIFWQF
A0A5B9TTD1_SULMU      ------------------------VIF--TGVQEPF-FTAMKVAFFAGFVLSLPVIFWQF
A8Z6M5_CAMC1          ------------------------IIF--TQIQEPF-FTAMKVAFFAGLVLALPIIFWQF
B5YKH3_THEYD          ------------------------LVF--LGPAEAF-WMNMKIALVTGFILTIPIIFYQL
E6W513_DESIS          ------------------------TPFALLRLPEGF-FTELKASLLVAVCVAMPYILFQV
E4TGB2_CALNY          ------------------------LSM--LKLTEGF-LTELKLSFMAAVFFAMPYILYEL
E6VUV0_PSEA9          ------------------------FQY--TYPAEAF-FSYIKISIVAGLFLVSPYVFAQI
Q1MQT5_LAWIP          ------------------------LIF--TSVPEGF-FVYLKIAFVAALFITSPYIFYQI
C8X1I2_DESRD          ------------------------LIY--TAPHEAF-FTYIKVAFVAGLFLTSPFIFYQF
C6BSE0_DESAD          ------------------------LIF--TSLPEGF-VTYLKVAFVAGIFAVSPYIFAQV
TATC_DESAH            ------------------------MIF--TGLPEAF-FTYLKVSLLTGVILATPVLFYEF
A9A055_DESOH          ------------------------MIF--TGLPEAF-FTYLKVSLLAGIILALPVIFYQF
C4XP92_DESMR          ------------------------LIA--TSLPETF-FTVMKLAMVAGAFVASPYIFYQL
Q2LXN7_SYNAS          ------------------------MIF--TSLPEAF-FTYMKISFFSSLILTSPYILYEI
                                                                                  

I7CPH1_NATSJ          RKALRRR-GYTSAIPISKGYIAGFIAMALSLFMAGVIYAYNIFFPYAFGFLAKN-A----
TATCT_HALVD           RGALKAR-DAWPKSPVAPWKLALIGLTMVALFAAGVAYGYFVFFPFTFAFLAQN-A----
M1XZE0_NATM8          RDSLKNR-GRWPE-SFPRWKGAGFGLASAGLFVGGVAYAYHLFFPIMFGFLADN-A----
D3S1J6_FERPA          YKTLKERTELLKNVEISKSKAVLYAIIAMLLFFMGVAYGYIVMLPLFLKFLY-S-I----
Q0W4Y5_METAR          YRFLAGR-QFGDRFRISGPKLLLATAVGLVLFIVGCLYSYWLMLPLVFEYLL-T-S----
Q97ZU3_SACS2          WAFVAP--GLYEH---EKKLFKSIIFPAFLLFALGSAFAYFLLIPLMLRIIL-L-Y----
A8MCQ5_CALMQ          WAFISP--GLYSH---EKRMLKISVLPAMVLFALGALFAYTIIIPVIFKFFL-F-Y----
TATC_CENSY            AAFLRP--ALRES---EIHVGRSISAPAVGLFAAGCAFSYIVVIPYILDFLY-K-I----
Q6KZY6_PICTO          MQFVSP--ALKNS---ERELIKSIIIPASLLFAAGAFMGLYFVAPEIFIIFQ-D-F----
D3SVL3_NATMM          YRFMKP--GLYPH---ERKYYLAAVPTSVVLAGIGMLFSYVLVLPILFEYFT-F-Y----
Q9HN36_HALSA          YVFMRP--GLYRN---ERRYYLASVPTSLVLSVVGVLFAFFIVLPYTMGYFQ-S-Y----
M1XNN2_NATM8          YLFMRP--GLYPA---ERRYYLASVPASLVLGVFGVLFAYFLVLPAIFTYFL-T-Y----
Q8TKC1_METAC          YRFAGK--GLYPH---EKRFFLKVVPASFLLFILGAALGYFIVLPVMFRYIF-F-Y----
TATC_METAR            FRFAAP--GLYPH---EKRFLYLVFPFSLLLFVAGGLVAYFVTLPLFFSIVI-G-H----
F8A8M8_THEID          WRFLSP--ALFPH---EKKFFSKTLFLGAIFCLASLAFTYFIVFPAFLKFVL-G-L----
C7N7W2_SLAHD          LAFFLP--ALKPN---ERKWFIPTFAVAVVLFIAGTLFCYFLILNPAVAWLT-D------
E1QWP7_OLSUV          MGFFLP--ALTER---ERRWVVPTVAAMVILFLLGMLFCYLVIQNAAVGWMI-D------
E3HCZ3_ILYPC          VAFIFP--ALNKK---EKMCLAAALVCSFVLVIVSIYLSYFKILPISIKFLTDSDF----
B3QTN4_CHLT3          WQFVMP--GLKKE---ERVASRFAVAFISICFFAGIAFGYFVFLPVSLKFFA-S-F----
A6LCU1_PARD8          WKFVSP--ALYEN---EKKNVRWVFLFGTIMFFIGCSVGYFLVFPMTLRFLA-T-Y----
A6L6V5_BACV8          FRFVSP--ALYEN---EKKYSTRIVGWGYFLFMMGVLLNYFLIFPLTFRFLA-T-Y----
C6X0T6_FLAB3          WRFISP--ALHPS---ERKNSVFLINFVWILFLVGILVGYFLILPFAINFGL-L-F----
C7PMH2_CHIPD          WSFIKP--ALKER---ELKGARGVIFWVSFQFFMGIAFSYFLMAPFTINFLA-G-Y----
C6XV03_PEDHD          WLFIKP--ALHDN---ERKSASHFVMFASTLFFIGILFGYYIVCPLSVNFLT-N-F----
G2Z214_FLABF          WKFISP--ALYKN---EKKNAILFITTSSILFFIGVLFGYFLILPLSVQFFG-A-F----
G8R5N0_OWEHD          WRFIKP--GLHDT---EKKYSRGVLFFASFLFMLGVLFGYFLISPLSIQFLG-T-Y----
A3UAJ3_CROAH          WKFISP--GLHHT---ERRHARGFITASSMLFFLGVLFGYYVITPLSINFLG-S-Y----
A0A6N4SQV5_CYTH3      WKYIKP--ALHKN---EINVSFKVVSVVPFLFIIGILFGYFILAPLSVNFLA-N-Y----
C6VXQ9_DYAFD          WRFIEP--GLKPS---EKRSARGAVFYVTSLFFSGVLFGYYIVSPLAINFLA-N-Y----
C8WRE5_ALIAD          WRFVAP--ALTAS---ERRLVRAGLAAGLLLFAAGAAFAWWIVVPRLVRYLV-A-I----
D5EP26_CORAD          GSFVAP--GLTDQ---EKKILKPSCFAAFALFITGVCFAFFIILPLTLTFTV-R-L----
B1ZP28_OPITP          GQFFLP--ALSVR---EKSVLYQWLGWGVLLFFSGVAATYFVLLPLALRASI-E-Y----
D6Z185_DESAT          WKAMAGPFGLTRA---TRAW---FVLFCCLLFYGGTMFCFFVTLPLGVNFLL-G-Y----
TATC_AKKM8            LQFIIP--GLLEH---ERKLLYKCMAVGFGLFLAGTLFCYFIVLPRVLTFFY-T-Y----
D6ZGM8_MOBCV          VAFIWP--GLRRR---ERLWMLIFGVAGVILFAAGAVFGDW-TAPRAVSILS-S-F----
E8N7E5_MICTS          FAFVLP--GLTRR---ERRYVLGSVGAAAPLFIAGCATGLL-LFPHMVSVLA-G-F----
C7MCX3_BRAFD          WLFVMP--GLHRN---ERKYAIGFFGTAIPLFFLGCAAGYWAVNQLVPVLLS---F----
C7NHS2_KYTSD          WAFILP--GLYRR---EKLIAFGYFLVAVPMFLAGCLLAIW-ALPTAVKTLLAA-F----
E6SAM0_INTC7          WGFVVP--GLTKK---EKRVTRLFVVAAVPLFVAGCAAA-FVMVPKAVAVLL-D-F----
TATC_XYLCX            WAFVTP--GLTRR---EKRHAYGFLGAAVPLFLGGAGLSWW-VLPHAVDIFA-S-F----
A6W980_KINRD          WAFITP--GLTRK---ERRYAVGFIFAAVPLFLAGAAIAYA-VLPNAMRFLV-D-F----
TATC_ROTMD            LRFLLP--ALHTK---EKKYLFGFLTASIFAFACGVAISYF-TLPGVVYALL-K-F----
C5CBV5_MICLC          WAFIVP--GLKKA---EKKYALGFIAAAVPLFLFGIALGWF-VMPQAVQFFV-G-F----
E1VW56_GLUAR          WAFIVP--GLKKN---ERRMSYSFVAAAVPLFLGGVAMAYF-VLPFALEFFI-S-L----
A9WSH2_RENSM          WAFVTP--GLSAR---ERRFTFGYMLAAVPLFLAGAYCGWL-VMPNIVYALT-C-F----
B2GIN3_KOCRD          WAFITP--ALHKN---ERRYAMGFLAASIPLFLGGCAMAVA-ALPAAVYALT-A-F----
D3Q548_STANL          WAFIAP--GLHKH---ERKYTYYFAAMAGPLFFAGATLGWF-VISKSLQFFL-A-L----
D7GEA7_PROFC          WAFIAP--GLLSN---ERRAAIRFLGTSIPLFLTGVLLGYW-ISPKGFAVLL-Q-F----
TATC_FRACC            WSFITP--GLHRH---ERRWSLTFVGVSLVLFATGAVFAYL-TLSTGLGLLL-G-F----
D2ATT8_STRRD          WAFVTP--GLYRN---EKRYSISFLALAIPLFLAGAALAYF-IMDTGLAILL-G-F----
Q47P16_THEFY          WAFVAP--ALRGK---EKRYTYLFVGFAVPLFFSGTVLAYY-VTAKGMEIMF-S-L----
A0LU67_ACIC1          WAFVTP--GLHKN---ERRYALQFVATAVPLFCGGATLAYF-VMSKGLQVLL-N-F----
D2S6F0_GEOOG          WAFITP--GLKRN---EKRYGFGFVAVSSLLFALGAALAYV-SLSAGLQLLL-G-L----
C6WIE9_ACTMD          WRFIAP--GLYAK---ERKFALIFVGVASLLFLAGAVLAFY-VVPQGLSVLV-G-F----
C8XAP1_NAKMY          WAFVTP--ALYSK---ERKYAIIFVSAGAVLFVAGAVLAYV-VIREGLTVLL-S-F----
B1VDV8_CORU7          WGFITP--GLKKN---ERRWAVSVSLVATLFFFFGAALAYL-VLHHGLHFLL-T-V----
D5UPM4_TSUPD          WAFIVP--ALHRK---EKRYTVAFVGLGGTLFISGAVLGYL-MITSAFSFFL-T-V----
TATC_MYCTU            WAFITP--GLYQR---ERRFAVAFVIPAAVLFVAGAVLAYL-VLSKALGFLL-T-V----
Q0SIG7_RHOJR          WAFITP--GLYAK---ERRYAIGFVVSGAALFIAGAVLAYV-VVAKALHFLL-T-I----
F6EP00_HOYSD          WAFIVP--ALHRN---ERRLAMTFVACGAALFIGGAVLAYY-LVAYALSFLL-T-I----
TATC_CORK4            WRFITP--GLLKN---ERRWTLSVGTIAGFLFVLGVVAAYL-VLPMGLDVLL-H-L----
Q8NQE5_CORGL          WGFITP--GLMKN---ERRYTAIFVTIAVVLFVGGAVLAYF-VVAYGLEFLL-T-I----
C7PVW6_CATAD          WAFIAP--GLHRN---EKKYSLGFVAAGVPLFAAGAALCYT-IFSTIMRVLL-G-F----
G2P670_STRV4          WAFLAP--GLHRN---EKKYGLFFVGLGVPLFVAGAYFAYM-ILPTSAKVLI-G-F----
B1W318_STRGG          WAFVAP--GLHKG---EKRYAYAFAVVGAPLFLAGGYLAYA-ILPQTAEIML-G-F----
D2Q3I8_KRIFD          WAFIAP--GLHRS---ERRWAVLFAAIATPLFAAGLAVAYW-TLPKGIEILI-G-F----
A1SK21_NOCSJ          WAFVVP--GLHDQ---ERKWTRIFAAIAGPLFIIGVATGYY-VLPRGLEVLI-G-F----
Q2G128_STAA8          WAFIAP--GLHNN---ERQFIYKYSFFSVLLFCAGVAFAFYVGFPMIIQFAL-K-L----
D5SQP1_PLAL2          WLFVAA--GLYPH---ERRYVYIYLPFSIGLFLAGAAFCYFAVFPLMLDFLL-G-Y----
E8R5A8_ISOPI          WAFVAA--GLYRH---EKAYVKKFLPFSLGLFLAGVFLCFFVVLPLTLRVLL-E-F----
Q6AN67_DESPS          WAFIAP--GLTKK---ERSIARTVVFWSTLLFLAGGSFAFFIILPKILSYFM-S-Y----
D6Z4B1_DESAT          WMFVAP--GLHRR---EKVVAIKVALWGFLLFAGGALFAYFVVLPQLLVFLL-W-F----
B1HXK1_LYSSC          WSFVKP--GLKET---ESRFLGLYAPVMLALFLLGIAFGYFVVNPLSYSFLV-G-I----
D6XUT8_BACIE          WLFVKP--ALTPK---EQKATIIYIPASFVLFAGGLAFGYFVVLPIVLSFLL-D-L----
Q8EQG3_OCEIH          WAFISP--ALTSR---EKKVSLSYIPALFLLFIIGLVFGYIIFIHLIFPFLL-S-L----
D5WSC2_KYRT2          WRFVAP--GLTPR---ERRAALAYIPMALFIFLAGVSFGYFLVFPTVFRFLI-R-L----
C5D4F0_GEOSW          WAFVSP--GLYEK---ERRVTLSYIPISIFLFLAGISFAYFILFPFVVRFMQ-N-L----
Q5WJP1_BACSK          WAFVSP--GLKEN---EQKATLAYIPIAFLLFLAGIAFSYFILLPFVISFMG-Q-M----
TATC_BACHD            WAFVSP--GLHEN---ERKATLAYIPIAFFLFLGGLSFAYFILFPFLIQFIG-G-L----
C0ZK48_BREBN          WRFVSP--GLEEQ---EKRGTLYFIPAACFLFIIGVLFGYYVVFPMVMQFMT-G-I----
E3EID4_PAEPS          WKFVSP--GLRPQ---ERSATLRYVPYVLLLFMIGAAFAYFIIFPMAIQFTS-S-V----
C6CVH0_PAESJ          WAFVKP--ALKPN---EQRATIKYIPFALIMFLIGLAFSYFVVFPLAFHFTR-K-V----
D8K211_DEHLB          FAFLMP--AFTLK---EKRFIFTFFPFIVIMFLGGVAFAYWVAMPPAVQFLF-G-F----
E6SMD5_THEM7          LRFIWP--GLTET---ERRYVRWYALPALVLFAAGLAFGLLVAVPMALNFLL-G-F----
E8N519_ANATU          FAFIVP--GLLPH---EKRILFTVIPIASILFISGVAFSYFVMLPAAIPFLV-S-F----
A5URY8_ROSS1          VAFFLP--GLLPH---EKRVLFIALPFVTELFIAGVAFGWFFTVPAALGFLL-G-F----
B9L0C4_THERP          VRFLAP--GLTRK---EKRYLYRALPFVSIMFVAGVAFAFFVLVPRALSFLS-H-F----
D1CCN1_THET1          IAFISP--GLTKR---ERRFVLRALPFVTLLFVTGVIFGYFIVLPTALRFLL-G-F----
C7LYQ4_ACIFD          WRFVAP--GLKRG---ERRLTLGFLVSSVALFVAGGVVA-WLVYPRALGFFQ-S------
Q7UFI8_RHOBA          WSFVAA--GLHSH---ERRYVYVYLPFSVVLFVSGVVLAFGLVLHYVLTFLL-Q-F----
B3E195_METI4          AQFIIP--GLTPS---ELRLLFPIFSVGALLFVGGILFSYFILLPQTLQFFS-A-Y----
Q1AUL3_RUBXD          WAFVAP--AVGEM---GRLFTYTLIALASSLFIAGVAFGYFVVLPIGVNFLL-D-W----
Q7U568_SYNPX          LAFVLP--GLTIR---ERRLIAPAVAGSAVLFLAGIAFAGWALVPAALRFLV-S-Y----
TATC_ORYSJ            IAFVLP--GLTRD---ERKFLGPIVLGSSVLFYLGIFFSYTVLAPAALNFFV-N-Y----
TATC_MAIZE            IAFVIP--GLTRD---ERKFLGPIVLGSSVLFYLGIFFSYTVLSPAALNFFV-N-Y----
K3XJC3_SETIT          IAFVLP--GLTRD---ERKFLGPIVLGSSVLFYLGIFFSYTVLSPAALNFFV-N-Y----
Q114K5_TRIEI          IKFVLP--GLTTR---ERRFLGPIFLGSTVLFGLGLVFAYFAIVPAALKFFI-G-Y----
B0CFY2_ACAM1          IQFVLP--GLTRS---ERRLLGPIVLGSSVLFFVGILFAYVALIPAALNFFI-Q-Y----
E0UC67_GLOV7          IQFVLP--GLTRR---ERGLLGPVVLGSSILFFAGLVFAYVALIPAALKFFI-S-Y----
C1A4F6_GEMAT          WGFLSP--ALYGH---EKKVVIPALVAAALLFLAGMALAFEYVLPVTLAFYA-S-F----
B3E7M3_GEOLS          WLFIAP--GLTDK---ERRMVVPFVTAATLTFCAGAMFFLVVIWPVIINFSL-S-Y----
E1X470_HALMS          WKFVKP--GLYEH---EAKGVKPFIVVGFILFWLGISFGYFLVFPLTFETLM-S-F----
A9EPV7_SORC5          WAFVAP--GLYAK---EKRYVIPFVLFSTILFVGGGWFGWRAAFPISFGYFL-S-M----
Q67QH4_SYMTH          IAFILP--ALKPE---EKRLLFIGLPFATGLFLAGWAFGYFIVVPITKEFFK-S-M----
A9KHC2_LACP7          WRFVAP--SLYRR---EKFVYGGVFFIVLLLFVLGILFAYLIVFHMAINFFV---F----
J9ZE06_LEPFM          WRFVSP--GLYRR---EKKSVFLWILGGTLFFALGVAFSNFVALPSALHFLV-G-F----
Q023M6_SOLUE          WAFISP--GLYRH---ERKWAAPFVLGTAGLFITGGIFAYFVVFRYGLTFLL-S-I----
TATC_DEIRA            WAFIAP--GLYPQ---ERRWGLPFILGAGFAFAAGVVFGYKLVLPTMVPFLI-E-F----
D7BE12_MEISD          WAFIAP--GLYDH---ERRLAVPFLLGAGFSFAAGAVFSYFVLLPFAVPFLL-G-F----
D7CQR8_TRURR          WGFIAP--GLYPE---ERRWAVPFVLLTALAFSAGILFAYYIVLPFALPIIV-G-F----
A5EVU4_DICNV          WRFIAP--AMYRH---EKRLMLPIVISATVLFYLGVLFAYFVILPLMFTFFS-G-I----
Q9PFU5_XYLFA          WAFIAP--GLYQR---EKRLALPLLISAVVLFYIGCAFAYFLVLPAVFHFLT-T-F----
Q1H3X3_METFK          WKFFQP--GLYPK---EKLISVLGVVSSVILFVIGACFAFYLVIPVVIKFIV-G-T----
A9BXA9_DELAS          WAFVAP--GLYSH---EKRFALPLIIFGSLLAYIGIAFVQFFVLDKMFAFIQ-G-F----
A1AVV9_RUTMC          WSFVAP--ALYKH---EKQMILPLVVSSTILFYTGLLFSFYIVFPVIFGFLS-S-V----
TATC_HALNC            WAFIAP--GLYKH---ERKLVAPLVFSSTILFYLGAAFAYFVVFPVVFGFLS-T-A----
Q47AM9_DECAR          WAFIAP--GLYAH---EKRLGIPLIISSTLLFVAGMSFCYFFVFGQVFSFIN-S-F----
E5APW1_PARRH          WAFVAP--GLYQH---EKKLVLPLVSSSYVLFLCGMAFAYFVVFPTIFRVMA-H-Y----
Q2YAV6_NITMU          WAFVAP--GLYSH---EKRLVLPLVLVSSILFGCGMAFAYFAVLPLVFEFIT-H-F----
Q31E59_HYDCU          WSFIAP--ALYQH---ERQLVGPLLFFSSFLFYAGGAFAYYAVFPLVFGFLS-T-A----
Q48AI0_COLP3          WSFVAP--GLYSN---EKRMIAPLMFGSTLLFYSGIAFAYFLVFPVVFAFFT-S-V----
G4QJK5_GLANF          WGFIAP--GLYRN---EKKLVAPLLLSSTLLFYSGMAFAYFVVFPLAFSFFA-A-V----
D3SCC9_THISK          WSFVAP--GLYSH---EKNMALPLVASSTILFYLGMAFAYFVVFPLIFAFFT-A-T----
H8GJD2_METAL          WAFVAP--GLYQH---ERRFILPLLIASTLLFFLGVAFAYFAVFPLMFQFLT-A-V----
K0C6J4_CYCSP          WLFVSP--GLYQH---EQRIALPLISAATFLFYGGMLFAYFVVMPLIFKFLT-A-T----
D3RQL8_ALLVD          WAFVAP--GLYQH---EKRLAVPLLVSSIFLFYLGMLFAYYVVFPLVFAFMV-G-T----
I3YA58_THIV6          WAFVAP--GLYQH---EQRLAIPLLVSSILLFYLGMAFAYYVVFPLVFAFMA-G-T----
F6A8L5_PSEF1          WGFIAP--GLYKH---EKRIAIPLLISSIILFYAGMAFAYFLVFPIIFHFFA-S-V----
TATC_HAEIN            WAFIAP--ALYQH---EKRMIYPLLFSSTILFYCGVAFAYYIVFPLVFSFFT-Q-T----
TATC_ECOLI            WAFIAP--ALYKH---ERRLVVPLLVSSSLLFYIGMAFAYFVVFPLAFGFLA-N-T----
H2IVX2_RAHAC          WAFVAP--ALYKH---ERRLMMPLLFSSSALFYLGVAFAYFVVFPLAFAFFA-K-T----
D1BNH6_VEIPT          WLFVKP--ALTVR---EKQLSNWILPVAIGLFGIGIVFSYFLVLPAAVKFFM-G-F----
A8MIP1_ALKOO          WMFIRP--GLKEK---EQRYVLFAMFMGIVFLVMGVVFAYFIIIPMTIQFFV-K-M----
E1R121_SEDSS          WRFVKP--GLEKR---EVAALGFTIIFGTIFFITGAFFSYRIILPITLTFFL-K-Y----
D2RIN1_ACIFV          WAFLLP--ALTQK---EKKTLLAFVPFSVLLFVGGCVFAFEIVLPRGLAFFL-E-F----
C6XIZ5_HIRBI          YSFVAP--GLYKS---ERQAMLPYITITPFLFVAGAALVYFMILPFVMHFAFNQEF----
A0A0H3LXY3_BARHE      YSFIAP--GLYKN---ERMAFLPFLIGGPILFCVGGAFVYALLAPIMLWFSLSQQF----
E0TEC0_PARBH          YAFVAP--GLYRH---ERRSVYPFLIAIPFLFSGGILLVHQLILPFVMEFAL-G-M----
Q28T34_JANSC          WRFVAP--GLYKS---EKGAILPFLVASPVLFTIGAAFAHYVVTPLAMNFFI-G-FSDAI
TATC_RHOCB            WRFVAP--GLYRN---EKRAFLPFLIASPVMFFVGAAFCYYIILPMAFSFFL-G-F----
A1B0H6_PARDP          WRFVAP--GLYRS---EKAAFLPFLVASPVMFMIGAAFAYYIILPMAYDFFL-G-F----
Q0AND8_MARMM          YGFVAP--GLYKN---ERGAFAPFLAMSPVLFGVGVSFVYFLVLPMVMRFSL-G------
Q2GER9_NEOSM          YMFIAP--GLYPG---EKKAFLPYLIAAPVLFILGCAVVYYYVFPLAWRFFV-S-F----
B3PIX7_CELJU          WKFIAP--GLYRH---EKRGLSLLFAMTPVLFVAGAALAYYLVFPLAWSFFI-S-F----
Q0C0W0_HYPNA          YAFVAP--GLYKN---ERGAFWPYLVFAPLLFSLGAAFVYFIMLPMLARFTI-S-M----
Q3SRQ3_NITWN          YKFVAP--GLYKH---ERNAFLPYLIATPAFFVLGATVVYFAVLPMLVRFSL-G-M----
B9JXD9_AGRVS          YKFVAP--GLYKN---ERQAFLPFLVASPVLFLMGAALVYFFFTPMVMWFFL-A-M----
Q98LC7_RHILO          YKFIAP--GLYKN---ERNAFLPFLIASPVLFLMGASLVYFFFTPMVMWFFL-A-M----
D9QLG6_BRESC          YAFVAP--GLYRN---EKGAFLPFLIATPVMFCLGGALVYFVMLPFVMLFSLSQQI----
B0T1Q5_CAUSK          YRFVAP--GLYKN---ERYAFLPFLIASPFMFVLGAALVYYIMLPFVLWFSLSQQI----
C7JE44_ACEP3          WIFIAP--GLYRS---EKRAFAPFLIATPILFLVGASLAYYFIFPIAWRFFL-S-F----
Q2G9D2_NOVAD          WAFVAP--GLYAR---EKKAFLPFLFATPILFTMGASLAYFIVMPTAFKWFL-G-F----
TATC_MAGMM            WLFIAP--GLYQH---ERSAILPFLFVTPVLFFMGGTLAYYFVFPLAFKFFL-G-F----
D5BQU2_PUNMI          WRFIAP--GLYKN---EKQAFLPFLIATPVLFLMGAAMVYYVVTPLAWNFFI-S-F----
I3TKT9_TISMK          YMFVAP--GLYRN---ERKAFMPFLIATPFLFVLGAALAYYFVFPLAWGFFA-G-F----
Q2RTH4_RHORT          WMFVAP--GLYRH---EKRAFLPFLIVSPMLFILGAAMVYYLVMPMAWSFLL-G-F----
Q6MGQ9_BDEBA          WKFIAP--GLYAK---ERKYTMGFIFSGTGLFVLGAAFSYWIALPMAFQFLM-T-Y----
B2A204_NATTJ          IAFVLP--ALEPG---EKKYLFIFLPLALILFVLGVLFAYFVILPLAYRFFI-N-F----
A5D1I5_PELTS          WSFIIP--ALKKN---ERFYFTLFVVLSFICFIGGIVFSFFGVYRLGVMFML-R-F----
B0TFS8_HELMI          WSFVMP--ALYPH---ERKWVYIILPISVLLLVLGVLFAFYTVYPIGVTFLI-T-F----
D5X7P7_THEPJ          WSFILP--ALTRN---EKRAVVFIMPISILLFVTGVVFGYLTVFNFGIEFLL-G-F----
B8D1R3_HALOH          WRFISP--AFTEN---RQKFISWLVPLSCLFFAGGLIFGYFVVVRFGLKFLM-R-F----
Q0AZ46_SYNWW          WRFFKP--ALYPE---ERKYVYVLLPVSVLLFSTGILFSYFGILPLVLKFFI---Y----
TATC_CARHZ            WSFVAP--GLKPA---ERKFILRMIPVIIILFVAGIVFAFFTVFQIATRFLL-Q-F----
TATC_KORVE            WLFIAP--GLYKR---ERRYVLPFMFSTVLLFLGGGVFGYYMVYPNALTFLI-G-Y----
C1F555_ACIC5          WMFISP--GLYAN---EKKYVVPFMVATVGLFLAGAYFGYRWVYPGSLDFLL-G-Y----
E8X125_GRATM          WLFISP--GMYAN---EKRYVWPFMGSTVGLFLAGAWFGYRYILPGALSTLING-F----
I3ZCY6_TERRK          WLFISP--GMYSN---EKKYVIPFMTATVALFFGGAYFGYHWVLPSALKMLI-GDF----
D0LGH0_HALO1          WQFIAP--GLYSH---ERRYGIVFALASAVCFISGGLFSYEFVLEPVYEFLL-G-FATSN
Q2IM06_ANADE          WLFIAP--GLYKR---EKKVVFPFLFWGTLLFYLGAVFCFELVMPQAFPAML-A-F----
A7H6D7_ANADF          WQFVAP--GLYKK---EKRLVIPFLFFGTLLFYVGAAFCYFLVMPPAFPAML-A-V----
B2V5Y3_SULSY          WKFIEP--ALYEH---EKKLVFPFVIFTTLFFIIGCLFSFYLVLPVAIGFFI-N-F----
TATC_PELCD            WAFVAP--GLYPS---EKRLALPFVLASSGCFGAGAWFGFGYVFPLVFRFLV-S-Y----
F2LUZ5_HIPMA          WLFIKP--GLKEN---ERKFAIPFVFVFSVLFVGGAMFAYWVVLPLGFKFLL-K-Y----
D3UFV2_HELM1          WAFVAP--GLYKH---EKKIVLPFVFFGSLMFFCGVAFAYFLAFPYAIKYIL-M-F----
B9LA52_NAUPA          WKFIAP--GLYDH---EKKLVIPFVLFGTIMFIVGAAFAYYIVFPIGFKVMI-N-F----
E6X1G9_NITSE          WLFIAP--GLYDN---EKKMVLPFVVGGSVMFLIGVLFAYYVVTPFGFQFLI-T-F----
TATC_CAMJE            WKFVAP--GLYDN---EKRLVVPFVSFASIMFAFGACFCYFVVVPLAFKFLI-N-F----
A0A5B9TTD1_SULMU      WLFVAP--GLYDN---EKKLVIPFVLAATIMFAIGASFCYYIVVPLAFGFLI-G-F----
A8Z6M5_CAMC1          WLFVAP--GLYDN---EKKYVIPFVLSASFMFACGAAFCYYVVIPLGFTFLV-N-F----
B5YKH3_THEYD          WRFVSP--GLYAH---EKKYVLPFVLTATGLFLTGVAFCYFIVLPFAMGFLL-N-Y----
E6W513_DESIS          WKFIAP--GLYPR---ERKATIPLVVFATIFFFVGASFAYYIVFPLGFQFFL-N-Y----
E4TGB2_CALNY          WKFIAP--GLYAH---ERRYVSGFVISASFLFFFGSFFCYQFVLPIAFKFFL-T-Y----
E6VUV0_PSEA9          WGFIAP--GLYSH---ERKWMIPIAVISAIFFTSGALFGYFIVFPFGFEFFA-S-F----
Q1MQT5_LAWIP          WLFISP--GLYDE---EKKYILPLSICSAAFFLGGAAFCYFFVFPFVFVFFM-S-Y----
C8X1I2_DESRD          WSFVAP--GLYKH---ERKWLIPIAFFSAAFFCTGAIFGYSIVFPWGYKFFM-G-F----
C6BSE0_DESAD          WGFIAP--GLYEH---ERKWMIPLAFLSAFFFVGGALFGYYVVFPFGCEFFM-G-F----
TATC_DESAH            WMFVSP--GLYRK---EKRFVLPVVILSIFFFCVGSSFGYFIVFPYGFQFFL-G-F----
A9A055_DESOH          WMFVAP--GLYRK---ERTLVLPVVLISLIFFAAGALFAYFLVFPLGFKFFL-G-F----
C4XP92_DESMR          WQFVAP--GLYKE---ERKIIIPVAFATAVCFVGGALFGYFIVFPFGFKFFV-D-Y----
Q2LXN7_SYNAS          WKFVSP--GLYPK---EKRYVLPFVFFSTLLFAGGVLFGYFIALPPAFKFFV-S-F----
                                                        .                         

I7CPH1_NATSJ          --------------------VSAG--I--KPSYGITEFTEFMALLTLSFGLAAQLPLLMG
TATCT_HALVD           --------------------ISAG--F--TPSYSIVKWAQFIFLLTLSFGLASQLPLAMT
M1XZE0_NATM8          --------------------VGAG--F--EPTYSISMWAQFVFLLSLSFGLAAQLPLLMS
D3S1J6_FERPA          -------------------AQSQG--V--LALYSIAEFINFVVLMLAVFGVTFEMPLIMH
Q0W4Y5_METAR          -------------------SLAAG--V--ANSWKVSDFVNFAVMTTAVFGLVFELPLAMT
Q97ZU3_SACS2          -------------------ATALGSAV--EPTLGLRSFVSTVMTLLIATGLSFELPLIMG
A8MCQ5_CALMQ          -------------------AKALN--V--EPTISLRSFVQTILALMLSMGLAFQTPLIMT
TATC_CENSY            -------------------GESAG--I--TTFLNVMDFVSFVLQFLLAFGISFQLPLVMF
Q6KZY6_PICTO          -------------------NVGLG--A--STTLSISSFVSFLFIYVIAFGLSFELPVIMV
D3SVL3_NATMM          --------------------AEGS--A--DIAYALGDTFDLIITLIGFLAIVFQIPLFIM
Q9HN36_HALSA          -------------------TEPTA-----DVAFALGTTFNLLLLVMGYLAVVFQIPLFIM
M1XNN2_NATM8          --------------------SQDA--A--VIAFGLTDTFDLIVLMMGLFAAVFQIPLFVM
Q8TKC1_METAC          --------------------SGDV--A--SAQLSVQNTLSAVTTILAGFGVVFQAPLLVV
TATC_METAR            --------------------GLEV--A--APALSVGETFSIVTNFVAGLGLVFQVPLIIV
F8A8M8_THEID          --------------------GYTH--F--TPLLRIQSYLAFLGKGLLFAAILSQIPLFTA
C7N7W2_SLAHD          -------------------QASGY--A--SIFPDAKAWVDVIINFEIAFGFAFELPLIVF
E1QWP7_OLSUV          -------------------QSTEF--A--AVIADAEDYLNIMMLLEIGFGVAFQLPLVIF
E3HCZ3_ILYPC          --------------------IPQD--V--GLLLNYNTNLFYALYFVFWSIIGFQSPIVFV
B3QTN4_CHLT3          --------------------GSEL--I--ENNIAIDDYVSFFLGALFTSGFIFELPFVSY
A6LCU1_PARD8          -------------------ELSAA--I--TEQVSLDSYMDNFLMLIFVMGIVFEMPLVSW
A6L6V5_BACV8          -------------------QVSME--V--ENTITLSSYMDTLMMMSLMMGIVFEIPVLCW
C6X0T6_FLAB3          -------------------TISDS--I--TQLFDLSDYTTLFMQVVLGMGIIFLFPVIVY
C7PMH2_CHIPD          -------------------TVTDR--A--VNQFFIDDYFGLMSQIVLGMGILFELPVLVF
C6XV03_PEDHD          -------------------TVSPD--I--QNTFTITSYLSSVATLTIGSGIIFQLPVVIY
G2Z214_FLABF          -------------------NVSKV--I--QNEFNLDNYMGMVKTSVISCGLIFELPIIIY
G8R5N0_OWEHD          -------------------TVSAD--V--TNFIDLNSFISTVSTVTLASGLIFELPIIVY
A3UAJ3_CROAH          -------------------QVSKE--V--FNDFDLSSYTGLVRASVLASGLIFQLPIVIY
A0A6N4SQV5_CYTH3      -------------------NIDAA--I--QNQFDITSYVSTVTIMVLVCGLIFQLPVLVY
C6VXQ9_DYAFD          -------------------TLDPS--I--INEFSVASYISLVATLTLACGVAFQLPIVVF
C8WRE5_ALIAD          -------------------AAWSH--L--GVYLRYGSYLSFVSTIVVAFGIAFELPVVVA
D5EP26_CORAD          -------------------NNYYD--F--DIFWAASDYYNMVVWFSLSVGAFFQFPLIVV
B1ZP28_OPITP          -------------------SHLLG--L-EAYDWRADGYIGFVMKFIVGMGIGFQFPIVVL
D6Z185_DESAT          --------------------QSEQ--L--QAVIAVGKFVTFVTVFVLAFGFIAMLPIFMI
TATC_AKKM8            -------------------SLEFG--I--SNEWRIGYYLSFATQMILMFGLAFELPVVVM
D6ZGM8_MOBCV          --------------------TPPD--S--AMLLQADSYIKFYIRLVLAFGISFLIPEILV
E8N7E5_MICTS          --------------------ASAE--D--STILDAGTYIDFVLKIVVATGIAFVVPVLLV
C7MCX3_BRAFD          --------------------TPQQDQV--EQLIKYDDYLSLLVKTMLAFGIAFVIPVVMV
C7NHS2_KYTSD          --------------------IPEG--G--GNFTAAEPYFAFVGNFILWFGVAFLLPVVMV
E6SAM0_INTC7          --------------------TPAG--A--FNIQDASLYLSFVLKFIIAFGCAFLLPVFLI
TATC_XYLCX            --------------------VPAG--S--SQYVNAQEYLSFVMRLVLAFGVAFVAPVLLV
A6W980_KINRD          --------------------TPVD--A--ANLIGADIYLSFVMRIILAFGLGFLMPVVLV
TATC_ROTMD            --------------------TPVN--E--SNYIDAGVYISFILKFVVTFSCAFIIPVILV
C5CBV5_MICLC          --------------------TPEG--G--ANLPTASVYISFVTRLYLAFGVAMVLPVLLV
E1VW56_GLUAR          --------------------SPEN--S--DNLLNISEYLPFIIRLLLAFGLAMLVPVLMV
A9WSH2_RENSM          --------------------TPEG--G--TNFIQANDYITFIMQLVLFMGIAFLVPVVLV
B2GIN3_KOCRD          --------------------TPEG--G--ANFVEAGIYLRFFLQLILTFGISCVVPVLLV
D3Q548_STANL          --------------------SNQY-----KLTVDLTGYFDFVTNVMLLFGAGFEFPLVVV
D7GEA7_PROFC          --------------------NPPG--V--LNLNDANEFLTFELTLLLVFGVSFLLPVVLV
TATC_FRACC            --------------------GGNG--L--VSVLDGNRYLSYVQAMLLIFGLSFEVPLLVM
D2ATT8_STRRD          --------------------APNN--A--IPLLEMDDYLSYALVMLIIFGVSFELPLLMV
Q47P16_THEFY          --------------------APEG--A--TALITLDNYLNYMIMMLAVFGAAFVLPLIVV
A0LU67_ACIC1          --------------------APAG--T--VSLISIDHYLTYILAMLLIFGLSFDIPLLVV
D2S6F0_GEOOG          --------------------AGSG--T--VIALTAQDYIGFALSLLVAFGVSFEVPLVAV
C6WIE9_ACTMD          --------------------GDNK--F--LTALSGTAYIDFVLALLIIFGVSFELPLVVV
C8XAP1_NAKMY          --------------------GGEA--T--ITALTPDSYFSFLIAMLIIFGVSFELPLLLI
B1VDV8_CORU7          --------------------GDEA--Q--ITALKGSEYFSFVLILLLVFGVSFELPLFTV
D5UPM4_TSUPD          --------------------GNET--Q--VTALQGPQYFSFVLTVMAIFGVSFELPLFII
TATC_MYCTU            --------------------GSDV--Q--VTALSGDRYFGFLLNLLVVFGVSFEFPLLIV
Q0SIG7_RHOJR          --------------------GDNV--Q--ITALGGAEYFGFIINLLIIFGVSFEIPLLIV
F6EP00_HOYSD          --------------------GDNV--Q--VTALSGQEYFGFIIRLIIIFGVSFELPLLIV
TATC_CORK4            --------------------GDST--Q--ISALTGEKYFNFVIALILVFGLSFEVPLFTA
Q8NQE5_CORGL          --------------------GGDT--Q--AAALTGDKYFGFLLALLAIFGVSFEVPLVIG
C7PVW6_CATAD          --------------------TPKG--V--SNILPLDTFINFFLRMVLIFGVSFEIPLIVV
G2P670_STRV4          --------------------TPEG--A--NNLLPLDDFLDLLSRMVLVFGLAFELPLLLI
B1W318_STRGG          --------------------SPDD--V--QNQIGLDSYLDLLVRMVIVFGLAFELPLLLI
D2Q3I8_KRIFD          --------------------TPDF--A--QNLITLPEYLDFVLRTMLVFGIAFLLPLVVV
A1SK21_NOCSJ          --------------------TPAG--L--DNLVEFGDYFSFLTRMLLVFGIAFEIPLFVV
Q2G128_STAA8          -------------------SLTLN--I--SPVIGFKAYLIELIRWLFTFGLLFQLPILFM
D5SQP1_PLAL2          -------------------NARLG--I--NPQIRISEWISFAVSFPLMFGISFQLPLVMM
E8R5A8_ISOPI          -------------------NVWLG--V--EPSLRLSDWMGFATLLPLVFGICFQTPLVML
Q6AN67_DESPS          --------------------TSEA--M--RPLPKLGLYLTFVGRTILTFGIAFQIPFLML
D6Z4B1_DESAT          --------------------ATEQ--I--HPHLKLAPYLNFVVRSSLAFGLAFELPFLMV
B1HXK1_LYSSC          --------------------GATN--F--DVMVSASEYMHFLIMTTVPLGLLFELPIVAL
D6XUT8_BACIE          --------------------GQGT--F--QTMFTADKYFQFVLRMTLPFSILFEMPLVVM
Q8EQG3_OCEIH          --------------------NEDM--F--NIMFTVDRYFTFLMKITLPFAFLFELPLIAM
D5WSC2_KYRT2          --------------------GAEQ--F--NVQITAGNYFGFMINLIVPLGLVFELPLVTM
C5D4F0_GEOSW          -------------------ASRLG--I--HQVIGINEYFEFLLHLILPFGIVFQLPVVVM
Q5WJP1_BACSK          -------------------ADRLE--I--NEMYGINEYFSFLFQLTIPFGLLFQLPVVVM
TATC_BACHD            -------------------AERLH--I--NELYGINEYFTFLFQITMPFGVLFQLPVVVM
C0ZK48_BREBN          -------------------TASMG--A--DPNYGIAQYFGFMFNMVIPFGILFQLPIIVM
E3EID4_PAEPS          -------------------TKSMG--L--QETYGIAQYFTFMFNIVLPVALLFELPLLIM
C6CVH0_PAESJ          -------------------SANLN--L--EETIGITQYFSFMFNILIPISLLFELPLVIM
D8K211_DEHLB          --------------------GSET--I--QVMPCVSNYIDVVLRLLVGIGLAFELPIILA
E6SMD5_THEM7          --------------------NAGP--I--QRTLSVQAYVDFVTGMVWPFGFIFELPVVVG
E8N519_ANATU          ----------------------LG--V--QSFIRLSNYINFVTNLMFWIGVSFETPLIVF
A5URY8_ROSS1          ------------------GVDGTT--I--ITQPRVDSFIGTVATLLLWNGLIFQLPAIVY
B9L0C4_THERP          --------------------GGSV--F--EAQFRAEEVVSFYMTLLLWVGVVFELPVVIF
D1CCN1_THET1          --------------------GSED--I--ATMPRFADYIGFVSNLLLWVGLSFETPVIVY
C7LYQ4_ACIFD          -------------------AAGAQ--V--HAIYTPQSYLSLLLILMIAFGVAFLFPVVLV
Q7UFI8_RHOBA          -------------------NGSMD--V--AVEPRLTYYVNFVLMLPLGFGVAFQLPLVML
B3E195_METI4          -------------------NKWMG--V--QTDWTLQNYSNFVVQMLISFGLAFELPLVVI
Q1AUL3_RUBXD          --------------------DPER--Y--NALITSDRYMAFVTRFLLAFGIVFELPAATY
Q7U568_SYNPX          --------------------GADV--V--EPLWSIERYLDFVLLLMLATGLAFQLPVLQL
TATC_ORYSJ            --------------------ADGA--V--ESLWSIDQYFEFVLVLLFSTGLSFQVPVIQL
TATC_MAIZE            --------------------ADGA--V--ESLWSIDQYFEFILVLMFSTGLSFQVPVIQL
K3XJC3_SETIT          --------------------ADGA--V--ESLWSIDQYFEFVLVLMFSTGLSFQVPVIQL
Q114K5_TRIEI          --------------------GLEA--V--EQAWSIEKYFEFVLLLMFSTALAFQVPILQL
B0CFY2_ACAM1          --------------------GGDV--V--EQLWSIDRYFEFVLLLLFSTGIAFQIPVIQL
E0UC67_GLOV7          --------------------GADL--V--EQSWSIDKYFEFVLLLLFSTGLAFQIPVIQL
C1A4F6_GEMAT          --------------------ESES--V--NTMQTVDGYMSFVTAMCLAFGAIFELPVVIA
B3E7M3_GEOLS          --------------------EVEG--L--QSWFNISAYINFCLRLILIFGLIFELPVLTL
E1X470_HALMS          --------------------GVSN--V--KATISLKEYLVLASKVLVFLGIIFQLPNLLL
A9EPV7_SORC5          ----------------AGTVGGDGVTI--TPTVMMGDYLDFVAQLLLGFGIIFEIPLIVL
Q67QH4_SYMTH          -------------------AQASL--V--EVAVTPSNYLSFILSICNPLGIAFELPLVVL
A9KHC2_LACP7          -------------------SSGAL--A--KPMISIESYVGFMIRFMIPFGITFELPLVIL
J9ZE06_LEPFM          -------------------GQKEG--L--QAFMSVDRTVAFELRFLFVFGLIFELPLLMA
Q023M6_SOLUE          -------------------GQGNH--V--VAMVSITEYFNLFVNVTLGVGLVFELPVIIF
TATC_DEIRA            --------------------LAGT--V--TQMQDLQEYIGTVVTFLVAFGVAFELPILAV
D7BE12_MEISD          --------------------LGDV--V--TPQISIGMYMGQVLTFMGLMGLLFEMPVVSY
D7CQR8_TRURR          --------------------LVGE--V--QLLPGIGDYISKILVYMAVFGLIFEMPVVSF
A5EVU4_DICNV          --------------------ELEG--V--AFMPDITSYLSLSIAIFLAFGVTFEVPIITV
Q9PFU5_XYLFA          --------------------KPDV--I--QLTPDAGAYLDFVLAIFFAFGASFELPVAMV
Q1H3X3_METFK          --------------------APEG--V--AVMTEIGSYLDFLVSIMLAFGISFQTPIIVV
A9BXA9_DELAS          --------------------TPDS--V--AATPDIASYVEAILSLYLAFGLAFQVPIVVM
A1AVV9_RUTMC          --------------------APNI--V--DLTPDIQYYLDFVLKVSFAFGVAFEVPIATI
TATC_HALNC            --------------------GPSD--V--NFAPDIGEYLSFVTSLFFAFGFVFEVPVAIV
Q47AM9_DECAR          --------------------APKS--I--TPAPDIEAYLSFVMTMFLAFGIAFEVPVALV
E5APW1_PARRH          -------------------NAPLG--A--EMSTDIDNYLSFVLTMFIAFGVTFEVPIVVV
Q2YAV6_NITMU          --------------------APEG--V--AVMTDISKYLDFVLTMFIAFGITFEVPIFVV
Q31E59_HYDCU          --------------------APEG--V--TIATDISLYLDFVIKMFFAFGIAFEVPIVVV
Q48AI0_COLP3          --------------------APEG--V--VIATDISSYLDFILKLFFAFGAAFEIPIAII
G4QJK5_GLANF          --------------------APDD--V--LISPDISEYLSFVLKIFFAFGVAFEIPVAII
D3SCC9_THISK          --------------------APEG--V--SVMTDISRYLSFVIMLFIAFGIAFEVPVATI
H8GJD2_METAL          --------------------APAG--V--TVMTDISHYLDFVLTLFFAFGICFEVPIFTV
K0C6J4_CYCSP          --------------------APEG--V--AVMTDISKYLDFILTLFFAFGMAFQVPIATF
D3RQL8_ALLVD          --------------------TPDG--V--AMMTDISAYLDFVLTLFFAFGVAFEIPIATI
I3YA58_THIV6          --------------------TPEG--V--AMMTDIAAYLDFVLALFFAFGLAFEIPVATI
F6A8L5_PSEF1          --------------------TPEG--V--SMMTDIASYLDFVMTLFFAFGVAFEIPVAVV
TATC_HAEIN            --------------------APEG--V--TIATDISSYLDFALALFLAFGVCFEVPIAII
TATC_ECOLI            --------------------APEG--V--QVSTDIASYLSFVMALFMAFGVSFEVPVAIV
H2IVX2_RAHAC          --------------------APAG--V--QIATDINNYLDFVMALFMAFGVSFEVPIAIV
D1BNH6_VEIPT          --------------------ATDE--L--QPMFSIGQYMDFVLSFVLPFGFIFELPLILI
A8MIP1_ALKOO          --------------------TVNG--I--EPLFSFANYISYISSILISFGVVFELPLIVI
E1R121_SEDSS          --------------------STPE--I--TAMFSFGNYIGFISSIMIAFGVAFELPIVVV
D2RIN1_ACIFV          --------------------TSPA--V--QPLLSLESYLDFMVMLVLPFGVLFNLPLALL
C6XIZ5_HIRBI          ----------------------EG--V--TFLPKAKPYVDLSISLITAFGLAFQTPVIMS
A0A0H3LXY3_BARHE      --------------------LPDV-HLRIEFIVRISDYLSFMTSFILIFGLIFQLPLVTS
E0TEC0_PARBH          -------------ESPAEAAGRAN--F--SLLVFVGDYLNLALTLIVGFGFAFQLPVVLT
Q28T34_JANSC          PALANLIAGDGTFENPETDGELQT-----IFLGSVKESLDLALKFIFAFGLCFQLPVLLT
TATC_RHOCB            --------QMGDVVAGADASDPANQMAVIGFTGSMEEYLKLTTKFVMAFGICFQMPVALT
A1B0H6_PARDP          ----QQGPLALPDDPAAAEQNPHLAGI--VFQGSVSEYLTLTTKFILAFGLSFQLPVALT
Q0AND8_MARMM          ---------------QEQSAELVGTRI--ELLLNVSDYMNLITTLMLVFGISFQMPVFLM
Q2GER9_NEOSM          ---------------EYDGSKPGTLPI--EFMPSVSEYLDLVVQFMFAFGIAFQLPAILT
B3PIX7_CELJU          ----------------ETTGLDGNMPV--QLEARVSEYLGLVIQLILAFGLSFELPVILL
Q0C0W0_HYPNA          ---------------EQVDAAQTT--I--KMMPRVSDYLALVMSLMLAFGISFQLPVILT
Q3SRQ3_NITWN          ----------------QQMAGPETAEI--QLLPKVGEFLSLTMSLIFAFGIAFQLPVILT
B9JXD9_AGRVS          ------------------QQAPGEGDVAISLMPKVSEYLSLIMSLVFAFGLVFQLPVVTT
Q98LC7_RHILO          ----------------QQAGTDDQVQI--SLLPKVSEYLSLIMTLIFSFGLVFQLPVVTS
D9QLG6_BRESC          --------------------SSEGITV--LLTTKISDYLNLVTSLILAFGLCFQLPVVTT
B0T1Q5_CAUSK          --------------------STAGISI--QLLPKVSDYLTLVTTLLLAFGLCFQLPVVVS
C7JE44_ACEP3          ---------------QTAGAGHDGVQI--ELQAKVSEYLSLVMKLIMAFGVAFELPVVLT
Q2G9D2_NOVAD          ------------------EGNKGGLQL--EALPGTGDYLSLVMQFILAFGISFLLPVLLM
TATC_MAGMM            --------------------QSST--I--EALPSMREYLSLVIKLIIAFGITFELPVGLL
D5BQU2_PUNMI          ----------------EMAASEGALAI--EVEPRISEYLSLVMRLIFAFGLAFELPVVLL
I3TKT9_TISMK          ----------------QTTGSETSMAI--ELEAKVDQYLSLVLALIFAFGLAFQLPVALS
Q2RTH4_RHORT          ----------------QTTREQTVLPI--QLEAKVGEYLGLVMKLILAFGFSFQMPVALT
Q6MGQ9_BDEBA          --------------------GGEV--D--KPMISIDQYMGFFTQMCLMFGVAFELPLVIV
B2A204_NATTJ          --------------------ARED--L--LPMITVRSYVSFALGLLLPFGLVFQLPLIVT
A5D1I5_PELTS          -------------------AGPEL-----VPMLTIDKYISFTITFLLPFGLVFELPLISF
B0TFS8_HELMI          ---------------------GDF-----TPMISISEYLSFALWFILPFGLVFQMPLVLM
D5X7P7_THEPJ          --------------------GGDG--L--EPMLSLSKYLSFAFWFLLPFGLIFEMPLVIL
B8D1R3_HALOH          --------------------ATDS--L--NPMFSLGKFISFVTGVMIPFGLIFQMPIIII
Q0AZ46_SYNWW          -------------------MQGPS--L--ENMFTVERYVSFVTAFTIPFGLVFELPVVVF
TATC_CARHZ            --------------------GGDI--M--SPMITIGKYISFALNFLIPFGLVFELPVVVY
TATC_KORVE            --------------------SHQF-----SPMITISEYTDLFLTIILGLGIVFEMPILVF
C1F555_ACIC5          --------------------SKEF-----KPLIEINEYTSLFLTVILGLGVTFELPIVVL
E8X125_GRATM          ---------------------GKG--F--QPIITIEDYTGFFLAIILGLGITFELPILIF
I3ZCY6_TERRK          ---------------------GHR--F--HPIITIEDYNSFFLSIIFGLGITFELPIIIF
D0LGH0_HALO1          LAEMAELTGAGAGAGAGAGAAPVG--L--KPLLTIQEYLSLARRLILAFGLVFELPLLIS
Q2IM06_ANADE          -------------------AESDT--L--SPMLSLSEQLSLVLAMLLGFGVVFEVPVVIA
A7H6D7_ANADF          -------------------AADAS--L--APMLTMSSTLGLVLAMLLGFGVVFEVPVILA
B2V5Y3_SULSY          ------------------GNIQLG--A--EAIFSVKEYISFVLRMILAFGLTFELPVILS
TATC_PELCD            ------------------GTEVGN--I--SAMLSMGAYLSLSCRLLLAFGLVFELPILIF
F2LUZ5_HIPMA          --------------------GGKD--L--SAMPSIKQYMSLFLKMITSFGLVFELPIISF
D3UFV2_HELM1          --------------------GNDE--F--TANITAANYITFFTRFVLGFGIAFELPVLAF
B9LA52_NAUPA          --------------------GGKD--F--VAMLKISEYVSVALKIMIGFGIAFELPVVTY
E6X1G9_NITSE          --------------------GSFL--Y--TPLINIEDYVGFFTKILIGFGIAFELPVVAY
TATC_CAMJE            -------------------GLNED--F--NPVITIGTYVDFFTKVVVAFGLAFEMPVIAF
A0A5B9TTD1_SULMU      --------------------GSAL--F--TALPSIGEYVGFFTKFLVGFGLSFEMPVVIF
A8Z6M5_CAMC1          --------------------GGQL--F--TALPSIGEYVGFFTKLLIGFGISFELPVITF
B5YKH3_THEYD          -------------------KVGDF--L--MPMLSVGLYIDFLLKFLLAFGLVFELPILIV
E6W513_DESIS          --------------------AEGS--V--IASLSLGWYLTFVVKLIMAFGIAFELPVIVF
E4TGB2_CALNY          --------------------ATDG--I--TANLSLTWYLSFVVKLMLGFGIVFELPVIVF
E6VUV0_PSEA9          --------------------STEG--I--QFTPKLNEYLSFCLKLLFAFGFVFELPLFIF
Q1MQT5_LAWIP          --------------------STDT--I--VAMPSLSNYLSFSLKMLVAFGLIFEMPLFAF
C8X1I2_DESRD          --------------------AEDL--I--RPMLTMREAFSFAMRLLIAFGVVFELPLVIF
C6BSE0_DESAD          --------------------ADEF--I--KPMPTLREYLGFSLKLLFAFGLIFELPLFIF
TATC_DESAH            --------------------SSDT--I--QAMPSMKEYLGFASKMLLAFGFVFELPLVLT
A9A055_DESOH          --------------------ATDN--I--QALPSMKEYLGFSAKLLLAFGLAFELPLVLT
C4XP92_DESMR          --------------------ASDY--I--TVMPTISAYFSLAVTLLFAFGVIFELPVFIF
Q2LXN7_SYNAS          --------------------SSDF--L--KPMVSMREYLSLALKFLLAFGLCFELPVFVF
                                                                             *    

I7CPH1_NATSJ          VLSYTEIVPYETFRDKWRHAVVAIVIFGALFSP--PDPFTQVMWAMPMVVLYVFSLGLSK
TATCT_HALVD           GLSYAEVVPYELFRDKWRHAIVGIFAFGALFTP--PDPFTQIMWAVPVILLYAFSLYLAR
M1XZE0_NATM8          TLSYTGIVPYETFRDKWKYAVIAIFVFGALFSP--PDPFTQIMWAVPLVVLYGASLYLSK
D3S1J6_FERPA          FLVKNGIVDLSTFKYYRRHFYVVFFVIGAVITP--PDVFTQLMVALPMILFFEISLAVVS
Q0W4Y5_METAR          VLARARIVPAWVFRKYRRHMYIVILIVAALVTS--PDVLTQIMVGIPLIIFYELSLLILR
Q97ZU3_SACS2          GLTGVGVVKSITWLKNWRWGVLVSFIIAWIISPGTTGGIIETVIGITLSTLYFIGALISK
A8MCQ5_CALMQ          ILTRFRIVKASTWRQYWRWGVLASFLFALIISPGTTGGVIETTIGLTMSALYIVGMLTSM
TATC_CENSY            AVTASGMVDGRFWRRNIRYALLGIVIFGAAITP-DGSGVTMWFVAGPMIGLYFAGMFFAE
Q6KZY6_PICTO          GLTRFGIVTYEQWAANWRYAVIGAFIFGMIFSP-GVTGFTMIILAVPIIALYFAGLYISK
D3SVL3_NATMM          LAIMMGVTTRRWLVDKRLYFWAAFFGLAFMFTF-DPTAMAPILVGITMILLFEGTLLILK
Q9HN36_HALSA          LAIMLGVTTREWLESRRLLFWGAFAGIAFTFSAIDPTGIVPVIVAITMVVLFEGTLALLR
M1XNN2_NATM8          LAIMMGLTTRAWLAAKRLYFWGAFLGIAFLFSP-DPTGMAPILVAGTMIGLFEATLFALR
Q8TKC1_METAC          FAVKLGLVKYQTLKKQRLLVYSAIVTLSLFLSP-DPTFIAQILVALLLAVLFEFSLLLVR
TATC_METAR            LAIKMGLVKRETLVKGRLGVYGLLFGVAMFFSP-DPTLFSQLIVLAVLAILFEVSMVLTR
F8A8M8_THEID          LLVKVGVLPAYGGKRRVLYLLGVAYALGLFLSP--GDIVAQIIIASCFYLLLESGYLLSK
C7N7W2_SLAHD          YLVVFEIIPYAKLREQWRTVYIVLMVISAMVTL-DASPVTMLLMFAALLMLYEVSLLIAR
E1QWP7_OLSUV          YLSILHIVPYKVFREQWRYVYVGLMILSGVVTP-DASPVTMILMFAALIALYEVALAVAR
E3HCZ3_ILYPC          LLMAFNIVKRKTALAASRYIIVFIFIISAVVTP--PDVVSQVGLALPLVILYFLAILVAK
B3QTN4_CHLT3          VLSKMGILTPAFMRFYRKHAIVAMIIIAAIVTP-STDAITQMVIAVPMILLYELSIWISA
A6LCU1_PARD8          LLSQIGLLNRSFFHKYRRHAVVGLLVGAAFITP-SSDPFTLSIVFLPLYGLYELSAFFVK
A6L6V5_BACV8          LFAKLGFLTADFMKRYRRHAIVIILIVGAVITP-TSDVFTLMMVSVPMYLLYEVSIWIVS
C6X0T6_FLAB3          FLTSIGILTPTFMRTYRRHAIVLIMVVAAIITP--ADVLSMLMAAFPLLLLYEFSIMMCA
C7PMH2_CHIPD          FLTKIGFITPTFLRTYRRHAIVVILVLAAVITP--PDVIDQLIVFTPLYLLYEISIYISG
C6XV03_PEDHD          ILSKFGIMTPKFMRSTRRYAAVIILIVAAVVTP-TADVMTMLVVAFPLFVLYELSIFISA
G2Z214_FLABF          FLTKLGLVTAASLREYRRYAIVIILIVAAIITP--PDILSQIIVSIPLLVLYEASILIAI
G8R5N0_OWEHD          FLAKLGLLTPEWMRTYRKHAFVVILILSAIITP--PDISSQVLVCLPIVGLYEISIKICA
A3UAJ3_CROAH          FLTKIGLVTPEFLKTYRKYALVIILVISAVITP--PDIASQVIVAIPVLILYEVSIVIAK
A0A6N4SQV5_CYTH3      FLAMAGILTPEFMRKYRRVAIILVFIIAGIITP-SPDIMSQLIVAIPIYLLYEISIYTAA
C6VXQ9_DYAFD          VLSKIGILTPAFMREYRKHSMIVILIVAAIITP-SPDIYSQILVAIPLFLLYEISIMVSA
C8WRE5_ALIAD          CGSAVGLITPSALRAKRKYAYFALVVVGVLISP--PELIAHLTVTVPLFALYEASVAIAS
D5EP26_CORAD          ILVYLGVLTTEKLKSIRRGVFVGIMVLAAFLSP-GGDFISLPLTTGFMYALYECAIWLGG
B1ZP28_OPITP          ILVKLGLVTHQQLAHYRRHVIVLTLIVGALLTT--PEVITQVAMAVPLYLLYEISILIAR
D6Z185_DESAT          FGAKTGLCPRRKFESGRGYAVLIITIVAALITP-TPDVVNLSFMAVPMYLLYESGIIIIK
TATC_AKKM8            PFVKLGVLTYDMMKSTRRYAIVAIAVLAAVITP-TPDVATMMLMAVPMYALYEICIILAW
D6ZGM8_MOBCV          MLNFLGVLKARTMLKGWRWATMVAFIFSAIANP-LPTPWPVILQASALLALYFLAVGIAA
E8N7E5_MICTS          VLNLAGVLPARTLARSWRYALVGIVVFSALATP-SADVLSMFLVAVPMSGLFAAALAVAA
C7MCX3_BRAFD          LLNFMGLVRGRTMLKGWRWIIFISFVFTAVMVP-TPEPITLIVMASAIAGLFFGAIAIAM
C7NHS2_KYTSD          AINHAGLLSGRVMLKGWRWATVGVLVFAAMAAP---DPMSMVTLTIPMMLMYFVACGIAM
E6SAM0_INTC7          CFNIIGLLTGRAMLKAWRPAVMVIFVFAAVMTP-TPDAFTMLFMASPMIVLYFASVGVAF
TATC_XYLCX            ALNLAGIVRHETLARGWRWAVLLAFVFAAVMTP-TPDALTMVLVAAPICALYFGALGVAV
A6W980_KINRD          GLNFAHLLSGRAVLRQWRISVFLSFLFSALVTP-TSDITTMLLLACPLLVLFALATVICI
TATC_ROTMD            GINMLGLIRGKTILKSWRWVVVLVAVIAALTAP-GSDIMMMFVLMAPLLIFFFAAIGICM
C5CBV5_MICLC          GLNMLGVLPGRTIVKHWRITVFIVMLVAAIAAP-GSDAISMFYMAVPLVILFGVAIILCL
E1VW56_GLUAR          GLNLVGILPAKLILKHWRITVFLIALVAAMAAP-GGDAITMFALAGPLFLTFAAATLICH
A9WSH2_RENSM          GVNMAGVLRGKTMFKSWRITVLAVTIVSAMAAP-GNDAFTMFLLAGPLLVLYFGAMSLCV
B2GIN3_KOCRD          GLNMMGLLSGRAVLKSWRVVVVVVLVVAAMAAP-GPDPVTMLYLAIPLLVLFFVAVGLCL
D3Q548_STANL          LLNVIGIASAKRLLGWWRIATFLVFLFCAIVTP-TPDPFGMIALAIPMVMLYFAAVGFAF
D7GEA7_PROFC          TLNRFGIISGAGLGKFRSMAIFLCFLFSAVATP-STDPISMCVLAVPMSFLYVIAEVLCK
TATC_FRACC            MLNLAGIVSTAKLRSWRRPEIFLVFVFAAVVTP-SQDPFTMLALGLPMVLLYEVALIIGW
D2ATT8_STRRD          FLNVIGVLPRATVAKHRRMVIFIMFLFAALATP-STDPFSMIALAIPMVVLFALAEGFMY
Q47P16_THEFY          LLNFMGVLSHRIIGKWRSIIIFLIFLFAAVATP-GGDPFTMLALGIPMVALFETAELIAF
A0LU67_ACIC1          LLNRIGILSYRRLAKSRRISYFLAFVFSAVVTP-SGDPFTMLALGVPLVVLLETATQIAR
D2S6F0_GEOOG          ALNLVGVLSYEVLRGARRWIFFLTIVFAAFVTP-TQDPFTMLLMAGPMIVLFELAIQVAR
C6WIE9_ACTMD          MLNAVGILPYEKLKRWRRGLVFGLFVFAAFATP-GTDPISMVALAISLALLFEMATQIAR
C8XAP1_NAKMY          MLNRIGVVSGAKLAAWRRYALFGLTVFAGLVVP-GNDPITMLALAVSLALLYELSVQVAK
B1VDV8_CORU7          LLSFAGLLRYDSIKTKRRYIIVGLFAFAAFVTP--ADPFSMLALGCALTLMMEIAYVIIR
D5UPM4_TSUPD          ALNLVGVLPYTKLKKWRRGLLLSMFIFSAVITP-SGDPFTMLALGAALAVLLELSIQFAR
TATC_MYCTU            MLNLAGLLTYERLKSWRRGLIFAMFVFAAIFTP-GSDPFSMTALGAALTVLLELAIQIAR
Q0SIG7_RHOJR          ALNFVGILPYAKLKAWRRGLIFALFVFAAIATP-GQDPFSMLALAFALTLLFEVAVQIAR
F6EP00_HOYSD          MLNRVGVLPYAKLKAWRRGLIFSLFVFAAIVTP--HDPFSMLALALVLTVLFEAAVQASR
TATC_CORK4            MLNLAGVVHYEQLKDKRRIMIVVIFIFAAIATP-GQDPISMLVLALTLVVLMELALQFTR
Q8NQE5_CORGL          MLNIVGILPYDAIKDKRRMIIMILFVFAAFMTP-GQDPFTMLVLALSLTVLVELALQFCR
C7PVW6_CATAD          ALNFAGVLSAERLKKSWRYVTFAIFVFAAGAVP-TGEPLGMTALAAPMCLLYYAAIGIAV
G2P670_STRV4          LLNFTGILTGRRMLGWWRAMIMGITVFGAIATP-STDPIGMFALAGPVTVLYFGAVGVAL
B1W318_STRGG          ALNMTGLVTGKRMLTWWRGMVVGLTAFAAIATP-GGEPISMLLLAGPLAVLYFIAVGFSL
D2Q3I8_KRIFD          LLNIVGLVPAAALAKFRPYIVLGIFVFGAVATP-SGDPFSLMFLALPMCALFFAAEVIAR
A1SK21_NOCSJ          MLNLAGVVSGKTLGRYRPWIILGTFVFAAVATP-STDPFSMTMLAIPMLLLFFVAEVIAR
Q2G128_STAA8          GLAKFGLIDTTSLKHYRKYIYFACFVLASIIAP--PDLTLNILLTLPLILLFEFSMFIVK
D5SQP1_PLAL2          FLAKINVVTPKMFREQRRMAILVIAIASMLLTP-SGDPASMILMMAPLLVLYELGIYLCK
E8R5A8_ISOPI          FLARIGVFTAEQYRSKRKFAILIMVVVAALLTP-DPTVTSQLLLAAPMICLYEVGIMLVE
Q6AN67_DESPS          MAGKANLVQARYFRQKRMYFYIAIITLSFLLCA--GDLMASALLSGPLFLLYESGIFLSA
D6Z4B1_DESAT          MATRLELVSADYFVRYRTWSYIGMIIISLLLVA--GDPVAAFMLAVPLCLLYEAGILIGK
B1HXK1_LYSSC          FLSAIGVLSAESMRKIRGWSYIVMGICSAVITP--PDFISQLLVLIPMIILYEISIYLVK
D6XUT8_BACIE          FLTSIGVITPAGMRKNRKYAYFALIVLSVLISP--PDFVSDVLVIVPLLFLYEISINMSV
Q8EQG3_OCEIH          FLTSLGIVTPDFMTKNRKYAYFVLIVIGVIITP--PDFILQIVVAVPLMVIYEISIYLSK
D5WSC2_KYRT2          FLTRLGIVTPATLGKMRKYAYLVLVIIGAMITP--PDFVSHLSVTIPMILLYELSVTVSK
C5D4F0_GEOSW          FLTRLGLITPMLLIKVRKYAYLALLILAAVITP--PDVLSQVIVMIPLSILYEVSIWISK
Q5WJP1_BACSK          FLTRLGVVTPAFLRKIRKYAYFALLVIAGIITP--PELTSHLFVTVPMLILYEISITISA
TATC_BACHD            FLTRLGIVTPEFLRSVRKYAFFVLLVVAGFITP--PELISHLMVTVPLLLLYEFSIWVSH
C0ZK48_BREBN          FLTRLRILNPMRLAKARRYAYFALAVVGITLTP--PEIVSDILVTIPLLLLYELSIWLSR
E3EID4_PAEPS          FLTGIRVLTPMRLRKWRKISYFLLVFVAVVITP--PDFISDFLVAIPLLVLYEASVYLSS
C6CVH0_PAESJ          FLTAIRILNPVRLRKMRRIAYFLMIFIGVVVTP--PDFVSDSLVAIPLIILYEISVLLSG
D8K211_DEHLB          ALSAVGIVTSKWLASKRKIWFVLAFILAAFITP-TMDPINQMIVAGPLIVLYEVSIWLTK
E6SMD5_THEM7          LLTEIGLLTPPFMAHLRKYALLVALVAAAFLTP-TTDAITLLIFTAPLAGLYEVGYVLCW
E8N519_ANATU          VLAKFKIVNSRMLLAQWRYAIVIIAVIAAMITP-TVDPVNMGLLMAPLFALYLLSVFFAR
A5URY8_ROSS1          VMARLGVVTAARLASTRRYAIVIIFIIAAFITP-TGDPYNLLLLAIPMYLLYELGIILAR
B9L0C4_THERP          ILAKLGIVSAKRLASLRKFAILIIAVAAALITP-TPDPFNMFLVAAPMYLLYELGVLLAR
D1CCN1_THET1          VLIKANIVSVQKLTKLRKYAFVVILIAAAIITP-TPDPMNMMIVATPMYLLYELGILMGR
C7LYQ4_ACIFD          GLELAGVVSPAALRRHRRPAWLGIIVVVAILIP-SNDPYSLTAMTVPLLVFYELSIVVGS
Q7UFI8_RHOBA          FLQRIDLIQTQDYINSWRVAVLVIFVISMIVTP--ADVTSMVALAVPLLFLYFLGIVMCA
B3E195_METI4          LLGILGILQSATLSRYRRHAIVIIVVAAACITP-TSDPLSLFLLAAPMYLLYECSLWVLK
Q1AUL3_RUBXD          VGAKLELVNAPLLRRYRRHAIVVNALLAAGLTP-GQDPFSMILMALPMILMYELSIIIAR
Q7U568_SYNPX          LLGVLGLVRWRTMLGAWRWVVLGSALAGAVLTP-STDPITMLLLAGAITALFLIGVGLVA
TATC_ORYSJ            LLGQVGLVSSDQMLSIWRYVVVGAVVAAAVLTP-STDPLTQMLLAGPLLGLYLGGAWMVK
TATC_MAIZE            LLGQLGLVSSDQMLSIWRYVVVGAVVAAAVLTP-STDPLTQMLLAGPLLGLYLGGAWMVK
K3XJC3_SETIT          LLGQVGLVSGDQMLSIWRYVVVGAVVAAAVLTP-STDPLTQMLLAGPLLGLYLGGAWMVK
Q114K5_TRIEI          LLGIVGIVNSQQMLSSWKYVLLGSVVLGAVLTP-STDPLTQSLLGGAVVALYLAGTFVVK
B0CFY2_ACAM1          LLGLTGIVSSRQMLSGWRYVILGAAILGAVLTP-STDPLTQSLLGGAVVGLYFGGIGLVI
E0UC67_GLOV7          ILGYLNIVSSAKMLSGWRYVILAGVILGAVLTP-STDPLTQSLLAGAVLGLYFGGIGMVK
C1A4F6_GEMAT          LLSALGIVQPEYLSRFRRHAVVGCLIAAALITP-GSDPTSLLLLTIPLYMLYEASITVSR
B3E7M3_GEOLS          LLSRFGIVSYKMLAPKRKYALLASSIIAAFH----ADLITMFVIMIPMYLMYEISIWVAL
E1X470_HALMS          ILGFMGLVTKYSLRSVRSYVYVGFAALSAVLTP--PDVITMLGLWLPLTVLFEVGILAVA
A9EPV7_SORC5          FLSIAGIVNYIQLILFGRWFVFGAFVLAAVLTP--PDITSQLVMAVPMCLLYVLSIGLAY
Q67QH4_SYMTH          ILARIGLVTHQFLGRVRKYAFLALMILAAVLSP--PDVISMMIFLVPLYGLYEFSIILAR
A9KHC2_LACP7          ILTKLQIVKLSQLMKSQKYVILLLFVLAAILTP--PDVISQIMLGLPLTLLYEIGVLGAA
J9ZE06_LEPFM          LASARGWITPEKFRKGRRWALVGNAVAASILSP-TQDFLNMMIMFVPLVILYEAGILFSL
Q023M6_SOLUE          LLILLRIVTPTFLINHSRYAILAIFILAAIVTP-TPDVFNLMLFATPMCLLFYIGIFAGY
TATC_DEIRA            ILTRLGIVNHTMLRQGWRFALIGIMILAAVITP-TPDPANMALVAVPLYALYELGVVLSR
D7BE12_MEISD          LLARLGFLTSRFLISNWRIAIVLLVTLAAVITP-TVDVVNLSLVALPLLLLYWISIFLVK
D7CQR8_TRURR          LFARLGLLRAPLLQHYRRYAIVISFVAAALITP-TADPINLLLVALPLVILYEVSILVVR
A5EVU4_DICNV          ILIRLGVVEIETLTRQRPYIVLIAFTIGMFLTP--PDVFSQTLLAVPMLILFEIGIIFAK
Q9PFU5_XYLFA          ILTVLHWVKPTQLRESRGYAIVAIFIFAAVLTP--PDVVSQLMLAIPMCLLYELGIVAAW
Q1H3X3_METFK          AIAALGIVELKTLREIRGYVVVGAFVVGAIFTP--PDIISQFMLAIPLWLLYELGVFIAM
A9BXA9_DELAS          LLVRFGLVDIAKLKSFRGYFIVVAFIIAAVVTP--PDVISQLALAVPMCILYEIGILGAG
A1AVV9_RUTMC          LLIMFGITTVDKLKSNRPYAIIGAFILGMLLTP--PDIISQTLIAIPMWLLFETGLIFAP
TATC_HALNC            LLVIVGVVTPDKLAGFRRYAILIAFIIAAILTP--PDVLSQFMMALPIIMLYEFGLFVSR
Q47AM9_DECAR          VLVKLGVVSVEKLKEWRSYFIVGAFIVAAVVTP--PDVVSQLALAIPMCLLYELGILAAR
E5APW1_PARRH          LLAKLNMVTVNKLKEVRPYVIVGAFVVSAIVTP--PDVFSQLILAVPLLVLYELGIIAAR
Q2YAV6_NITMU          ILVRIGLVTIEKLKAMRRYVLVGAFVVGAIFTP--PDVVSQFMLAVPLYLLYELGILAAG
Q31E59_HYDCU          LLILTRMASPQKLSHARPYVVVGAFVIGMLLTP--PDIVSQTLLAIPMWLLYEAGIIVGS
Q48AI0_COLP3          LMCWTGMTTPDSLREKRPYVVVGAFVIGMLLTP--PDIISQTMLAVPMLILFEVGIIIAS
G4QJK5_GLANF          LMCWTGMTTPDQLRAKRSHVIVAAFVVGMLLTP--PDVISQVLLAIPMWFLFEVGVVVGG
D3SCC9_THISK          LLVSLGATTPDKLAKKRPYVIVGVFLIGMVLTP--PDIISQTLLALPMWLLFEIGLILSR
H8GJD2_METAL          VLVWAGLVTPRNLAEQRPYVIVGAFVIGMVLTP--PDVISQTLLAVPMWLLFEAGLLCSR
K0C6J4_CYCSP          LLVKTGVSTPQSLAEKRPYIIVGAFVIGMLLTP--PDIISQTLLALPMWLLFEIGLLMSK
D3RQL8_ALLVD          LLVAIGAVTPEGLAHKRPYVIVGAFVVGMFLTP--PDVISQTLLAVPMWLLFELGILLSR
I3YA58_THIV6          LLVAVGAVTPETLVQKRPYVIVGAFIIGMLLTP--PDVISQTMLALPMWLLFELGIIFSR
F6A8L5_PSEF1          LLIWIGVVDVEYLRKIRPYVIIGCFVVGMILTP--PDIFSQTLLAVPMWLLFELGILAGS
TATC_HAEIN            LLCWTGITTVKALSEKRPYIIVAAFFIGMLLTP--PDVFSQTLLAIPMCLLFELGLLVAR
TATC_ECOLI            LLCWMGITSPEDLRKKRPYVLVGAFVVGMLLTP--PDVFSQTLLAIPMYCLFEIGVFFSR
H2IVX2_RAHAC          LLCWSGVTTPEDLKKKRPYVLVGAFVVGMLLTP--PDVFSQTLLAIPMYLLFEIGVFFAR
D1BNH6_VEIPT          ILGYFNLITSRFLKTKRKIFILISFIIGAVISP-TPDMFSQTMIALPMILLYETSLFVLA
A8MIP1_ALKOO          LLTQLGLATPATFKKHRKMVILGIFVVSAILTP--PDVVSQSMMALPMIVLYEFSIVIAN
E1R121_SEDSS          ILTRVGLVNHKKLQQAAKYILLGIVVMAAILTP--PDVVSQILLAGPMFVLYELSVLLAM
D2RIN1_ACIFV          FLALAGLIRSEQLRKARRFVIFGSFVAAGILTP-TTDIVTQCLLAVPLILLYELSYGMIR
C6XIZ5_HIRBI          LLARAGVVQVSTLRASRKYAIFGIFLIAMFMTP--PDPFSQIALALPVYLLFELGIIAAA
A0A0H3LXY3_BARHE      LLMKVGLLTSHSLASKRKWAILISFIIAAIVTP--SDFFTMFAVALPTIALYEISILIAY
E0TEC0_PARBH          LLGRAGVVTPSWLRKNRRFAIVGIFLVAAFLTP--PDPVSQIALGVTIWVLYEISILMVV
Q28T34_JANSC          LMGKAGLVSSQGLADVRKWAVVGILTLAALVTP--PDVITQVILFTVVYGLYEISIQLVR
TATC_RHOCB            LLGKAGLVSAQALASVRKYAVVAMLTVSAIVTP--PDVMSQVIMFAVIYPLYEGSIFLVR
A1B0H6_PARDP          LMGKAGLVSSEGLGSVRRYAIVVILILAAIVTP--PDVISQIVLFTVIYGLYEVSIFLVR
Q0AND8_MARMM          LLAKAGILKAKTLLKGWRFAVVGIALFAAFATP--PDPISQIMLGGALLLLYFISIGGMH
Q2GER9_NEOSM          LLSHMGLIDHNLLLKKRRLSIVLIFIAAAVLTP--PDVLSQIGLAIPMLFLYELSIFSCR
B3PIX7_CELJU          LLAHTGALTADSLVKGRRYAIVGIYALAALITP--PDLISQIALGTPILLLYEVSIWLIR
Q0C0W0_HYPNA          LLAKIGIVTSEGLGKGRKYAIVGILAFAAVFTP--PDAISQLLLAVPVYCLYEISIFCVR
Q3SRQ3_NITWN          LLGRIGVVTSKGLREKRRYFIVGAFVIAAVLTP--PDVLSQMSLALPLLLLYEGSILAVA
B9JXD9_AGRVS          LLARVGIIDSKWLAEKRKYFIVIAFIVAAVLTP--PDPMSQIGLALPTILLYEVSIYAAK
Q98LC7_RHILO          LMTRVGMLSSKALAEKRKWAIVIAFVVAAVLTP--PDPMSQIGLAIPTILLYEVAIWSAR
D9QLG6_BRESC          LLGMAGLISSKLMAEGRRYAIVAVVVLAAVVTP--PDPISQLMLAVPLVLLYEVSIWCVR
B0T1Q5_CAUSK          LLGMAGIVSSKLLREGRRYAIVGVFIAAAILTP--PDPISQMTLAIPMCLLYEISIWCVW
C7JE44_ACEP3          LLARVGIVTADMLRRFRRYAIVGAFVIAAILMP--PDVITQIGLAVPLVLLYEISIICAR
Q2G9D2_NOVAD          LLNRAGIVSREQLVKARRYAIVVIFAVATVATP--PDVVSQLMLAIPLLILFEGTLLIMR
TATC_MAGMM            LAIKAGVVSTAGLVDKRKYNIVLAFVAAAILTP--PDPFTQVMLAIPIMLMYEISIFFGR
D5BQU2_PUNMI          LLARAGLVTPEGLAEKRKIAIVIAFVAAAILTP--PDIISQVLLATPIIILYELSIFGAK
I3TKT9_TISMK          LLVRAGLVSAEALAKKRRFAIVIVFLAAAVMTP--PDLISQCSLAVPLLILYEISIFIAR
Q2RTH4_RHORT          LMARVGLVTSRGLAKARKYAIVAVFAGAAVITP--PDIMSQVMLAIPLLVLYELSIVAAR
Q6MGQ9_BDEBA          VLGMMGIVSQSFLRKNRRYAIMTIATIAAIITP--PDLLSMVMMLAPMWVLFEAAVLIVG
B2A204_NATTJ          ILSNLELITPEFLRTNRKIAVLITFVIGSFLTP--PDLISQGLLAGPLIILYESSIMVSK
A5D1I5_PELTS          ILARLELINYRFLAKNRRYALLIIVVAAAVLTP-TPDVITCLIVSGPMYLLYEASAWIVR
B0TFS8_HELMI          FLVRLGVVDHHFLARYRRYALLLMFVIAAIFTP-TPDVISQTLMAAPMYLLYEISIWIAR
D5X7P7_THEPJ          FLTRLGLVTPQFLAKNRRFALLIIFIISAVVTP-TTDMVSQFAMAGPMYVLYEISIWISR
B8D1R3_HALOH          PLVKLNLIDHKFLKKQRKYVLLIIFILAAILTP--PDVISQVMMALPLILLYEVSIIWAR
Q0AZ46_SYNWW          FLAKFGIIKAETLSKNRKYALLAIVVIAAALTP-GPDPISQMLMAGPVYFLYEVSIIVAK
TATC_CARHZ            ILAKLNIISHEFLVKNRKYALLVVFILAAALTP-GPDVISQLLMAAPLLILYEVSIFIAK
TATC_KORVE            FLALMGIVSAGWMWRNLRYSILVIFVIAAIITP-TTDIMNMCVFAAPMILLYILSIGVAF
C1F555_ACIC5          FLSLFGIVSPRFLWKNIRYAILIIFIIAAIITP-TPDVLTMCVFATPMLTLYLISIGVSF
E8X125_GRATM          FLSLFGIVDAKFLLKHIRYAVLIIFLITAIICP-LPDPISMCIFASPMLVLYGLGVVIAV
I3ZCY6_TERRK          FLALFGIVDGRFLVKHMRYAILIIFIIAAIICP-LPDPLSMCLFAAPMLVLYALSVGVAF
D0LGH0_HALO1          FLALIGAVTHRGLLKFNRWWIVLSFVISAMLTP--PDLFSQVLMAGPLVVLYNLSIGLAW
Q2IM06_ANADE          FLSMIGLVQWRTLAKYRRIAIIVNVIAAAIITP-TGDPLNLALMAVPMIVFYEVGIVLAR
A7H6D7_ANADF          FLSLIGVVSAQTLAKYRRVAIIVNVLVAAVITP-TGDPLNLAMMAVPMIVFYEIGILLAR
B2V5Y3_SULSY          LLARLGLVTPEFLMKSRPYFIVLAFIIAAIITP-TPDAISQLMLAIPLILFYEISILMAK
TATC_PELCD            FLTRMGIVDHFWLARRRRTALLLAFVVGAVLTP--PDIVSQLAIAGPFVVLYEVSIVVAR
F2LUZ5_HIPMA          ILARMGVINGKDLLKKFDYALLVIFFVAAILTP--PDVFTQFLMAAPLTLLYILSIIIAY
D3UFV2_HELM1          FLAKIDLITDQTLKRNFKYAIVGIFIIAAIITP--PDVLSQVLMALPLIFLYGLSILIVA
B9LA52_NAUPA          FLAKLGLVTDKTLKEFARYAIVIIFIVAAVLTP--PDLFSQMAMAAPLLLLYGLSILIAK
E6X1G9_NITSE          FLALLGLITDKTLKDYFKYAIVIIFLLAAFLTP--PDVLTQLLMAAPLILLYGLSILIVH
TATC_CAMJE            FFAKIGLIDDSFLKRHFRIAVLVIFVFSAFMTP--PDVLSQFLMAGPLCGLYGLSILIVQ
A0A5B9TTD1_SULMU      FFAKLGLVDDKGLKEFFRYAVVIIFVLAGILTP--PDVLSQFLMAGPLLILYGISIFVAK
A8Z6M5_CAMC1          FLAKIGLVDDKMLKDYFRYAVVVIFIFAAIVTP--PDVISQILMALPLIGLYGISIIVAK
B5YKH3_THEYD          ITTRMGLITPQTLKKYRRLAIVLAFVVAAIITP-TPDAFNQTLMAVPMIILYELGIWVSI
E6W513_DESIS          VLGRLGLVSAAAMRKGRKIAILVIFAGAAILTP--PDVVTQVMMAGPMILLYEGSIIIVR
E4TGB2_CALNY          FLAKIGLVTEDMLKKYRGYSIVGIFIIAAILTP--PDVVSQVLMAIPLLILYELSIFVAK
E6VUV0_PSEA9          FLARMGMVSSDGLRKKRKYAILIGFVVAAILTP--PDPFTQCLMAGPLIFLYEVGIWVTY
Q1MQT5_LAWIP          FLGKMNLINAEKMRSIRKYAILVVFIVAAILTP--PDVFSQILMAIPMLILYELSIWVVA
C8X1I2_DESRD          FLARLGLVNAAWLRKKRKYAILIAFILSALLTP--PDMVTQSFMAGPLALLYELSIWVAA
C6BSE0_DESAD          FLARLGVVTAEGLREKRKYAILVCFICSAILTP--PDVMTQTLMAGPLIILYEIGIWVAY
TATC_DESAH            FMARMGLVSVEFLKKNRKYAILIFFTGAALITP--PDVVTQIMMAIPLMILYEISIIGAR
A9A055_DESOH          CFARFGFVTPDFLKKNRKYALLLFFVGAAILTP--PDVISQILLAIPLMALYELSIVGAR
C4XP92_DESMR          FLTSLGMVGTKALRKFRRWAILLSFVVAAVLTP-TPDAINQLLMAGPMIVLYEVGIWVSW
Q2LXN7_SYNAS          FLTKVGVINARMLSSQRRYAILIIFIVAAVLTP-SPDAVSQILMALPLMVLYEVSILVSR
                                                                                  

I7CPH1_NATSJ          VV---------TNVRRRGAAKY-------------AGTGTSHVKRRLLQFGGVLAVVALG
TATCT_HALVD           VV---------VTAK---RGSEKIDVKSTATTHWNLLAGVGVVVGLLVYAFYEYGGVELA
M1XZE0_NATM8          IV---------VTTK---RSHDSIDVRQTAGERWNVLVGLFVLGAGSVYAFYTYGVGAAL
D3S1J6_FERPA          VT---------T------------------------------------------------
Q0W4Y5_METAR          FT---------APDN---RPPA-------------EEKASGQ------------------
Q97ZU3_SACS2          FM---------EKGR---KKES-------------QKTLERI------------------
A8MCQ5_CALMQ          VV---------ERRQ--------------------PHVEKAS------------------
TATC_CENSY            RR---------ERKE--------------------KSAGA--------------------
Q6KZY6_PICTO          RV---------EKKE---RSIS-------------ITNDY--------------------
D3SVL3_NATMM          WV---------GVD----------------------------------------------
Q9HN36_HALSA          WT---------GN-----------------------------------------------
M1XNN2_NATM8          WV---------KRSP---------------------------------------------
Q8TKC1_METAC          LF----------------------------------------------------------
TATC_METAR            FL----------------------------------------------------------
F8A8M8_THEID          IF----------------------------------------------------------
C7N7W2_SLAHD          LVLGNRVQKQKEEAA---AEAA-------------EEAEWASE-WEKTRARIKERLGDDE
E1QWP7_OLSUV          YI----LIARDGKASLKWTRED-------------YERHEEEKYEEDLSKQ---------
E3HCZ3_ILYPC          IF----------------KFGE--------------------------------------
B3QTN4_CHLT3          YV---------NRKN---AALK--------------------------------------
A6LCU1_PARD8          KA---------PKEE---DEEN-------------EEDNNEE------------------
A6L6V5_BACV8          RI---------GKKQ---REES-------------VEEVLEKS-----------------
C6X0T6_FLAB3          YT---------FKKV---QLRD-------------QLPAKP-------------------
C7PMH2_CHIPD          RA---------LKGM---EQAE-------------KEAEEWS------------------
C6XV03_PEDHD          NI---------ERKR---NKEL-------------YGVAKVKKS----------------
G2Z214_FLABF          MV---------NKKQ----QNV--------------------------------------
G8R5N0_OWEHD          RV---------VKNQ--------------------KKALKTT------------------
A3UAJ3_CROAH          WV---------VRKQ---RKKE-------------QQLKKTS------------------
A0A6N4SQV5_CYTH3      SI---------SKKR---KMQE-------------V------------------------
C6VXQ9_DYAFD          KV---------EREK---LREE-------------TRLAKLGGTLTED------------
C8WRE5_ALIAD          AI---------HRRK---SRDT-------------AQATALSER----------------
D5EP26_CORAD          RL---------EAKK---RAEA-------------LAREGEA------------------
B1ZP28_OPITP          YW---------DWKK---RRAE-------------ATAGAG-------------------
D6Z185_DESAT          VM----------KID---------------------------------------------
TATC_AKKM8            MH---------ERKEAARTREE-------------IARFEEDFNNNNSPYNQ--------
D6ZGM8_MOBCV          LH---------DWLR---------------------SWNAT-------------------
E8N7E5_MICTS          LH---------DRSV---ARRT-------------TAPAGEEPPCSA-------------
C7MCX3_BRAFD          IH---------DRRK---GTAE-------------DEELDDDQASSIDGPSRLDDADEDR
C7NHS2_KYTSD          VR---------DKAR---RRKR-------------PEWMDADADTASAL-----------
E6SAM0_INTC7          VL---------DRKK---QANL-------------PDWLDVPDDQASAL-----------
TATC_XYLCX            WH---------DRRA---DRRT-------------APAAA--------------------
A6W980_KINRD          LN---------DRRR---SKNS-------------DEPDYTDLSDDEASAI---------
TATC_ROTMD            IN---------DKRR---DRKL-------------AKLAQGSDEASLNTATSSEDLAKMG
C5CBV5_MICLC          WG---------DRRR---DRRK-------------GQRETDIEAELAAGPKPLDEI----
E1VW56_GLUAR          FN---------DKKR---AKKL-------------AAQEAENERLAAGGVATDIDAPSTI
A9WSH2_RENSM          LL---------DRRR---DKRA-------------EKRAQETEDTADSATPLTDLDSI--
B2GIN3_KOCRD          YL---------DRRR---ARKR-------------QKQQAATGASADRGTSADELRSLGS
D3Q548_STANL          IN---------DRRR---NRKT-------------ADWDTLDPDEASVIDDGPSDIGEVE
D7GEA7_PROFC          RH---------DKRQ-VAEQQQ--------------------------------------
TATC_FRACC            LN---------DRRV---ARRGDTSPYADLDDDETSPLDFDDAPPRPAASAGPAATATSP
D2ATT8_STRRD          LR---------ERRA---PKGE-----------DFSHLSDDEASPLAEDLSPLDLNTTDT
Q47P16_THEFY          IN---------DRRR---SRNR---------DPL-AELDDDEISPLNDF--DSTTESTSN
A0LU67_ACIC1          IH---------DARK---ARAP--------AATAYAHLSDDEPSPLDLSTG---------
D2S6F0_GEOOG          FV---------DRRR---AKRDAVEHFHALSDDEASPLDAAPSELDAAPYDDLRREDDAA
C6WIE9_ACTMD          LH---------DKRKARKRVEEGFGPEENWDKLSDDEASPFDYTPTQVEDSGTAGRTATQ
C8XAP1_NAKMY          VH---------DRRA---RRQE-------------ERRELSDDEATPLSDLPVGVAANPA
B1VDV8_CORU7          FN---------DKRR---DKRQ-------------AREADAPGSDIRPSGAVAPAEAVER
D5UPM4_TSUPD          FH---------DRLK---SKRNPTDGWEGDIDDETASPTPAAPQPIGASAAPSGSDVGGA
TATC_MYCTU            VH---------DKRK---AKRE-------------AAIPDDEASVIDPPSPVPAPSVIGS
Q0SIG7_RHOJR          IN---------DRRKARRTEQEWGALDDDEASTIAAPSDLNEAFDVAATPVPEPAGRFRR
F6EP00_HOYSD          LH---------DRRK---ARKH---------FEQFGDIGDDEAAPVGPAAPLDEDKATKT
TATC_CORK4            IH---------DRRA---ARHV-------S-EW--EGLSDDEASPLKVAPSSIPAAESIY
Q8NQE5_CORGL          FN---------DKRR---DKKR-------------PEWLDGDDLSASPLDTSAGGEDAPS
C7PVW6_CATAD          LN---------DRRR---AARN-------------INAGLTPDEASNLDLSPVPVEQARP
G2P670_STRV4          AN---------DRRK---ARRRAADPDFGLSDDEASELDLTPEAVAAPSARPELTDGDDS
B1W318_STRGG          VN---------DKRR---NRNNPDAELSDDEASDLDLTPEPVGRVENVSGSRPALPGQAS
D2Q3I8_KRIFD          II---------DKRR---ARKT-------------EELLAE-------------------
A1SK21_NOCSJ          TV---------DRAR---RRGA----------GSTDQWADDEASPL--------------
Q2G128_STAA8          FT---------CRGK---PPTH--------------------------------------
D5SQP1_PLAL2          VP---------ESSE---EATS-------------PEAA---------------------
E8R5A8_ISOPI          RG---------QNPG---RLAS-------------GGSSIGG------------------
Q6AN67_DESPS          LF----------------NRVK-------------ASKKDDA------------------
D6Z4B1_DESAT          IF---------------------------------APPGGAR------------------
B1HXK1_LYSSC          RL---------ERKQ---IEST-------------A------------------------
D6XUT8_BACIE          LV---------YRRK---MKKE-------------REREKELEN----------------
Q8EQG3_OCEIH          IV---------YKKK---QAKH-------------EAFMNES------------------
D5WSC2_KYRT2          WV---------WARR---QKNP-------------DDPVEN-------------------
C5D4F0_GEOSW          IA---------YRKA---LLAQ-------------TEQENLP------------------
Q5WJP1_BACSK          IT---------YRKY---HGTT-------------DHNGQESAK----------------
TATC_BACHD            LT---------YRKV---QKLE-------------KLRQEEYRQEEG-------------
C0ZK48_BREBN          IV---------YRKQ---LKEQ-------------EAWEQEYGSLETNEPVQ--------
E3EID4_PAEPS          VV---------YRKQ---LRAQ-------------EEREAQLRVAAE-------------
C6CVH0_PAESJ          TV---------YKKQ---LAAA-------------EKREAEW-AAGQ-------------
D8K211_DEHLB          VV---------RKRK---PAIQ--------------------------------------
E6SMD5_THEM7          LI---------HRRR---RGRT-------------AAGAAGAAAPAGAGKVAGAGADPAE
E8N519_ANATU          FA------------Q---------------------------------------------
A5URY8_ROSS1          FV---------PKRR---TADE-------------QAAAPSAG-----------------
B9L0C4_THERP          FA-----------------KPV--------------------------------------
D1CCN1_THET1          IW----------------------------------------------------------
C7LYQ4_ACIFD          AL---------TKRR---ARVA-------------DAGG---------------------
Q7UFI8_RHOBA          YM---------PRGR---GLGS-------------EAYDPA-------------------
B3E195_METI4          AI---------EARK---RTQK-------------DRAIEKGDVIP--------------
Q1AUL3_RUBXD          YV---------NPVS---DVPE-------------RLEEDGR-------------PPERV
Q7U568_SYNPX          FT---------ESLR---PETP--------------------------------------
TATC_ORYSJ            LT---------GR-----------------------------------------------
TATC_MAIZE            IT---------GR-----------------------------------------------
K3XJC3_SETIT          LI---------GR-----------------------------------------------
Q114K5_TRIEI          LI---------GK-----------------------------------------------
B0CFY2_ACAM1          LT---------GH-----------------------------------------------
E0UC67_GLOV7          LT---------GH-----------------------------------------------
C1A4F6_GEMAT          FI---------ARRR---ERRL-------------AVEVA--------------------
B3E7M3_GEOLS          IF---------GKKK---AADP-------------AEMDNFPITSAA-------------
E1X470_HALMS          LV----------------VHPY-------------LERHHTS------------------
A9EPV7_SORC5          VF---------GKPP---TDAQ-------------RAAYKAR-------------KEKEV
Q67QH4_SYMTH          FA---------QPKN------E--------------------------------------
A9KHC2_LACP7          IV---------TARR---KRRE-------------SYEAESCSQA---------------
J9ZE06_LEPFM          LT---------ARKG---QKKV-------------STVSSRSRVSL--------------
Q023M6_SOLUE          LL-------VLHREN---RRFP-------------WRKTMTIVIPVLLLLALVLYLSITK
TATC_DEIRA            VF---------RVIA---PEEQ-------------ERPAPMS------------------
D7BE12_MEISD          WA---------ERSR---PKEI-------------EEAAA--------------------
D7CQR8_TRURR          IF---------QRKV---PFAR-------------DHPEPTRPH----------------
A5EVU4_DICNV          YL---------QKQS---AEKD--------------------------------------
Q9PFU5_XYLFA          AV---------TH-----PKTA--------------------------------------
Q1H3X3_METFK          LV---------VARR---AAVP-------------ALPDA--------------------
A9BXA9_DELAS          WF---------SRVS---KAPE-------------EEAEPGTAVDKPAEDKPSP------
A1AVV9_RUTMC          LF---------KQNK---QKISDKPPPNSSKKFSKKEKNSDNNDWNDNEMEAEMKKIDTE
TATC_HALNC            FF---------YKAK---LARAAEVEAEESGAADDESDEAVSARHAEYEAKAQTQADEPL
Q47AM9_DECAR          FV----------SAP---RPVE-------------APAEVTP-------------EKSAE
E5APW1_PARRH          LL---------VTRQ---PDSE-------------PESEEAK------------------
Q2YAV6_NITMU          II---------GRSE---TLAVYQPAGGPDTNSPSDQTGTEEGKRS--------------
Q31E59_HYDCU          AV---------QKAR---RRKEDEETDDEEDETPKQDPAASGQSNDTASPESDEIDPYAI
Q48AI0_COLP3          FY---------HKEE---DEDE-------------SNNIKENDK----------------
G4QJK5_GLANF          WY---------TKNA---RRDQ-------------DPDDEVSMDPKPEEEKNN-------
D3SCC9_THISK          IM---------ERKK---AEKR-------------RAQGGDEPDDLSDDSGDGPDDPDGG
H8GJD2_METAL          LF---------APKP---ASDS-------------DKQLTSS------------------
K0C6J4_CYCSP          RF---------ARPT--------------------EHQTAQ-------------------
D3RQL8_ALLVD          VL---------LKGRLAEDSDSGEPPPAGSAPKPLPVTPSAGGGAVGRELSPGLDDPDRW
I3YA58_THIV6          LL---------LRQR---GNRG-------------EGADSTP-------------PPPGG
F6A8L5_PSEF1          MV---------RTRR---GEPD-------------EEDDNAP-----------TDQPPSV
TATC_HAEIN            FY---------QPKD---DESA-------------VKNNDESEKTQ--------------
TATC_ECOLI            FY--------VGKGR---NREE-------------ENDAEAESEKTEE------------
H2IVX2_RAHAC          FY-------VGGRRR---SDVD-------------NETDPDQPA----------------
D1BNH6_VEIPT          KI---------MKR----------------------------------------------
A8MIP1_ALKOO          MI---------YKRK---KIDA--------------------------------------
E1R121_SEDSS          IF---------EKRK---QKEE-------------ALAETHA------------------
D2RIN1_ACIFV          F----------GLGR---------------------------------------------
C6XIZ5_HIRBI          FV---------EKKK---DEAE-------------EERLNI-------------------
A0A0H3LXY3_BARHE      YM---------EKKK---NSFK-------------RSL----------------------
E0TEC0_PARBH          FF---------GNAP--VVAQE--------------------------------------
Q28T34_JANSC          WV---------EHSR---NRRL-------------RAEGILDEGEEL-------------
TATC_RHOCB            RI---------EKKR---EAQM-----RAEGTWIDDDEDDEA------------------
A1B0H6_PARDP          RI---------EKKR---ELEE-------------READV--------------------
Q0AND8_MARMM          LM---------QSSD---DRAD-------------DTQED--------------------
Q2GER9_NEOSM          YV---------SKKK-LILRKE-------------SKENSDE------------------
B3PIX7_CELJU          WQ---------EKTR---TKPA-------------DKKPSANKPATQTS-----------
Q0C0W0_HYPNA          LI---------EKKA---EKEE-------------AATAAE-------------------
Q3SRQ3_NITWN          IV---------EKKA---ARPS-------------ASAATSPPAGNPAE-----------
B9JXD9_AGRVS          LV---------ERER---SKKA-------------AAEASTSTEVK--------------
Q98LC7_RHILO          LI-----ERSQERER---LARE-------------KQEAGET----VADKTPDEPPAPAA
D9QLG6_BRESC          LI---------ELRR---KKDE-------------DAEGLEAA-----------------
B0T1Q5_CAUSK          LI---------ERRK---AKDE-------------REASTDVATV---------------
C7JE44_ACEP3          LV---------EPKF---KASQ-------------AEDTSNT------------------
Q2G9D2_NOVAD          FT---------ERAD---AKRR-------------AEEAAEEAAAEAQARLLPAGEQPPL
TATC_MAGMM            GI---------ERKR---AEQE-------------AAEEAQW-------------AADHN
D5BQU2_PUNMI          IM---------NKRQ--------------------YDEFDD-------------------
I3TKT9_TISMK          RI---------ERAR---AERE-------------KAEEAELAATLADKDDSGA------
Q2RTH4_RHORT          MV---------EKSKGIEDDDL-------------ENLDDDEPPPAAAAPSTAHKRGGTT
Q6MGQ9_BDEBA          IF---------EKKR---EDAY-------------AVNERE-------------------
B2A204_NATTJ          FI---------YRRK---NKHT-------------GQAA---------------------
A5D1I5_PELTS          IV---------ERGT---ARRK-------------RREELAE-------------LAGAR
B0TFS8_HELMI          WI---------GPKK---RAEA-------------EAGGEDAPIRDVP------------
D5X7P7_THEPJ          FM---------KAKK---RKEE-------------ETEKVEG------VEEAEEVEEAEK
B8D1R3_HALOH          II---------E------------------------------------------------
Q0AZ46_SYNWW          MA---------KPRKKTEEEES-------------EEPREPEPEREEQPRKPEEEKEGEE
TATC_CARHZ            FI---------KPKE-FSGERK--------------------------------------
TATC_KORVE            LV---------HPKN---RRKR-------------REAQEAQEG----------------
C1F555_ACIC5          MV---------HPTR---RKAR-------------AEKRNAK------------------
E8X125_GRATM          FV---------NPNR---RKAK-------------ELKAS--------------------
I3ZCY6_TERRK          AV---------SPKK------K-------------ELPA---------------------
D0LGH0_HALO1          II---------TTRR---ERRE-------------AALIRQE-------------DEAAA
Q2IM06_ANADE          IL---------GKKP---APDA-------------APAA---------------------
A7H6D7_ANADF          IL---------GKRK---AEPV-------------GAAANP-------------------
B2V5Y3_SULSY          YL---------YPKS---MKYK-------------EEIVSVKEKIEA-------------
TATC_PELCD            VG---------AKRS---RDAF-------------SEENSAE------------------
F2LUZ5_HIPMA          VF---------STKD-----NT--------------------------------------
D3UFV2_HELM1          WV---------NPAP---KDPQ-------------KEATESEKESQEAGEQEPIKLPQSK
B9LA52_NAUPA          VV---------NPEK---EETE--------------------------------------
E6X1G9_NITSE          YV---------NPYK---PEEK-------------EDDEEEEEDEFEKAEREFEALEKGS
TATC_CAMJE            KV---------NPAP--------------------KDKESDE------------------
A0A5B9TTD1_SULMU      TV---------NPYI---PPEN-------------DDTEEEPETKSEE------------
A8Z6M5_CAMC1          RA---------GKSD---EDED-------------EKKEDVKEQVDADSDDE--------
B5YKH3_THEYD          LL---------NKKGKNSGGQN--------------------------------------
E6W513_DESIS          LF---------GKKP--------------------EDFTLEDESPAS-------------
E4TGB2_CALNY          IF---------GKKK---GKEL-------------SIYE---------------------
E6VUV0_PSEA9          FF---------GKNE---KRHL-------------DRKAAAE-------------AAAQA
Q1MQT5_LAWIP          LS---------AGHK---EKRK--------------------------------------
C8X1I2_DESRD          VF---------GKKRPEKEDAEEAGANAKAEEADETAASDPEASSEAHEEELLREDAASS
C6BSE0_DESAD          FF---------GKRG---GRKLKNADPENDGPDDSGPDGGDSAATAEDSSSEAKAESTAE
TATC_DESAH            VF---------GKKK---DSDE-------------EEAAENSDVQTDKSTDDTTPGEDQN
A9A055_DESOH          VF---------GKKV---EPEQ-------------GAESAGKEEKDA-------------
C4XP92_DESMR          FV---------DKQRLAEKAQRKAEQEAGADGGPKEPPRSPDTPGAPEAPEATATADATA
Q2LXN7_SYNAS          LA---------GRKR---RGTL-------------EETGNEIDRKEEEEDIPETPKAE--
                                                                                  

I7CPH1_NATSJ          TTAAVNQGGFGYLRESVYPTFPSWLRPSGTTGLETMAIEHGLLGEIGVGLVVAAGVGFVV
TATCT_HALVD           NDGLAAIGSDYVFLAPGSGVALGAFVVAGGFVGLAFGLAYLVYRDIERLERTEIGVGDPT
M1XZE0_NATM8          NDLLAAAGSGYRILPPGAGYGIAETTYLAVVGSVYGLVFSVLGFAYFVYDGLEEPEPDVR
D3S1J6_FERPA          ------------------------------------------------------------
Q0W4Y5_METAR          ------------------------------------------------------------
Q97ZU3_SACS2          ------------------------------------------------------------
A8MCQ5_CALMQ          ------------------------------------------------------------
TATC_CENSY            ------------------------------------------------------------
Q6KZY6_PICTO          ------------------------------------------------------------
D3SVL3_NATMM          ------------------------------------------------------------
Q9HN36_HALSA          ------------------------------------------------------------
M1XNN2_NATM8          ------------------------------------------------------------
Q8TKC1_METAC          ------------------------------------------------------------
TATC_METAR            ------------------------------------------------------------
F8A8M8_THEID          ------------------------------------------------------------
C7N7W2_SLAHD          EE----------------------------------------------------------
E1QWP7_OLSUV          ------------------------------------------------------------
E3HCZ3_ILYPC          ------------------------------------------------------------
B3QTN4_CHLT3          ------------------------------------------------------------
A6LCU1_PARD8          ------------------------------------------------------------
A6L6V5_BACV8          ------------------------------------------------------------
C6X0T6_FLAB3          ------------------------------------------------------------
C7PMH2_CHIPD          ------------------------------------------------------------
C6XV03_PEDHD          ------------------------------------------------------------
G2Z214_FLABF          ------------------------------------------------------------
G8R5N0_OWEHD          ------------------------------------------------------------
A3UAJ3_CROAH          ------------------------------------------------------------
A0A6N4SQV5_CYTH3      ------------------------------------------------------------
C6VXQ9_DYAFD          ------------------------------------------------------------
C8WRE5_ALIAD          ------------------------------------------------------------
D5EP26_CORAD          ------------------------------------------------------------
B1ZP28_OPITP          ------------------------------------------------------------
D6Z185_DESAT          ------------------------------------------------------------
TATC_AKKM8            ------------------------------------------------------------
D6ZGM8_MOBCV          ------------------------------------------------------------
E8N7E5_MICTS          ------------------------------------------------------------
C7MCX3_BRAFD          R-----------------------------------------------------------
C7NHS2_KYTSD          ------------------------------------------------------------
E6SAM0_INTC7          ------------------------------------------------------------
TATC_XYLCX            ------------------------------------------------------------
A6W980_KINRD          ------------------------------------------------------------
TATC_ROTMD            YFEEEKTS----------------------------------------------------
C5CBV5_MICLC          ------------------------------------------------------------
E1VW56_GLUAR          DEPKSQL-----------------------------------------------------
A9WSH2_RENSM          ------------------------------------------------------------
B2GIN3_KOCRD          TAAES-------------------------------------------------------
D3Q548_STANL          SVDDSDDLVDEIAESDGGSDNRPVRRYDEDAT----------------------------
D7GEA7_PROFC          ------------------------------------------------------------
TATC_FRACC            GTANPPGTANPPGTANPVGTANPVGTGSSTPVGAGTAPVSPSTDVTHGDIT---------
D2ATT8_STRRD          DPIK--------------------------------------------------------
Q47P16_THEFY          R-----------------------------------------------------------
A0LU67_ACIC1          ------------------------------------------------------------
D2S6F0_GEOOG          PLDDPARSRR--------------------------------------------------
C6WIE9_ACTMD          AAPPQAQAAQAQAAQAQGQGQPVQPQSPAQPTPPAAQPERRVNYDDDAT-----------
C8XAP1_NAKMY          AATDTVVAPVPAPAPVPAPQPMPGRAAPTARRPYDDLGDVT-------------------
B1VDV8_CORU7          AEPIKASQGIAGQGPADPGMGRRNSFNYAEIFDEDI------------------------
D5UPM4_TSUPD          STIAPPETLMRNSIPRSGLDDVL-------------------------------------
TATC_MYCTU            HDDVT-------------------------------------------------------
Q0SIG7_RHOJR          SRKSGKPAGANKNDDASTTGSNTPGQDFSDTL----------------------------
F6EP00_HOYSD          K-----------------------------------------------------------
TATC_CORK4            DGDHKGIAGGGDAHPAGGSGPIPKPSPVTA-----------PTRAPSASESPTPTPSPAP
Q8NQE5_CORGL          PVETPEAVEPSRMLNPSGEASISYKPGRADFGDVL-------------------------
C7PVW6_CATAD          VEQVRRGFDDDYDDLT--------------------------------------------
G2P670_STRV4          GGTPRRNGYDDVT-----------------------------------------------
B1W318_STRGG          GEADGPGSHRLNGYDDIT------------------------------------------
D2Q3I8_KRIFD          ------------------------------------------------------------
A1SK21_NOCSJ          ------------------------------------------------------------
Q2G128_STAA8          ------------------------------------------------------------
D5SQP1_PLAL2          ------------------------------------------------------------
E8R5A8_ISOPI          ------------------------------------------------------------
Q6AN67_DESPS          ------------------------------------------------------------
D6Z4B1_DESAT          ------------------------------------------------------------
B1HXK1_LYSSC          ------------------------------------------------------------
D6XUT8_BACIE          ------------------------------------------------------------
Q8EQG3_OCEIH          ------------------------------------------------------------
D5WSC2_KYRT2          ------------------------------------------------------------
C5D4F0_GEOSW          ------------------------------------------------------------
Q5WJP1_BACSK          ------------------------------------------------------------
TATC_BACHD            ------------------------------------------------------------
C0ZK48_BREBN          ------------------------------------------------------------
E3EID4_PAEPS          ------------------------------------------------------------
C6CVH0_PAESJ          ------------------------------------------------------------
D8K211_DEHLB          ------------------------------------------------------------
E6SMD5_THEM7          PGPAVAATAGPDTAAPAVTAGARNGETVAPRNGEGSA-----------------------
E8N519_ANATU          ------------------------------------------------------------
A5URY8_ROSS1          ------------------------------------------------------------
B9L0C4_THERP          ------------------------------------------------------------
D1CCN1_THET1          ------------------------------------------------------------
C7LYQ4_ACIFD          ------------------------------------------------------------
Q7UFI8_RHOBA          ------------------------------------------------------------
B3E195_METI4          ------------------------------------------------------------
Q1AUL3_RUBXD          GERDL-------------------------------------------------------
Q7U568_SYNPX          ------------------------------------------------------------
TATC_ORYSJ            ------------------------------------------------------------
TATC_MAIZE            ------------------------------------------------------------
K3XJC3_SETIT          ------------------------------------------------------------
Q114K5_TRIEI          ------------------------------------------------------------
B0CFY2_ACAM1          ------------------------------------------------------------
E0UC67_GLOV7          ------------------------------------------------------------
C1A4F6_GEMAT          ------------------------------------------------------------
B3E7M3_GEOLS          ------------------------------------------------------------
E1X470_HALMS          ------------------------------------------------------------
A9EPV7_SORC5          TKG---------------------------------------------------------
Q67QH4_SYMTH          ------------------------------------------------------------
A9KHC2_LACP7          ------------------------------------------------------------
J9ZE06_LEPFM          ------------------------------------------------------------
Q023M6_SOLUE          YGMKLVPHWPFLTR----------------------------------------------
TATC_DEIRA            ------------------------------------------------------------
D7BE12_MEISD          ------------------------------------------------------------
D7CQR8_TRURR          ------------------------------------------------------------
A5EVU4_DICNV          ------------------------------------------------------------
Q9PFU5_XYLFA          ------------------------------------------------------------
Q1H3X3_METFK          ------------------------------------------------------------
A9BXA9_DELAS          ------------------------------------------------------------
A1AVV9_RUTMC          MKKLDKE-----------------------------------------------------
TATC_HALNC            DMDKAFDEAEADQRRLESDSSASDDGPESNTAGRTEEGEQPSTGSKPEDEPNAPSEPSPK
Q47AM9_DECAR          MDSEMAKAEEDFRKLSEH------------------------------------------
E5APW1_PARRH          ------------------------------------------------------------
Q2YAV6_NITMU          ------------------------------------------------------------
Q31E59_HYDCU          PEEDFDNRYADQLEDDEDWDKTFDEIDSEFSILEQEYKKRKEAEQAEKDAQNKEAKKEDD
Q48AI0_COLP3          ------------------------------------------------------------
G4QJK5_GLANF          ------------------------------------------------------------
D3SCC9_THISK          PGGGGKGASGTSSRKAAAATATAGAASSSSSAGARETPASARAGYTPMTDEEMDAELDRI
H8GJD2_METAL          ------------------------------------------------------------
K0C6J4_CYCSP          ------------------------------------------------------------
D3RQL8_ALLVD          RPMTDAEMETELDLIDAEDARLAQAAKTNAPPVTPAGSSAAETPAMPVDPVEDKIVRANQ
I3YA58_THIV6          GALSSSFAGSKTARNAPARTSTGKTVAGSEIGRDLAGDVDDPDRWRPMTDEEMEVELDLL
F6A8L5_PSEF1          QP----------------------------------------------------------
TATC_HAEIN            ------------------------------------------------------------
TATC_ECOLI            ------------------------------------------------------------
H2IVX2_RAHAC          ------------------------------------------------------------
D1BNH6_VEIPT          ------------------------------------------------------------
A8MIP1_ALKOO          ------------------------------------------------------------
E1R121_SEDSS          ------------------------------------------------------------
D2RIN1_ACIFV          ------------------------------------------------------------
C6XIZ5_HIRBI          ------------------------------------------------------------
A0A0H3LXY3_BARHE      ------------------------------------------------------------
E0TEC0_PARBH          ------------------------------------------------------------
Q28T34_JANSC          ------------------------------------------------------------
TATC_RHOCB            ------------------------------------------------------------
A1B0H6_PARDP          ------------------------------------------------------------
Q0AND8_MARMM          ------------------------------------------------------------
Q2GER9_NEOSM          ------------------------------------------------------------
B3PIX7_CELJU          ------------------------------------------------------------
Q0C0W0_HYPNA          ------------------------------------------------------------
Q3SRQ3_NITWN          ------------------------------------------------------------
B9JXD9_AGRVS          ------------------------------------------------------------
Q98LC7_RHILO          S-----------------------------------------------------------
D9QLG6_BRESC          ------------------------------------------------------------
B0T1Q5_CAUSK          ------------------------------------------------------------
C7JE44_ACEP3          ------------------------------------------------------------
Q2G9D2_NOVAD          LP----------------------------------------------------------
TATC_MAGMM            VDDDDVDHPEHKA-----------------------------------------------
D5BQU2_PUNMI          ------------------------------------------------------------
I3TKT9_TISMK          ------------------------------------------------------------
Q2RTH4_RHORT          ALAAPLARDEEAGADGDPGRFEETDWNHGH------------------------------
Q6MGQ9_BDEBA          ------------------------------------------------------------
B2A204_NATTJ          ------------------------------------------------------------
A5D1I5_PELTS          AADT--------------------------------------------------------
B0TFS8_HELMI          ------------------------------------------------------------
D5X7P7_THEPJ          TWETPGVSGDISDSSAVQKGGEQEDTTANNVNETSADDEVTILFIDEDPKEKRLKDIYKN
B8D1R3_HALOH          ------------------------------------------------------------
Q0AZ46_SYNWW          QATVDES-----------------------------------------------------
TATC_CARHZ            ------------------------------------------------------------
TATC_KORVE            ------------------------------------------------------------
C1F555_ACIC5          ------------------------------------------------------------
E8X125_GRATM          ------------------------------------------------------------
I3ZCY6_TERRK          ------------------------------------------------------------
D0LGH0_HALO1          KAEAAATAAKSSDDAP--------------------------------------------
Q2IM06_ANADE          ------------------------------------------------------------
A7H6D7_ANADF          ------------------------------------------------------------
B2V5Y3_SULSY          ------------------------------------------------------------
TATC_PELCD            ------------------------------------------------------------
F2LUZ5_HIPMA          ------------------------------------------------------------
D3UFV2_HELM1          KLPPKKLPSKKKS-----------------------------------------------
B9LA52_NAUPA          ------------------------------------------------------------
E6X1G9_NITSE          ESHES-------------------------------------------------------
TATC_CAMJE            ------------------------------------------------------------
A0A5B9TTD1_SULMU      ------------------------------------------------------------
A8Z6M5_CAMC1          ------------------------------------------------------------
B5YKH3_THEYD          ------------------------------------------------------------
E6W513_DESIS          ------------------------------------------------------------
E4TGB2_CALNY          ------------------------------------------------------------
E6VUV0_PSEA9          EMDAAAAAAAAETTAGAEAGNPSGEPESGHDKA---------------------------
Q1MQT5_LAWIP          ------------------------------------------------------------
C8X1I2_DESRD          DEQDDDDGDEDATTERKEDGYAPDDY----------------------------------
C6BSE0_DESAD          KKPEAEEPGSDKKKKSKAADSGYDEDLIEM------------------------------
TATC_DESAH            ------------------------------------------------------------
A9A055_DESOH          ------------------------------------------------------------
C4XP92_DESMR          APDETAQNTEAQATGAADAVPTDAGHTADAHEGKKTAKADAAAKDDGQGPKAG-------
Q2LXN7_SYNAS          ------------------------------------------------------------
                                                                                  

I7CPH1_NATSJ          LLGYTIHVLQQPVHPRQDDIRRANTHEDVDFETLAVEDIEDVSTQVFRTMSEDQALEYSR
TATCT_HALVD           KLDLSALDVAGVRAAPPEAFADLEEDEVMALASAAIDDGDKAKAQALIDRFDEAEADREA
M1XZE0_NATM8          RLDPEEIDVADLDLEGVRSAPGAVFAAMDEDEAVGLAGAAMEADDPDRAQAILDRFDEAE
D3S1J6_FERPA          ------------------------------------------------------------
Q0W4Y5_METAR          ------------------------------------------------------------
Q97ZU3_SACS2          ------------------------------------------------------------
A8MCQ5_CALMQ          ------------------------------------------------------------
TATC_CENSY            ------------------------------------------------------------
Q6KZY6_PICTO          ------------------------------------------------------------
D3SVL3_NATMM          ------------------------------------------------------------
Q9HN36_HALSA          ------------------------------------------------------------
M1XNN2_NATM8          ------------------------------------------------------------
Q8TKC1_METAC          ------------------------------------------------------------
TATC_METAR            ------------------------------------------------------------
F8A8M8_THEID          ------------------------------------------------------------
C7N7W2_SLAHD          ------------------------------------------------------------
E1QWP7_OLSUV          ------------------------------------------------------------
E3HCZ3_ILYPC          ------------------------------------------------------------
B3QTN4_CHLT3          ------------------------------------------------------------
A6LCU1_PARD8          ------------------------------------------------------------
A6L6V5_BACV8          ------------------------------------------------------------
C6X0T6_FLAB3          ------------------------------------------------------------
C7PMH2_CHIPD          ------------------------------------------------------------
C6XV03_PEDHD          ------------------------------------------------------------
G2Z214_FLABF          ------------------------------------------------------------
G8R5N0_OWEHD          ------------------------------------------------------------
A3UAJ3_CROAH          ------------------------------------------------------------
A0A6N4SQV5_CYTH3      ------------------------------------------------------------
C6VXQ9_DYAFD          ------------------------------------------------------------
C8WRE5_ALIAD          ------------------------------------------------------------
D5EP26_CORAD          ------------------------------------------------------------
B1ZP28_OPITP          ------------------------------------------------------------
D6Z185_DESAT          ------------------------------------------------------------
TATC_AKKM8            ------------------------------------------------------------
D6ZGM8_MOBCV          ------------------------------------------------------------
E8N7E5_MICTS          ------------------------------------------------------------
C7MCX3_BRAFD          ------------------------------------------------------------
C7NHS2_KYTSD          ------------------------------------------------------------
E6SAM0_INTC7          ------------------------------------------------------------
TATC_XYLCX            ------------------------------------------------------------
A6W980_KINRD          ------------------------------------------------------------
TATC_ROTMD            ------------------------------------------------------------
C5CBV5_MICLC          ------------------------------------------------------------
E1VW56_GLUAR          ------------------------------------------------------------
A9WSH2_RENSM          ------------------------------------------------------------
B2GIN3_KOCRD          ------------------------------------------------------------
D3Q548_STANL          ------------------------------------------------------------
D7GEA7_PROFC          ------------------------------------------------------------
TATC_FRACC            ------------------------------------------------------------
D2ATT8_STRRD          ------------------------------------------------------------
Q47P16_THEFY          ------------------------------------------------------------
A0LU67_ACIC1          ------------------------------------------------------------
D2S6F0_GEOOG          ------------------------------------------------------------
C6WIE9_ACTMD          ------------------------------------------------------------
C8XAP1_NAKMY          ------------------------------------------------------------
B1VDV8_CORU7          ------------------------------------------------------------
D5UPM4_TSUPD          ------------------------------------------------------------
TATC_MYCTU            ------------------------------------------------------------
Q0SIG7_RHOJR          ------------------------------------------------------------
F6EP00_HOYSD          ------------------------------------------------------------
TATC_CORK4            SDSPTSGSHHAPPAAVLRRGPRSWNDSTGDNDGKPGQDTIQSSSFDDVL-----------
Q8NQE5_CORGL          ------------------------------------------------------------
C7PVW6_CATAD          ------------------------------------------------------------
G2P670_STRV4          ------------------------------------------------------------
B1W318_STRGG          ------------------------------------------------------------
D2Q3I8_KRIFD          ------------------------------------------------------------
A1SK21_NOCSJ          ------------------------------------------------------------
Q2G128_STAA8          ------------------------------------------------------------
D5SQP1_PLAL2          ------------------------------------------------------------
E8R5A8_ISOPI          ------------------------------------------------------------
Q6AN67_DESPS          ------------------------------------------------------------
D6Z4B1_DESAT          ------------------------------------------------------------
B1HXK1_LYSSC          ------------------------------------------------------------
D6XUT8_BACIE          ------------------------------------------------------------
Q8EQG3_OCEIH          ------------------------------------------------------------
D5WSC2_KYRT2          ------------------------------------------------------------
C5D4F0_GEOSW          ------------------------------------------------------------
Q5WJP1_BACSK          ------------------------------------------------------------
TATC_BACHD            ------------------------------------------------------------
C0ZK48_BREBN          ------------------------------------------------------------
E3EID4_PAEPS          ------------------------------------------------------------
C6CVH0_PAESJ          ------------------------------------------------------------
D8K211_DEHLB          ------------------------------------------------------------
E6SMD5_THEM7          ------------------------------------------------------------
E8N519_ANATU          ------------------------------------------------------------
A5URY8_ROSS1          ------------------------------------------------------------
B9L0C4_THERP          ------------------------------------------------------------
D1CCN1_THET1          ------------------------------------------------------------
C7LYQ4_ACIFD          ------------------------------------------------------------
Q7UFI8_RHOBA          ------------------------------------------------------------
B3E195_METI4          ------------------------------------------------------------
Q1AUL3_RUBXD          ------------------------------------------------------------
Q7U568_SYNPX          ------------------------------------------------------------
TATC_ORYSJ            ------------------------------------------------------------
TATC_MAIZE            ------------------------------------------------------------
K3XJC3_SETIT          ------------------------------------------------------------
Q114K5_TRIEI          ------------------------------------------------------------
B0CFY2_ACAM1          ------------------------------------------------------------
E0UC67_GLOV7          ------------------------------------------------------------
C1A4F6_GEMAT          ------------------------------------------------------------
B3E7M3_GEOLS          ------------------------------------------------------------
E1X470_HALMS          ------------------------------------------------------------
A9EPV7_SORC5          ------------------------------------------------------------
Q67QH4_SYMTH          ------------------------------------------------------------
A9KHC2_LACP7          ------------------------------------------------------------
J9ZE06_LEPFM          ------------------------------------------------------------
Q023M6_SOLUE          ------------------------------------------------------------
TATC_DEIRA            ------------------------------------------------------------
D7BE12_MEISD          ------------------------------------------------------------
D7CQR8_TRURR          ------------------------------------------------------------
A5EVU4_DICNV          ------------------------------------------------------------
Q9PFU5_XYLFA          ------------------------------------------------------------
Q1H3X3_METFK          ------------------------------------------------------------
A9BXA9_DELAS          ------------------------------------------------------------
A1AVV9_RUTMC          ------------------------------------------------------------
TATC_HALNC            KPDSPV------------------------------------------------------
Q47AM9_DECAR          ------------------------------------------------------------
E5APW1_PARRH          ------------------------------------------------------------
Q2YAV6_NITMU          ------------------------------------------------------------
Q31E59_HYDCU          DLPSDSTPNDSSDSPSKSDK----------------------------------------
Q48AI0_COLP3          ------------------------------------------------------------
G4QJK5_GLANF          ------------------------------------------------------------
D3SCC9_THISK          EAEQAELQRQKEARKSSESQTDETPGTDLSQDDTPQEPARDDARADEGPSQEDYDEGRFR
H8GJD2_METAL          ------------------------------------------------------------
K0C6J4_CYCSP          ------------------------------------------------------------
D3RQL8_ALLVD          LRDLGNDFAARQMLYQVLEEGDATQRQVARNILNQLDEH---------------------
I3YA58_THIV6          DADQAHASQSQKEKAP----------NSSTGAINSVEEKILRANRLRDLSNDFAARQILY
F6A8L5_PSEF1          ------------------------------------------------------------
TATC_HAEIN            ------------------------------------------------------------
TATC_ECOLI            ------------------------------------------------------------
H2IVX2_RAHAC          ------------------------------------------------------------
D1BNH6_VEIPT          ------------------------------------------------------------
A8MIP1_ALKOO          ------------------------------------------------------------
E1R121_SEDSS          ------------------------------------------------------------
D2RIN1_ACIFV          ------------------------------------------------------------
C6XIZ5_HIRBI          ------------------------------------------------------------
A0A0H3LXY3_BARHE      ------------------------------------------------------------
E0TEC0_PARBH          ------------------------------------------------------------
Q28T34_JANSC          ------------------------------------------------------------
TATC_RHOCB            ------------------------------------------------------------
A1B0H6_PARDP          ------------------------------------------------------------
Q0AND8_MARMM          ------------------------------------------------------------
Q2GER9_NEOSM          ------------------------------------------------------------
B3PIX7_CELJU          ------------------------------------------------------------
Q0C0W0_HYPNA          ------------------------------------------------------------
Q3SRQ3_NITWN          ------------------------------------------------------------
B9JXD9_AGRVS          ------------------------------------------------------------
Q98LC7_RHILO          ------------------------------------------------------------
D9QLG6_BRESC          ------------------------------------------------------------
B0T1Q5_CAUSK          ------------------------------------------------------------
C7JE44_ACEP3          ------------------------------------------------------------
Q2G9D2_NOVAD          ------------------------------------------------------------
TATC_MAGMM            ------------------------------------------------------------
D5BQU2_PUNMI          ------------------------------------------------------------
I3TKT9_TISMK          ------------------------------------------------------------
Q2RTH4_RHORT          ------------------------------------------------------------
Q6MGQ9_BDEBA          ------------------------------------------------------------
B2A204_NATTJ          ------------------------------------------------------------
A5D1I5_PELTS          ------------------------------------------------------------
B0TFS8_HELMI          ------------------------------------------------------------
D5X7P7_THEPJ          ITEKGNGPE---------------------------------------------------
B8D1R3_HALOH          ------------------------------------------------------------
Q0AZ46_SYNWW          ------------------------------------------------------------
TATC_CARHZ            ------------------------------------------------------------
TATC_KORVE            ------------------------------------------------------------
C1F555_ACIC5          ------------------------------------------------------------
E8X125_GRATM          ------------------------------------------------------------
I3ZCY6_TERRK          ------------------------------------------------------------
D0LGH0_HALO1          ------------------------------------------------------------
Q2IM06_ANADE          ------------------------------------------------------------
A7H6D7_ANADF          ------------------------------------------------------------
B2V5Y3_SULSY          ------------------------------------------------------------
TATC_PELCD            ------------------------------------------------------------
F2LUZ5_HIPMA          ------------------------------------------------------------
D3UFV2_HELM1          ------------------------------------------------------------
B9LA52_NAUPA          ------------------------------------------------------------
E6X1G9_NITSE          ------------------------------------------------------------
TATC_CAMJE            ------------------------------------------------------------
A0A5B9TTD1_SULMU      ------------------------------------------------------------
A8Z6M5_CAMC1          ------------------------------------------------------------
B5YKH3_THEYD          ------------------------------------------------------------
E6W513_DESIS          ------------------------------------------------------------
E4TGB2_CALNY          ------------------------------------------------------------
E6VUV0_PSEA9          ------------------------------------------------------------
Q1MQT5_LAWIP          ------------------------------------------------------------
C8X1I2_DESRD          ------------------------------------------------------------
C6BSE0_DESAD          ------------------------------------------------------------
TATC_DESAH            ------------------------------------------------------------
A9A055_DESOH          ------------------------------------------------------------
C4XP92_DESMR          ------------------------------------------------------------
Q2LXN7_SYNAS          ------------------------------------------------------------
                                                                                  

I7CPH1_NATSJ          QAMYDDDRAKAQAILDRFDTVEEMDDESAAAAGGAAATGAAGSQEDEGGLVASTAAGMLD
TATCT_HALVD           EAADAEDEPGELEDRTTRAGGAFVSELTEGETDEDDIGGYYTDIAFIVDSLTSRAFWVVG
M1XZE0_NATM8          AAAEEASEGEGTAGDGSVPPQGEPGQSQHTQGTVGAETAKSLRRRQQVRGDSTVQEAAGA
D3S1J6_FERPA          ------------------------------------------------------------
Q0W4Y5_METAR          ------------------------------------------------------------
Q97ZU3_SACS2          ------------------------------------------------------------
A8MCQ5_CALMQ          ------------------------------------------------------------
TATC_CENSY            ------------------------------------------------------------
Q6KZY6_PICTO          ------------------------------------------------------------
D3SVL3_NATMM          ------------------------------------------------------------
Q9HN36_HALSA          ------------------------------------------------------------
M1XNN2_NATM8          ------------------------------------------------------------
Q8TKC1_METAC          ------------------------------------------------------------
TATC_METAR            ------------------------------------------------------------
F8A8M8_THEID          ------------------------------------------------------------
C7N7W2_SLAHD          ------------------------------------------------------------
E1QWP7_OLSUV          ------------------------------------------------------------
E3HCZ3_ILYPC          ------------------------------------------------------------
B3QTN4_CHLT3          ------------------------------------------------------------
A6LCU1_PARD8          ------------------------------------------------------------
A6L6V5_BACV8          ------------------------------------------------------------
C6X0T6_FLAB3          ------------------------------------------------------------
C7PMH2_CHIPD          ------------------------------------------------------------
C6XV03_PEDHD          ------------------------------------------------------------
G2Z214_FLABF          ------------------------------------------------------------
G8R5N0_OWEHD          ------------------------------------------------------------
A3UAJ3_CROAH          ------------------------------------------------------------
A0A6N4SQV5_CYTH3      ------------------------------------------------------------
C6VXQ9_DYAFD          ------------------------------------------------------------
C8WRE5_ALIAD          ------------------------------------------------------------
D5EP26_CORAD          ------------------------------------------------------------
B1ZP28_OPITP          ------------------------------------------------------------
D6Z185_DESAT          ------------------------------------------------------------
TATC_AKKM8            ------------------------------------------------------------
D6ZGM8_MOBCV          ------------------------------------------------------------
E8N7E5_MICTS          ------------------------------------------------------------
C7MCX3_BRAFD          ------------------------------------------------------------
C7NHS2_KYTSD          ------------------------------------------------------------
E6SAM0_INTC7          ------------------------------------------------------------
TATC_XYLCX            ------------------------------------------------------------
A6W980_KINRD          ------------------------------------------------------------
TATC_ROTMD            ------------------------------------------------------------
C5CBV5_MICLC          ------------------------------------------------------------
E1VW56_GLUAR          ------------------------------------------------------------
A9WSH2_RENSM          ------------------------------------------------------------
B2GIN3_KOCRD          ------------------------------------------------------------
D3Q548_STANL          ------------------------------------------------------------
D7GEA7_PROFC          ------------------------------------------------------------
TATC_FRACC            ------------------------------------------------------------
D2ATT8_STRRD          ------------------------------------------------------------
Q47P16_THEFY          ------------------------------------------------------------
A0LU67_ACIC1          ------------------------------------------------------------
D2S6F0_GEOOG          ------------------------------------------------------------
C6WIE9_ACTMD          ------------------------------------------------------------
C8XAP1_NAKMY          ------------------------------------------------------------
B1VDV8_CORU7          ------------------------------------------------------------
D5UPM4_TSUPD          ------------------------------------------------------------
TATC_MYCTU            ------------------------------------------------------------
Q0SIG7_RHOJR          ------------------------------------------------------------
F6EP00_HOYSD          ------------------------------------------------------------
TATC_CORK4            ------------------------------------------------------------
Q8NQE5_CORGL          ------------------------------------------------------------
C7PVW6_CATAD          ------------------------------------------------------------
G2P670_STRV4          ------------------------------------------------------------
B1W318_STRGG          ------------------------------------------------------------
D2Q3I8_KRIFD          ------------------------------------------------------------
A1SK21_NOCSJ          ------------------------------------------------------------
Q2G128_STAA8          ------------------------------------------------------------
D5SQP1_PLAL2          ------------------------------------------------------------
E8R5A8_ISOPI          ------------------------------------------------------------
Q6AN67_DESPS          ------------------------------------------------------------
D6Z4B1_DESAT          ------------------------------------------------------------
B1HXK1_LYSSC          ------------------------------------------------------------
D6XUT8_BACIE          ------------------------------------------------------------
Q8EQG3_OCEIH          ------------------------------------------------------------
D5WSC2_KYRT2          ------------------------------------------------------------
C5D4F0_GEOSW          ------------------------------------------------------------
Q5WJP1_BACSK          ------------------------------------------------------------
TATC_BACHD            ------------------------------------------------------------
C0ZK48_BREBN          ------------------------------------------------------------
E3EID4_PAEPS          ------------------------------------------------------------
C6CVH0_PAESJ          ------------------------------------------------------------
D8K211_DEHLB          ------------------------------------------------------------
E6SMD5_THEM7          ------------------------------------------------------------
E8N519_ANATU          ------------------------------------------------------------
A5URY8_ROSS1          ------------------------------------------------------------
B9L0C4_THERP          ------------------------------------------------------------
D1CCN1_THET1          ------------------------------------------------------------
C7LYQ4_ACIFD          ------------------------------------------------------------
Q7UFI8_RHOBA          ------------------------------------------------------------
B3E195_METI4          ------------------------------------------------------------
Q1AUL3_RUBXD          ------------------------------------------------------------
Q7U568_SYNPX          ------------------------------------------------------------
TATC_ORYSJ            ------------------------------------------------------------
TATC_MAIZE            ------------------------------------------------------------
K3XJC3_SETIT          ------------------------------------------------------------
Q114K5_TRIEI          ------------------------------------------------------------
B0CFY2_ACAM1          ------------------------------------------------------------
E0UC67_GLOV7          ------------------------------------------------------------
C1A4F6_GEMAT          ------------------------------------------------------------
B3E7M3_GEOLS          ------------------------------------------------------------
E1X470_HALMS          ------------------------------------------------------------
A9EPV7_SORC5          ------------------------------------------------------------
Q67QH4_SYMTH          ------------------------------------------------------------
A9KHC2_LACP7          ------------------------------------------------------------
J9ZE06_LEPFM          ------------------------------------------------------------
Q023M6_SOLUE          ------------------------------------------------------------
TATC_DEIRA            ------------------------------------------------------------
D7BE12_MEISD          ------------------------------------------------------------
D7CQR8_TRURR          ------------------------------------------------------------
A5EVU4_DICNV          ------------------------------------------------------------
Q9PFU5_XYLFA          ------------------------------------------------------------
Q1H3X3_METFK          ------------------------------------------------------------
A9BXA9_DELAS          ------------------------------------------------------------
A1AVV9_RUTMC          ------------------------------------------------------------
TATC_HALNC            ------------------------------------------------------------
Q47AM9_DECAR          ------------------------------------------------------------
E5APW1_PARRH          ------------------------------------------------------------
Q2YAV6_NITMU          ------------------------------------------------------------
Q31E59_HYDCU          ------------------------------------------------------------
Q48AI0_COLP3          ------------------------------------------------------------
G4QJK5_GLANF          ------------------------------------------------------------
D3SCC9_THISK          ------------------------------------------------------------
H8GJD2_METAL          ------------------------------------------------------------
K0C6J4_CYCSP          ------------------------------------------------------------
D3RQL8_ALLVD          ------------------------------------------------------------
I3YA58_THIV6          EVLEEGDADQRRVARNILQQLDNT------------------------------------
F6A8L5_PSEF1          ------------------------------------------------------------
TATC_HAEIN            ------------------------------------------------------------
TATC_ECOLI            ------------------------------------------------------------
H2IVX2_RAHAC          ------------------------------------------------------------
D1BNH6_VEIPT          ------------------------------------------------------------
A8MIP1_ALKOO          ------------------------------------------------------------
E1R121_SEDSS          ------------------------------------------------------------
D2RIN1_ACIFV          ------------------------------------------------------------
C6XIZ5_HIRBI          ------------------------------------------------------------
A0A0H3LXY3_BARHE      ------------------------------------------------------------
E0TEC0_PARBH          ------------------------------------------------------------
Q28T34_JANSC          ------------------------------------------------------------
TATC_RHOCB            ------------------------------------------------------------
A1B0H6_PARDP          ------------------------------------------------------------
Q0AND8_MARMM          ------------------------------------------------------------
Q2GER9_NEOSM          ------------------------------------------------------------
B3PIX7_CELJU          ------------------------------------------------------------
Q0C0W0_HYPNA          ------------------------------------------------------------
Q3SRQ3_NITWN          ------------------------------------------------------------
B9JXD9_AGRVS          ------------------------------------------------------------
Q98LC7_RHILO          ------------------------------------------------------------
D9QLG6_BRESC          ------------------------------------------------------------
B0T1Q5_CAUSK          ------------------------------------------------------------
C7JE44_ACEP3          ------------------------------------------------------------
Q2G9D2_NOVAD          ------------------------------------------------------------
TATC_MAGMM            ------------------------------------------------------------
D5BQU2_PUNMI          ------------------------------------------------------------
I3TKT9_TISMK          ------------------------------------------------------------
Q2RTH4_RHORT          ------------------------------------------------------------
Q6MGQ9_BDEBA          ------------------------------------------------------------
B2A204_NATTJ          ------------------------------------------------------------
A5D1I5_PELTS          ------------------------------------------------------------
B0TFS8_HELMI          ------------------------------------------------------------
D5X7P7_THEPJ          ------------------------------------------------------------
B8D1R3_HALOH          ------------------------------------------------------------
Q0AZ46_SYNWW          ------------------------------------------------------------
TATC_CARHZ            ------------------------------------------------------------
TATC_KORVE            ------------------------------------------------------------
C1F555_ACIC5          ------------------------------------------------------------
E8X125_GRATM          ------------------------------------------------------------
I3ZCY6_TERRK          ------------------------------------------------------------
D0LGH0_HALO1          ------------------------------------------------------------
Q2IM06_ANADE          ------------------------------------------------------------
A7H6D7_ANADF          ------------------------------------------------------------
B2V5Y3_SULSY          ------------------------------------------------------------
TATC_PELCD            ------------------------------------------------------------
F2LUZ5_HIPMA          ------------------------------------------------------------
D3UFV2_HELM1          ------------------------------------------------------------
B9LA52_NAUPA          ------------------------------------------------------------
E6X1G9_NITSE          ------------------------------------------------------------
TATC_CAMJE            ------------------------------------------------------------
A0A5B9TTD1_SULMU      ------------------------------------------------------------
A8Z6M5_CAMC1          ------------------------------------------------------------
B5YKH3_THEYD          ------------------------------------------------------------
E6W513_DESIS          ------------------------------------------------------------
E4TGB2_CALNY          ------------------------------------------------------------
E6VUV0_PSEA9          ------------------------------------------------------------
Q1MQT5_LAWIP          ------------------------------------------------------------
C8X1I2_DESRD          ------------------------------------------------------------
C6BSE0_DESAD          ------------------------------------------------------------
TATC_DESAH            ------------------------------------------------------------
A9A055_DESOH          ------------------------------------------------------------
C4XP92_DESMR          ------------------------------------------------------------
Q2LXN7_SYNAS          ------------------------------------------------------------
                                                                                  

I7CPH1_NATSJ          PFTEDETSEDDIGGYAYDIAFIFNSLTSKVFRIVGLFMVVMGGTFFWLYSDGLGDILKLF
TATCT_HALVD           WFMLVLATTFGWLYTGGIRDVYDDFLGRLPAAVRPEEVLNVVALHPMEALIFEVKFSTIL
M1XZE0_NATM8          GTAARGDESDPAGAEAGADGRSLAERSAGALDVFSDDDVDEDDIGGYAYDIKFILDSVTS
D3S1J6_FERPA          ------------------------------------------------------------
Q0W4Y5_METAR          ------------------------------------------------------------
Q97ZU3_SACS2          ------------------------------------------------------------
A8MCQ5_CALMQ          ------------------------------------------------------------
TATC_CENSY            ------------------------------------------------------------
Q6KZY6_PICTO          ------------------------------------------------------------
D3SVL3_NATMM          ------------------------------------------------------------
Q9HN36_HALSA          ------------------------------------------------------------
M1XNN2_NATM8          ------------------------------------------------------------
Q8TKC1_METAC          ------------------------------------------------------------
TATC_METAR            ------------------------------------------------------------
F8A8M8_THEID          ------------------------------------------------------------
C7N7W2_SLAHD          ------------------------------------------------------------
E1QWP7_OLSUV          ------------------------------------------------------------
E3HCZ3_ILYPC          ------------------------------------------------------------
B3QTN4_CHLT3          ------------------------------------------------------------
A6LCU1_PARD8          ------------------------------------------------------------
A6L6V5_BACV8          ------------------------------------------------------------
C6X0T6_FLAB3          ------------------------------------------------------------
C7PMH2_CHIPD          ------------------------------------------------------------
C6XV03_PEDHD          ------------------------------------------------------------
G2Z214_FLABF          ------------------------------------------------------------
G8R5N0_OWEHD          ------------------------------------------------------------
A3UAJ3_CROAH          ------------------------------------------------------------
A0A6N4SQV5_CYTH3      ------------------------------------------------------------
C6VXQ9_DYAFD          ------------------------------------------------------------
C8WRE5_ALIAD          ------------------------------------------------------------
D5EP26_CORAD          ------------------------------------------------------------
B1ZP28_OPITP          ------------------------------------------------------------
D6Z185_DESAT          ------------------------------------------------------------
TATC_AKKM8            ------------------------------------------------------------
D6ZGM8_MOBCV          ------------------------------------------------------------
E8N7E5_MICTS          ------------------------------------------------------------
C7MCX3_BRAFD          ------------------------------------------------------------
C7NHS2_KYTSD          ------------------------------------------------------------
E6SAM0_INTC7          ------------------------------------------------------------
TATC_XYLCX            ------------------------------------------------------------
A6W980_KINRD          ------------------------------------------------------------
TATC_ROTMD            ------------------------------------------------------------
C5CBV5_MICLC          ------------------------------------------------------------
E1VW56_GLUAR          ------------------------------------------------------------
A9WSH2_RENSM          ------------------------------------------------------------
B2GIN3_KOCRD          ------------------------------------------------------------
D3Q548_STANL          ------------------------------------------------------------
D7GEA7_PROFC          ------------------------------------------------------------
TATC_FRACC            ------------------------------------------------------------
D2ATT8_STRRD          ------------------------------------------------------------
Q47P16_THEFY          ------------------------------------------------------------
A0LU67_ACIC1          ------------------------------------------------------------
D2S6F0_GEOOG          ------------------------------------------------------------
C6WIE9_ACTMD          ------------------------------------------------------------
C8XAP1_NAKMY          ------------------------------------------------------------
B1VDV8_CORU7          ------------------------------------------------------------
D5UPM4_TSUPD          ------------------------------------------------------------
TATC_MYCTU            ------------------------------------------------------------
Q0SIG7_RHOJR          ------------------------------------------------------------
F6EP00_HOYSD          ------------------------------------------------------------
TATC_CORK4            ------------------------------------------------------------
Q8NQE5_CORGL          ------------------------------------------------------------
C7PVW6_CATAD          ------------------------------------------------------------
G2P670_STRV4          ------------------------------------------------------------
B1W318_STRGG          ------------------------------------------------------------
D2Q3I8_KRIFD          ------------------------------------------------------------
A1SK21_NOCSJ          ------------------------------------------------------------
Q2G128_STAA8          ------------------------------------------------------------
D5SQP1_PLAL2          ------------------------------------------------------------
E8R5A8_ISOPI          ------------------------------------------------------------
Q6AN67_DESPS          ------------------------------------------------------------
D6Z4B1_DESAT          ------------------------------------------------------------
B1HXK1_LYSSC          ------------------------------------------------------------
D6XUT8_BACIE          ------------------------------------------------------------
Q8EQG3_OCEIH          ------------------------------------------------------------
D5WSC2_KYRT2          ------------------------------------------------------------
C5D4F0_GEOSW          ------------------------------------------------------------
Q5WJP1_BACSK          ------------------------------------------------------------
TATC_BACHD            ------------------------------------------------------------
C0ZK48_BREBN          ------------------------------------------------------------
E3EID4_PAEPS          ------------------------------------------------------------
C6CVH0_PAESJ          ------------------------------------------------------------
D8K211_DEHLB          ------------------------------------------------------------
E6SMD5_THEM7          ------------------------------------------------------------
E8N519_ANATU          ------------------------------------------------------------
A5URY8_ROSS1          ------------------------------------------------------------
B9L0C4_THERP          ------------------------------------------------------------
D1CCN1_THET1          ------------------------------------------------------------
C7LYQ4_ACIFD          ------------------------------------------------------------
Q7UFI8_RHOBA          ------------------------------------------------------------
B3E195_METI4          ------------------------------------------------------------
Q1AUL3_RUBXD          ------------------------------------------------------------
Q7U568_SYNPX          ------------------------------------------------------------
TATC_ORYSJ            ------------------------------------------------------------
TATC_MAIZE            ------------------------------------------------------------
K3XJC3_SETIT          ------------------------------------------------------------
Q114K5_TRIEI          ------------------------------------------------------------
B0CFY2_ACAM1          ------------------------------------------------------------
E0UC67_GLOV7          ------------------------------------------------------------
C1A4F6_GEMAT          ------------------------------------------------------------
B3E7M3_GEOLS          ------------------------------------------------------------
E1X470_HALMS          ------------------------------------------------------------
A9EPV7_SORC5          ------------------------------------------------------------
Q67QH4_SYMTH          ------------------------------------------------------------
A9KHC2_LACP7          ------------------------------------------------------------
J9ZE06_LEPFM          ------------------------------------------------------------
Q023M6_SOLUE          ------------------------------------------------------------
TATC_DEIRA            ------------------------------------------------------------
D7BE12_MEISD          ------------------------------------------------------------
D7CQR8_TRURR          ------------------------------------------------------------
A5EVU4_DICNV          ------------------------------------------------------------
Q9PFU5_XYLFA          ------------------------------------------------------------
Q1H3X3_METFK          ------------------------------------------------------------
A9BXA9_DELAS          ------------------------------------------------------------
A1AVV9_RUTMC          ------------------------------------------------------------
TATC_HALNC            ------------------------------------------------------------
Q47AM9_DECAR          ------------------------------------------------------------
E5APW1_PARRH          ------------------------------------------------------------
Q2YAV6_NITMU          ------------------------------------------------------------
Q31E59_HYDCU          ------------------------------------------------------------
Q48AI0_COLP3          ------------------------------------------------------------
G4QJK5_GLANF          ------------------------------------------------------------
D3SCC9_THISK          ------------------------------------------------------------
H8GJD2_METAL          ------------------------------------------------------------
K0C6J4_CYCSP          ------------------------------------------------------------
D3RQL8_ALLVD          ------------------------------------------------------------
I3YA58_THIV6          ------------------------------------------------------------
F6A8L5_PSEF1          ------------------------------------------------------------
TATC_HAEIN            ------------------------------------------------------------
TATC_ECOLI            ------------------------------------------------------------
H2IVX2_RAHAC          ------------------------------------------------------------
D1BNH6_VEIPT          ------------------------------------------------------------
A8MIP1_ALKOO          ------------------------------------------------------------
E1R121_SEDSS          ------------------------------------------------------------
D2RIN1_ACIFV          ------------------------------------------------------------
C6XIZ5_HIRBI          ------------------------------------------------------------
A0A0H3LXY3_BARHE      ------------------------------------------------------------
E0TEC0_PARBH          ------------------------------------------------------------
Q28T34_JANSC          ------------------------------------------------------------
TATC_RHOCB            ------------------------------------------------------------
A1B0H6_PARDP          ------------------------------------------------------------
Q0AND8_MARMM          ------------------------------------------------------------
Q2GER9_NEOSM          ------------------------------------------------------------
B3PIX7_CELJU          ------------------------------------------------------------
Q0C0W0_HYPNA          ------------------------------------------------------------
Q3SRQ3_NITWN          ------------------------------------------------------------
B9JXD9_AGRVS          ------------------------------------------------------------
Q98LC7_RHILO          ------------------------------------------------------------
D9QLG6_BRESC          ------------------------------------------------------------
B0T1Q5_CAUSK          ------------------------------------------------------------
C7JE44_ACEP3          ------------------------------------------------------------
Q2G9D2_NOVAD          ------------------------------------------------------------
TATC_MAGMM            ------------------------------------------------------------
D5BQU2_PUNMI          ------------------------------------------------------------
I3TKT9_TISMK          ------------------------------------------------------------
Q2RTH4_RHORT          ------------------------------------------------------------
Q6MGQ9_BDEBA          ------------------------------------------------------------
B2A204_NATTJ          ------------------------------------------------------------
A5D1I5_PELTS          ------------------------------------------------------------
B0TFS8_HELMI          ------------------------------------------------------------
D5X7P7_THEPJ          ------------------------------------------------------------
B8D1R3_HALOH          ------------------------------------------------------------
Q0AZ46_SYNWW          ------------------------------------------------------------
TATC_CARHZ            ------------------------------------------------------------
TATC_KORVE            ------------------------------------------------------------
C1F555_ACIC5          ------------------------------------------------------------
E8X125_GRATM          ------------------------------------------------------------
I3ZCY6_TERRK          ------------------------------------------------------------
D0LGH0_HALO1          ------------------------------------------------------------
Q2IM06_ANADE          ------------------------------------------------------------
A7H6D7_ANADF          ------------------------------------------------------------
B2V5Y3_SULSY          ------------------------------------------------------------
TATC_PELCD            ------------------------------------------------------------
F2LUZ5_HIPMA          ------------------------------------------------------------
D3UFV2_HELM1          ------------------------------------------------------------
B9LA52_NAUPA          ------------------------------------------------------------
E6X1G9_NITSE          ------------------------------------------------------------
TATC_CAMJE            ------------------------------------------------------------
A0A5B9TTD1_SULMU      ------------------------------------------------------------
A8Z6M5_CAMC1          ------------------------------------------------------------
B5YKH3_THEYD          ------------------------------------------------------------
E6W513_DESIS          ------------------------------------------------------------
E4TGB2_CALNY          ------------------------------------------------------------
E6VUV0_PSEA9          ------------------------------------------------------------
Q1MQT5_LAWIP          ------------------------------------------------------------
C8X1I2_DESRD          ------------------------------------------------------------
C6BSE0_DESAD          ------------------------------------------------------------
TATC_DESAH            ------------------------------------------------------------
A9A055_DESOH          ------------------------------------------------------------
C4XP92_DESMR          ------------------------------------------------------------
Q2LXN7_SYNAS          ------------------------------------------------------------
                                                                                  

I7CPH1_NATSJ          LDRVPRHVLEEVVGKGVDPSTLPLSKLIEKMDIVVALHPVEVLIFEAKVSALAGLVVTLP
TATCT_HALVD           AVLATLPLVAYFVWPALRERNIIRKRRRTVFVWTGALAGGLLGGFALGYTYVAPTVITFL
M1XZE0_NATM8          KSFRLVGVFAAVMAATFFVLYQGGIGVLHERFVGGMPSQFAAEQVSIVTLHPVEALIFMI
D3S1J6_FERPA          ------------------------------------------------------------
Q0W4Y5_METAR          ------------------------------------------------------------
Q97ZU3_SACS2          ------------------------------------------------------------
A8MCQ5_CALMQ          ------------------------------------------------------------
TATC_CENSY            ------------------------------------------------------------
Q6KZY6_PICTO          ------------------------------------------------------------
D3SVL3_NATMM          ------------------------------------------------------------
Q9HN36_HALSA          ------------------------------------------------------------
M1XNN2_NATM8          ------------------------------------------------------------
Q8TKC1_METAC          ------------------------------------------------------------
TATC_METAR            ------------------------------------------------------------
F8A8M8_THEID          ------------------------------------------------------------
C7N7W2_SLAHD          ------------------------------------------------------------
E1QWP7_OLSUV          ------------------------------------------------------------
E3HCZ3_ILYPC          ------------------------------------------------------------
B3QTN4_CHLT3          ------------------------------------------------------------
A6LCU1_PARD8          ------------------------------------------------------------
A6L6V5_BACV8          ------------------------------------------------------------
C6X0T6_FLAB3          ------------------------------------------------------------
C7PMH2_CHIPD          ------------------------------------------------------------
C6XV03_PEDHD          ------------------------------------------------------------
G2Z214_FLABF          ------------------------------------------------------------
G8R5N0_OWEHD          ------------------------------------------------------------
A3UAJ3_CROAH          ------------------------------------------------------------
A0A6N4SQV5_CYTH3      ------------------------------------------------------------
C6VXQ9_DYAFD          ------------------------------------------------------------
C8WRE5_ALIAD          ------------------------------------------------------------
D5EP26_CORAD          ------------------------------------------------------------
B1ZP28_OPITP          ------------------------------------------------------------
D6Z185_DESAT          ------------------------------------------------------------
TATC_AKKM8            ------------------------------------------------------------
D6ZGM8_MOBCV          ------------------------------------------------------------
E8N7E5_MICTS          ------------------------------------------------------------
C7MCX3_BRAFD          ------------------------------------------------------------
C7NHS2_KYTSD          ------------------------------------------------------------
E6SAM0_INTC7          ------------------------------------------------------------
TATC_XYLCX            ------------------------------------------------------------
A6W980_KINRD          ------------------------------------------------------------
TATC_ROTMD            ------------------------------------------------------------
C5CBV5_MICLC          ------------------------------------------------------------
E1VW56_GLUAR          ------------------------------------------------------------
A9WSH2_RENSM          ------------------------------------------------------------
B2GIN3_KOCRD          ------------------------------------------------------------
D3Q548_STANL          ------------------------------------------------------------
D7GEA7_PROFC          ------------------------------------------------------------
TATC_FRACC            ------------------------------------------------------------
D2ATT8_STRRD          ------------------------------------------------------------
Q47P16_THEFY          ------------------------------------------------------------
A0LU67_ACIC1          ------------------------------------------------------------
D2S6F0_GEOOG          ------------------------------------------------------------
C6WIE9_ACTMD          ------------------------------------------------------------
C8XAP1_NAKMY          ------------------------------------------------------------
B1VDV8_CORU7          ------------------------------------------------------------
D5UPM4_TSUPD          ------------------------------------------------------------
TATC_MYCTU            ------------------------------------------------------------
Q0SIG7_RHOJR          ------------------------------------------------------------
F6EP00_HOYSD          ------------------------------------------------------------
TATC_CORK4            ------------------------------------------------------------
Q8NQE5_CORGL          ------------------------------------------------------------
C7PVW6_CATAD          ------------------------------------------------------------
G2P670_STRV4          ------------------------------------------------------------
B1W318_STRGG          ------------------------------------------------------------
D2Q3I8_KRIFD          ------------------------------------------------------------
A1SK21_NOCSJ          ------------------------------------------------------------
Q2G128_STAA8          ------------------------------------------------------------
D5SQP1_PLAL2          ------------------------------------------------------------
E8R5A8_ISOPI          ------------------------------------------------------------
Q6AN67_DESPS          ------------------------------------------------------------
D6Z4B1_DESAT          ------------------------------------------------------------
B1HXK1_LYSSC          ------------------------------------------------------------
D6XUT8_BACIE          ------------------------------------------------------------
Q8EQG3_OCEIH          ------------------------------------------------------------
D5WSC2_KYRT2          ------------------------------------------------------------
C5D4F0_GEOSW          ------------------------------------------------------------
Q5WJP1_BACSK          ------------------------------------------------------------
TATC_BACHD            ------------------------------------------------------------
C0ZK48_BREBN          ------------------------------------------------------------
E3EID4_PAEPS          ------------------------------------------------------------
C6CVH0_PAESJ          ------------------------------------------------------------
D8K211_DEHLB          ------------------------------------------------------------
E6SMD5_THEM7          ------------------------------------------------------------
E8N519_ANATU          ------------------------------------------------------------
A5URY8_ROSS1          ------------------------------------------------------------
B9L0C4_THERP          ------------------------------------------------------------
D1CCN1_THET1          ------------------------------------------------------------
C7LYQ4_ACIFD          ------------------------------------------------------------
Q7UFI8_RHOBA          ------------------------------------------------------------
B3E195_METI4          ------------------------------------------------------------
Q1AUL3_RUBXD          ------------------------------------------------------------
Q7U568_SYNPX          ------------------------------------------------------------
TATC_ORYSJ            ------------------------------------------------------------
TATC_MAIZE            ------------------------------------------------------------
K3XJC3_SETIT          ------------------------------------------------------------
Q114K5_TRIEI          ------------------------------------------------------------
B0CFY2_ACAM1          ------------------------------------------------------------
E0UC67_GLOV7          ------------------------------------------------------------
C1A4F6_GEMAT          ------------------------------------------------------------
B3E7M3_GEOLS          ------------------------------------------------------------
E1X470_HALMS          ------------------------------------------------------------
A9EPV7_SORC5          ------------------------------------------------------------
Q67QH4_SYMTH          ------------------------------------------------------------
A9KHC2_LACP7          ------------------------------------------------------------
J9ZE06_LEPFM          ------------------------------------------------------------
Q023M6_SOLUE          ------------------------------------------------------------
TATC_DEIRA            ------------------------------------------------------------
D7BE12_MEISD          ------------------------------------------------------------
D7CQR8_TRURR          ------------------------------------------------------------
A5EVU4_DICNV          ------------------------------------------------------------
Q9PFU5_XYLFA          ------------------------------------------------------------
Q1H3X3_METFK          ------------------------------------------------------------
A9BXA9_DELAS          ------------------------------------------------------------
A1AVV9_RUTMC          ------------------------------------------------------------
TATC_HALNC            ------------------------------------------------------------
Q47AM9_DECAR          ------------------------------------------------------------
E5APW1_PARRH          ------------------------------------------------------------
Q2YAV6_NITMU          ------------------------------------------------------------
Q31E59_HYDCU          ------------------------------------------------------------
Q48AI0_COLP3          ------------------------------------------------------------
G4QJK5_GLANF          ------------------------------------------------------------
D3SCC9_THISK          ------------------------------------------------------------
H8GJD2_METAL          ------------------------------------------------------------
K0C6J4_CYCSP          ------------------------------------------------------------
D3RQL8_ALLVD          ------------------------------------------------------------
I3YA58_THIV6          ------------------------------------------------------------
F6A8L5_PSEF1          ------------------------------------------------------------
TATC_HAEIN            ------------------------------------------------------------
TATC_ECOLI            ------------------------------------------------------------
H2IVX2_RAHAC          ------------------------------------------------------------
D1BNH6_VEIPT          ------------------------------------------------------------
A8MIP1_ALKOO          ------------------------------------------------------------
E1R121_SEDSS          ------------------------------------------------------------
D2RIN1_ACIFV          ------------------------------------------------------------
C6XIZ5_HIRBI          ------------------------------------------------------------
A0A0H3LXY3_BARHE      ------------------------------------------------------------
E0TEC0_PARBH          ------------------------------------------------------------
Q28T34_JANSC          ------------------------------------------------------------
TATC_RHOCB            ------------------------------------------------------------
A1B0H6_PARDP          ------------------------------------------------------------
Q0AND8_MARMM          ------------------------------------------------------------
Q2GER9_NEOSM          ------------------------------------------------------------
B3PIX7_CELJU          ------------------------------------------------------------
Q0C0W0_HYPNA          ------------------------------------------------------------
Q3SRQ3_NITWN          ------------------------------------------------------------
B9JXD9_AGRVS          ------------------------------------------------------------
Q98LC7_RHILO          ------------------------------------------------------------
D9QLG6_BRESC          ------------------------------------------------------------
B0T1Q5_CAUSK          ------------------------------------------------------------
C7JE44_ACEP3          ------------------------------------------------------------
Q2G9D2_NOVAD          ------------------------------------------------------------
TATC_MAGMM            ------------------------------------------------------------
D5BQU2_PUNMI          ------------------------------------------------------------
I3TKT9_TISMK          ------------------------------------------------------------
Q2RTH4_RHORT          ------------------------------------------------------------
Q6MGQ9_BDEBA          ------------------------------------------------------------
B2A204_NATTJ          ------------------------------------------------------------
A5D1I5_PELTS          ------------------------------------------------------------
B0TFS8_HELMI          ------------------------------------------------------------
D5X7P7_THEPJ          ------------------------------------------------------------
B8D1R3_HALOH          ------------------------------------------------------------
Q0AZ46_SYNWW          ------------------------------------------------------------
TATC_CARHZ            ------------------------------------------------------------
TATC_KORVE            ------------------------------------------------------------
C1F555_ACIC5          ------------------------------------------------------------
E8X125_GRATM          ------------------------------------------------------------
I3ZCY6_TERRK          ------------------------------------------------------------
D0LGH0_HALO1          ------------------------------------------------------------
Q2IM06_ANADE          ------------------------------------------------------------
A7H6D7_ANADF          ------------------------------------------------------------
B2V5Y3_SULSY          ------------------------------------------------------------
TATC_PELCD            ------------------------------------------------------------
F2LUZ5_HIPMA          ------------------------------------------------------------
D3UFV2_HELM1          ------------------------------------------------------------
B9LA52_NAUPA          ------------------------------------------------------------
E6X1G9_NITSE          ------------------------------------------------------------
TATC_CAMJE            ------------------------------------------------------------
A0A5B9TTD1_SULMU      ------------------------------------------------------------
A8Z6M5_CAMC1          ------------------------------------------------------------
B5YKH3_THEYD          ------------------------------------------------------------
E6W513_DESIS          ------------------------------------------------------------
E4TGB2_CALNY          ------------------------------------------------------------
E6VUV0_PSEA9          ------------------------------------------------------------
Q1MQT5_LAWIP          ------------------------------------------------------------
C8X1I2_DESRD          ------------------------------------------------------------
C6BSE0_DESAD          ------------------------------------------------------------
TATC_DESAH            ------------------------------------------------------------
A9A055_DESOH          ------------------------------------------------------------
C4XP92_DESMR          ------------------------------------------------------------
Q2LXN7_SYNAS          ------------------------------------------------------------
                                                                                  

I7CPH1_NATSJ          VILFYAWEPAKERGLVYGDRRTFIVWGGGLLAGFAVGTYLGFFWVAPSIISYLVSDALAN
TATCT_HALVD           VEDALAANMIITYRITNFFWLIFFTTAGIGLLADVPILMVLLNTAGISYRMMRNRWREVT
M1XZE0_NATM8          KVSVIFGAASTLPLLLYYAWPALKDRGLARGDRRVLLVWGGSLLTAMVLGSLFGFLYLAP
D3S1J6_FERPA          ------------------------------------------------------------
Q0W4Y5_METAR          ------------------------------------------------------------
Q97ZU3_SACS2          ------------------------------------------------------------
A8MCQ5_CALMQ          ------------------------------------------------------------
TATC_CENSY            ------------------------------------------------------------
Q6KZY6_PICTO          ------------------------------------------------------------
D3SVL3_NATMM          ------------------------------------------------------------
Q9HN36_HALSA          ------------------------------------------------------------
M1XNN2_NATM8          ------------------------------------------------------------
Q8TKC1_METAC          ------------------------------------------------------------
TATC_METAR            ------------------------------------------------------------
F8A8M8_THEID          ------------------------------------------------------------
C7N7W2_SLAHD          ------------------------------------------------------------
E1QWP7_OLSUV          ------------------------------------------------------------
E3HCZ3_ILYPC          ------------------------------------------------------------
B3QTN4_CHLT3          ------------------------------------------------------------
A6LCU1_PARD8          ------------------------------------------------------------
A6L6V5_BACV8          ------------------------------------------------------------
C6X0T6_FLAB3          ------------------------------------------------------------
C7PMH2_CHIPD          ------------------------------------------------------------
C6XV03_PEDHD          ------------------------------------------------------------
G2Z214_FLABF          ------------------------------------------------------------
G8R5N0_OWEHD          ------------------------------------------------------------
A3UAJ3_CROAH          ------------------------------------------------------------
A0A6N4SQV5_CYTH3      ------------------------------------------------------------
C6VXQ9_DYAFD          ------------------------------------------------------------
C8WRE5_ALIAD          ------------------------------------------------------------
D5EP26_CORAD          ------------------------------------------------------------
B1ZP28_OPITP          ------------------------------------------------------------
D6Z185_DESAT          ------------------------------------------------------------
TATC_AKKM8            ------------------------------------------------------------
D6ZGM8_MOBCV          ------------------------------------------------------------
E8N7E5_MICTS          ------------------------------------------------------------
C7MCX3_BRAFD          ------------------------------------------------------------
C7NHS2_KYTSD          ------------------------------------------------------------
E6SAM0_INTC7          ------------------------------------------------------------
TATC_XYLCX            ------------------------------------------------------------
A6W980_KINRD          ------------------------------------------------------------
TATC_ROTMD            ------------------------------------------------------------
C5CBV5_MICLC          ------------------------------------------------------------
E1VW56_GLUAR          ------------------------------------------------------------
A9WSH2_RENSM          ------------------------------------------------------------
B2GIN3_KOCRD          ------------------------------------------------------------
D3Q548_STANL          ------------------------------------------------------------
D7GEA7_PROFC          ------------------------------------------------------------
TATC_FRACC            ------------------------------------------------------------
D2ATT8_STRRD          ------------------------------------------------------------
Q47P16_THEFY          ------------------------------------------------------------
A0LU67_ACIC1          ------------------------------------------------------------
D2S6F0_GEOOG          ------------------------------------------------------------
C6WIE9_ACTMD          ------------------------------------------------------------
C8XAP1_NAKMY          ------------------------------------------------------------
B1VDV8_CORU7          ------------------------------------------------------------
D5UPM4_TSUPD          ------------------------------------------------------------
TATC_MYCTU            ------------------------------------------------------------
Q0SIG7_RHOJR          ------------------------------------------------------------
F6EP00_HOYSD          ------------------------------------------------------------
TATC_CORK4            ------------------------------------------------------------
Q8NQE5_CORGL          ------------------------------------------------------------
C7PVW6_CATAD          ------------------------------------------------------------
G2P670_STRV4          ------------------------------------------------------------
B1W318_STRGG          ------------------------------------------------------------
D2Q3I8_KRIFD          ------------------------------------------------------------
A1SK21_NOCSJ          ------------------------------------------------------------
Q2G128_STAA8          ------------------------------------------------------------
D5SQP1_PLAL2          ------------------------------------------------------------
E8R5A8_ISOPI          ------------------------------------------------------------
Q6AN67_DESPS          ------------------------------------------------------------
D6Z4B1_DESAT          ------------------------------------------------------------
B1HXK1_LYSSC          ------------------------------------------------------------
D6XUT8_BACIE          ------------------------------------------------------------
Q8EQG3_OCEIH          ------------------------------------------------------------
D5WSC2_KYRT2          ------------------------------------------------------------
C5D4F0_GEOSW          ------------------------------------------------------------
Q5WJP1_BACSK          ------------------------------------------------------------
TATC_BACHD            ------------------------------------------------------------
C0ZK48_BREBN          ------------------------------------------------------------
E3EID4_PAEPS          ------------------------------------------------------------
C6CVH0_PAESJ          ------------------------------------------------------------
D8K211_DEHLB          ------------------------------------------------------------
E6SMD5_THEM7          ------------------------------------------------------------
E8N519_ANATU          ------------------------------------------------------------
A5URY8_ROSS1          ------------------------------------------------------------
B9L0C4_THERP          ------------------------------------------------------------
D1CCN1_THET1          ------------------------------------------------------------
C7LYQ4_ACIFD          ------------------------------------------------------------
Q7UFI8_RHOBA          ------------------------------------------------------------
B3E195_METI4          ------------------------------------------------------------
Q1AUL3_RUBXD          ------------------------------------------------------------
Q7U568_SYNPX          ------------------------------------------------------------
TATC_ORYSJ            ------------------------------------------------------------
TATC_MAIZE            ------------------------------------------------------------
K3XJC3_SETIT          ------------------------------------------------------------
Q114K5_TRIEI          ------------------------------------------------------------
B0CFY2_ACAM1          ------------------------------------------------------------
E0UC67_GLOV7          ------------------------------------------------------------
C1A4F6_GEMAT          ------------------------------------------------------------
B3E7M3_GEOLS          ------------------------------------------------------------
E1X470_HALMS          ------------------------------------------------------------
A9EPV7_SORC5          ------------------------------------------------------------
Q67QH4_SYMTH          ------------------------------------------------------------
A9KHC2_LACP7          ------------------------------------------------------------
J9ZE06_LEPFM          ------------------------------------------------------------
Q023M6_SOLUE          ------------------------------------------------------------
TATC_DEIRA            ------------------------------------------------------------
D7BE12_MEISD          ------------------------------------------------------------
D7CQR8_TRURR          ------------------------------------------------------------
A5EVU4_DICNV          ------------------------------------------------------------
Q9PFU5_XYLFA          ------------------------------------------------------------
Q1H3X3_METFK          ------------------------------------------------------------
A9BXA9_DELAS          ------------------------------------------------------------
A1AVV9_RUTMC          ------------------------------------------------------------
TATC_HALNC            ------------------------------------------------------------
Q47AM9_DECAR          ------------------------------------------------------------
E5APW1_PARRH          ------------------------------------------------------------
Q2YAV6_NITMU          ------------------------------------------------------------
Q31E59_HYDCU          ------------------------------------------------------------
Q48AI0_COLP3          ------------------------------------------------------------
G4QJK5_GLANF          ------------------------------------------------------------
D3SCC9_THISK          ------------------------------------------------------------
H8GJD2_METAL          ------------------------------------------------------------
K0C6J4_CYCSP          ------------------------------------------------------------
D3RQL8_ALLVD          ------------------------------------------------------------
I3YA58_THIV6          ------------------------------------------------------------
F6A8L5_PSEF1          ------------------------------------------------------------
TATC_HAEIN            ------------------------------------------------------------
TATC_ECOLI            ------------------------------------------------------------
H2IVX2_RAHAC          ------------------------------------------------------------
D1BNH6_VEIPT          ------------------------------------------------------------
A8MIP1_ALKOO          ------------------------------------------------------------
E1R121_SEDSS          ------------------------------------------------------------
D2RIN1_ACIFV          ------------------------------------------------------------
C6XIZ5_HIRBI          ------------------------------------------------------------
A0A0H3LXY3_BARHE      ------------------------------------------------------------
E0TEC0_PARBH          ------------------------------------------------------------
Q28T34_JANSC          ------------------------------------------------------------
TATC_RHOCB            ------------------------------------------------------------
A1B0H6_PARDP          ------------------------------------------------------------
Q0AND8_MARMM          ------------------------------------------------------------
Q2GER9_NEOSM          ------------------------------------------------------------
B3PIX7_CELJU          ------------------------------------------------------------
Q0C0W0_HYPNA          ------------------------------------------------------------
Q3SRQ3_NITWN          ------------------------------------------------------------
B9JXD9_AGRVS          ------------------------------------------------------------
Q98LC7_RHILO          ------------------------------------------------------------
D9QLG6_BRESC          ------------------------------------------------------------
B0T1Q5_CAUSK          ------------------------------------------------------------
C7JE44_ACEP3          ------------------------------------------------------------
Q2G9D2_NOVAD          ------------------------------------------------------------
TATC_MAGMM            ------------------------------------------------------------
D5BQU2_PUNMI          ------------------------------------------------------------
I3TKT9_TISMK          ------------------------------------------------------------
Q2RTH4_RHORT          ------------------------------------------------------------
Q6MGQ9_BDEBA          ------------------------------------------------------------
B2A204_NATTJ          ------------------------------------------------------------
A5D1I5_PELTS          ------------------------------------------------------------
B0TFS8_HELMI          ------------------------------------------------------------
D5X7P7_THEPJ          ------------------------------------------------------------
B8D1R3_HALOH          ------------------------------------------------------------
Q0AZ46_SYNWW          ------------------------------------------------------------
TATC_CARHZ            ------------------------------------------------------------
TATC_KORVE            ------------------------------------------------------------
C1F555_ACIC5          ------------------------------------------------------------
E8X125_GRATM          ------------------------------------------------------------
I3ZCY6_TERRK          ------------------------------------------------------------
D0LGH0_HALO1          ------------------------------------------------------------
Q2IM06_ANADE          ------------------------------------------------------------
A7H6D7_ANADF          ------------------------------------------------------------
B2V5Y3_SULSY          ------------------------------------------------------------
TATC_PELCD            ------------------------------------------------------------
F2LUZ5_HIPMA          ------------------------------------------------------------
D3UFV2_HELM1          ------------------------------------------------------------
B9LA52_NAUPA          ------------------------------------------------------------
E6X1G9_NITSE          ------------------------------------------------------------
TATC_CAMJE            ------------------------------------------------------------
A0A5B9TTD1_SULMU      ------------------------------------------------------------
A8Z6M5_CAMC1          ------------------------------------------------------------
B5YKH3_THEYD          ------------------------------------------------------------
E6W513_DESIS          ------------------------------------------------------------
E4TGB2_CALNY          ------------------------------------------------------------
E6VUV0_PSEA9          ------------------------------------------------------------
Q1MQT5_LAWIP          ------------------------------------------------------------
C8X1I2_DESRD          ------------------------------------------------------------
C6BSE0_DESAD          ------------------------------------------------------------
TATC_DESAH            ------------------------------------------------------------
A9A055_DESOH          ------------------------------------------------------------
C4XP92_DESMR          ------------------------------------------------------------
Q2LXN7_SYNAS          ------------------------------------------------------------
                                                                                  

I7CPH1_NATSJ          KMVVSYRIKSFFWLVIFTTVGIGFLLNIIVTMALFHVGGIVSYRSMLERWRPVVVGIFVV
TATCT_HALVD           VFILAISAVFTPASITTMFMVTLPLMAAYGVGLGVLFVLTVGGRRDLSPARGAAE-----
M1XZE0_NATM8          TAISWLASDVLDAGMVIAYRISNYGWMIFFFTVGIGILVMVPVTMLLFHRGGIVPYGVFR
D3S1J6_FERPA          ------------------------------------------------------------
Q0W4Y5_METAR          ------------------------------------------------------------
Q97ZU3_SACS2          ------------------------------------------------------------
A8MCQ5_CALMQ          ------------------------------------------------------------
TATC_CENSY            ------------------------------------------------------------
Q6KZY6_PICTO          ------------------------------------------------------------
D3SVL3_NATMM          ------------------------------------------------------------
Q9HN36_HALSA          ------------------------------------------------------------
M1XNN2_NATM8          ------------------------------------------------------------
Q8TKC1_METAC          ------------------------------------------------------------
TATC_METAR            ------------------------------------------------------------
F8A8M8_THEID          ------------------------------------------------------------
C7N7W2_SLAHD          ------------------------------------------------------------
E1QWP7_OLSUV          ------------------------------------------------------------
E3HCZ3_ILYPC          ------------------------------------------------------------
B3QTN4_CHLT3          ------------------------------------------------------------
A6LCU1_PARD8          ------------------------------------------------------------
A6L6V5_BACV8          ------------------------------------------------------------
C6X0T6_FLAB3          ------------------------------------------------------------
C7PMH2_CHIPD          ------------------------------------------------------------
C6XV03_PEDHD          ------------------------------------------------------------
G2Z214_FLABF          ------------------------------------------------------------
G8R5N0_OWEHD          ------------------------------------------------------------
A3UAJ3_CROAH          ------------------------------------------------------------
A0A6N4SQV5_CYTH3      ------------------------------------------------------------
C6VXQ9_DYAFD          ------------------------------------------------------------
C8WRE5_ALIAD          ------------------------------------------------------------
D5EP26_CORAD          ------------------------------------------------------------
B1ZP28_OPITP          ------------------------------------------------------------
D6Z185_DESAT          ------------------------------------------------------------
TATC_AKKM8            ------------------------------------------------------------
D6ZGM8_MOBCV          ------------------------------------------------------------
E8N7E5_MICTS          ------------------------------------------------------------
C7MCX3_BRAFD          ------------------------------------------------------------
C7NHS2_KYTSD          ------------------------------------------------------------
E6SAM0_INTC7          ------------------------------------------------------------
TATC_XYLCX            ------------------------------------------------------------
A6W980_KINRD          ------------------------------------------------------------
TATC_ROTMD            ------------------------------------------------------------
C5CBV5_MICLC          ------------------------------------------------------------
E1VW56_GLUAR          ------------------------------------------------------------
A9WSH2_RENSM          ------------------------------------------------------------
B2GIN3_KOCRD          ------------------------------------------------------------
D3Q548_STANL          ------------------------------------------------------------
D7GEA7_PROFC          ------------------------------------------------------------
TATC_FRACC            ------------------------------------------------------------
D2ATT8_STRRD          ------------------------------------------------------------
Q47P16_THEFY          ------------------------------------------------------------
A0LU67_ACIC1          ------------------------------------------------------------
D2S6F0_GEOOG          ------------------------------------------------------------
C6WIE9_ACTMD          ------------------------------------------------------------
C8XAP1_NAKMY          ------------------------------------------------------------
B1VDV8_CORU7          ------------------------------------------------------------
D5UPM4_TSUPD          ------------------------------------------------------------
TATC_MYCTU            ------------------------------------------------------------
Q0SIG7_RHOJR          ------------------------------------------------------------
F6EP00_HOYSD          ------------------------------------------------------------
TATC_CORK4            ------------------------------------------------------------
Q8NQE5_CORGL          ------------------------------------------------------------
C7PVW6_CATAD          ------------------------------------------------------------
G2P670_STRV4          ------------------------------------------------------------
B1W318_STRGG          ------------------------------------------------------------
D2Q3I8_KRIFD          ------------------------------------------------------------
A1SK21_NOCSJ          ------------------------------------------------------------
Q2G128_STAA8          ------------------------------------------------------------
D5SQP1_PLAL2          ------------------------------------------------------------
E8R5A8_ISOPI          ------------------------------------------------------------
Q6AN67_DESPS          ------------------------------------------------------------
D6Z4B1_DESAT          ------------------------------------------------------------
B1HXK1_LYSSC          ------------------------------------------------------------
D6XUT8_BACIE          ------------------------------------------------------------
Q8EQG3_OCEIH          ------------------------------------------------------------
D5WSC2_KYRT2          ------------------------------------------------------------
C5D4F0_GEOSW          ------------------------------------------------------------
Q5WJP1_BACSK          ------------------------------------------------------------
TATC_BACHD            ------------------------------------------------------------
C0ZK48_BREBN          ------------------------------------------------------------
E3EID4_PAEPS          ------------------------------------------------------------
C6CVH0_PAESJ          ------------------------------------------------------------
D8K211_DEHLB          ------------------------------------------------------------
E6SMD5_THEM7          ------------------------------------------------------------
E8N519_ANATU          ------------------------------------------------------------
A5URY8_ROSS1          ------------------------------------------------------------
B9L0C4_THERP          ------------------------------------------------------------
D1CCN1_THET1          ------------------------------------------------------------
C7LYQ4_ACIFD          ------------------------------------------------------------
Q7UFI8_RHOBA          ------------------------------------------------------------
B3E195_METI4          ------------------------------------------------------------
Q1AUL3_RUBXD          ------------------------------------------------------------
Q7U568_SYNPX          ------------------------------------------------------------
TATC_ORYSJ            ------------------------------------------------------------
TATC_MAIZE            ------------------------------------------------------------
K3XJC3_SETIT          ------------------------------------------------------------
Q114K5_TRIEI          ------------------------------------------------------------
B0CFY2_ACAM1          ------------------------------------------------------------
E0UC67_GLOV7          ------------------------------------------------------------
C1A4F6_GEMAT          ------------------------------------------------------------
B3E7M3_GEOLS          ------------------------------------------------------------
E1X470_HALMS          ------------------------------------------------------------
A9EPV7_SORC5          ------------------------------------------------------------
Q67QH4_SYMTH          ------------------------------------------------------------
A9KHC2_LACP7          ------------------------------------------------------------
J9ZE06_LEPFM          ------------------------------------------------------------
Q023M6_SOLUE          ------------------------------------------------------------
TATC_DEIRA            ------------------------------------------------------------
D7BE12_MEISD          ------------------------------------------------------------
D7CQR8_TRURR          ------------------------------------------------------------
A5EVU4_DICNV          ------------------------------------------------------------
Q9PFU5_XYLFA          ------------------------------------------------------------
Q1H3X3_METFK          ------------------------------------------------------------
A9BXA9_DELAS          ------------------------------------------------------------
A1AVV9_RUTMC          ------------------------------------------------------------
TATC_HALNC            ------------------------------------------------------------
Q47AM9_DECAR          ------------------------------------------------------------
E5APW1_PARRH          ------------------------------------------------------------
Q2YAV6_NITMU          ------------------------------------------------------------
Q31E59_HYDCU          ------------------------------------------------------------
Q48AI0_COLP3          ------------------------------------------------------------
G4QJK5_GLANF          ------------------------------------------------------------
D3SCC9_THISK          ------------------------------------------------------------
H8GJD2_METAL          ------------------------------------------------------------
K0C6J4_CYCSP          ------------------------------------------------------------
D3RQL8_ALLVD          ------------------------------------------------------------
I3YA58_THIV6          ------------------------------------------------------------
F6A8L5_PSEF1          ------------------------------------------------------------
TATC_HAEIN            ------------------------------------------------------------
TATC_ECOLI            ------------------------------------------------------------
H2IVX2_RAHAC          ------------------------------------------------------------
D1BNH6_VEIPT          ------------------------------------------------------------
A8MIP1_ALKOO          ------------------------------------------------------------
E1R121_SEDSS          ------------------------------------------------------------
D2RIN1_ACIFV          ------------------------------------------------------------
C6XIZ5_HIRBI          ------------------------------------------------------------
A0A0H3LXY3_BARHE      ------------------------------------------------------------
E0TEC0_PARBH          ------------------------------------------------------------
Q28T34_JANSC          ------------------------------------------------------------
TATC_RHOCB            ------------------------------------------------------------
A1B0H6_PARDP          ------------------------------------------------------------
Q0AND8_MARMM          ------------------------------------------------------------
Q2GER9_NEOSM          ------------------------------------------------------------
B3PIX7_CELJU          ------------------------------------------------------------
Q0C0W0_HYPNA          ------------------------------------------------------------
Q3SRQ3_NITWN          ------------------------------------------------------------
B9JXD9_AGRVS          ------------------------------------------------------------
Q98LC7_RHILO          ------------------------------------------------------------
D9QLG6_BRESC          ------------------------------------------------------------
B0T1Q5_CAUSK          ------------------------------------------------------------
C7JE44_ACEP3          ------------------------------------------------------------
Q2G9D2_NOVAD          ------------------------------------------------------------
TATC_MAGMM            ------------------------------------------------------------
D5BQU2_PUNMI          ------------------------------------------------------------
I3TKT9_TISMK          ------------------------------------------------------------
Q2RTH4_RHORT          ------------------------------------------------------------
Q6MGQ9_BDEBA          ------------------------------------------------------------
B2A204_NATTJ          ------------------------------------------------------------
A5D1I5_PELTS          ------------------------------------------------------------
B0TFS8_HELMI          ------------------------------------------------------------
D5X7P7_THEPJ          ------------------------------------------------------------
B8D1R3_HALOH          ------------------------------------------------------------
Q0AZ46_SYNWW          ------------------------------------------------------------
TATC_CARHZ            ------------------------------------------------------------
TATC_KORVE            ------------------------------------------------------------
C1F555_ACIC5          ------------------------------------------------------------
E8X125_GRATM          ------------------------------------------------------------
I3ZCY6_TERRK          ------------------------------------------------------------
D0LGH0_HALO1          ------------------------------------------------------------
Q2IM06_ANADE          ------------------------------------------------------------
A7H6D7_ANADF          ------------------------------------------------------------
B2V5Y3_SULSY          ------------------------------------------------------------
TATC_PELCD            ------------------------------------------------------------
F2LUZ5_HIPMA          ------------------------------------------------------------
D3UFV2_HELM1          ------------------------------------------------------------
B9LA52_NAUPA          ------------------------------------------------------------
E6X1G9_NITSE          ------------------------------------------------------------
TATC_CAMJE            ------------------------------------------------------------
A0A5B9TTD1_SULMU      ------------------------------------------------------------
A8Z6M5_CAMC1          ------------------------------------------------------------
B5YKH3_THEYD          ------------------------------------------------------------
E6W513_DESIS          ------------------------------------------------------------
E4TGB2_CALNY          ------------------------------------------------------------
E6VUV0_PSEA9          ------------------------------------------------------------
Q1MQT5_LAWIP          ------------------------------------------------------------
C8X1I2_DESRD          ------------------------------------------------------------
C6BSE0_DESAD          ------------------------------------------------------------
TATC_DESAH            ------------------------------------------------------------
A9A055_DESOH          ------------------------------------------------------------
C4XP92_DESMR          ------------------------------------------------------------
Q2LXN7_SYNAS          ------------------------------------------------------------
                                                                                  

I7CPH1_NATSJ          AAFFSPKGILMMLLFAIPISFTYLLGLAILYVLTAGGRLFGGSGGSAAESDAEDTGVAAT
TATCT_HALVD           ------------------------------------------------------------
M1XZE0_NATM8          TRWREFAIAVLAAGAFLSPRGIFTMFLLGVPIIAAYGLGLGSLWLYTLGGRRVPEAAEPA
D3S1J6_FERPA          ------------------------------------------------------------
Q0W4Y5_METAR          ------------------------------------------------------------
Q97ZU3_SACS2          ------------------------------------------------------------
A8MCQ5_CALMQ          ------------------------------------------------------------
TATC_CENSY            ------------------------------------------------------------
Q6KZY6_PICTO          ------------------------------------------------------------
D3SVL3_NATMM          ------------------------------------------------------------
Q9HN36_HALSA          ------------------------------------------------------------
M1XNN2_NATM8          ------------------------------------------------------------
Q8TKC1_METAC          ------------------------------------------------------------
TATC_METAR            ------------------------------------------------------------
F8A8M8_THEID          ------------------------------------------------------------
C7N7W2_SLAHD          ------------------------------------------------------------
E1QWP7_OLSUV          ------------------------------------------------------------
E3HCZ3_ILYPC          ------------------------------------------------------------
B3QTN4_CHLT3          ------------------------------------------------------------
A6LCU1_PARD8          ------------------------------------------------------------
A6L6V5_BACV8          ------------------------------------------------------------
C6X0T6_FLAB3          ------------------------------------------------------------
C7PMH2_CHIPD          ------------------------------------------------------------
C6XV03_PEDHD          ------------------------------------------------------------
G2Z214_FLABF          ------------------------------------------------------------
G8R5N0_OWEHD          ------------------------------------------------------------
A3UAJ3_CROAH          ------------------------------------------------------------
A0A6N4SQV5_CYTH3      ------------------------------------------------------------
C6VXQ9_DYAFD          ------------------------------------------------------------
C8WRE5_ALIAD          ------------------------------------------------------------
D5EP26_CORAD          ------------------------------------------------------------
B1ZP28_OPITP          ------------------------------------------------------------
D6Z185_DESAT          ------------------------------------------------------------
TATC_AKKM8            ------------------------------------------------------------
D6ZGM8_MOBCV          ------------------------------------------------------------
E8N7E5_MICTS          ------------------------------------------------------------
C7MCX3_BRAFD          ------------------------------------------------------------
C7NHS2_KYTSD          ------------------------------------------------------------
E6SAM0_INTC7          ------------------------------------------------------------
TATC_XYLCX            ------------------------------------------------------------
A6W980_KINRD          ------------------------------------------------------------
TATC_ROTMD            ------------------------------------------------------------
C5CBV5_MICLC          ------------------------------------------------------------
E1VW56_GLUAR          ------------------------------------------------------------
A9WSH2_RENSM          ------------------------------------------------------------
B2GIN3_KOCRD          ------------------------------------------------------------
D3Q548_STANL          ------------------------------------------------------------
D7GEA7_PROFC          ------------------------------------------------------------
TATC_FRACC            ------------------------------------------------------------
D2ATT8_STRRD          ------------------------------------------------------------
Q47P16_THEFY          ------------------------------------------------------------
A0LU67_ACIC1          ------------------------------------------------------------
D2S6F0_GEOOG          ------------------------------------------------------------
C6WIE9_ACTMD          ------------------------------------------------------------
C8XAP1_NAKMY          ------------------------------------------------------------
B1VDV8_CORU7          ------------------------------------------------------------
D5UPM4_TSUPD          ------------------------------------------------------------
TATC_MYCTU            ------------------------------------------------------------
Q0SIG7_RHOJR          ------------------------------------------------------------
F6EP00_HOYSD          ------------------------------------------------------------
TATC_CORK4            ------------------------------------------------------------
Q8NQE5_CORGL          ------------------------------------------------------------
C7PVW6_CATAD          ------------------------------------------------------------
G2P670_STRV4          ------------------------------------------------------------
B1W318_STRGG          ------------------------------------------------------------
D2Q3I8_KRIFD          ------------------------------------------------------------
A1SK21_NOCSJ          ------------------------------------------------------------
Q2G128_STAA8          ------------------------------------------------------------
D5SQP1_PLAL2          ------------------------------------------------------------
E8R5A8_ISOPI          ------------------------------------------------------------
Q6AN67_DESPS          ------------------------------------------------------------
D6Z4B1_DESAT          ------------------------------------------------------------
B1HXK1_LYSSC          ------------------------------------------------------------
D6XUT8_BACIE          ------------------------------------------------------------
Q8EQG3_OCEIH          ------------------------------------------------------------
D5WSC2_KYRT2          ------------------------------------------------------------
C5D4F0_GEOSW          ------------------------------------------------------------
Q5WJP1_BACSK          ------------------------------------------------------------
TATC_BACHD            ------------------------------------------------------------
C0ZK48_BREBN          ------------------------------------------------------------
E3EID4_PAEPS          ------------------------------------------------------------
C6CVH0_PAESJ          ------------------------------------------------------------
D8K211_DEHLB          ------------------------------------------------------------
E6SMD5_THEM7          ------------------------------------------------------------
E8N519_ANATU          ------------------------------------------------------------
A5URY8_ROSS1          ------------------------------------------------------------
B9L0C4_THERP          ------------------------------------------------------------
D1CCN1_THET1          ------------------------------------------------------------
C7LYQ4_ACIFD          ------------------------------------------------------------
Q7UFI8_RHOBA          ------------------------------------------------------------
B3E195_METI4          ------------------------------------------------------------
Q1AUL3_RUBXD          ------------------------------------------------------------
Q7U568_SYNPX          ------------------------------------------------------------
TATC_ORYSJ            ------------------------------------------------------------
TATC_MAIZE            ------------------------------------------------------------
K3XJC3_SETIT          ------------------------------------------------------------
Q114K5_TRIEI          ------------------------------------------------------------
B0CFY2_ACAM1          ------------------------------------------------------------
E0UC67_GLOV7          ------------------------------------------------------------
C1A4F6_GEMAT          ------------------------------------------------------------
B3E7M3_GEOLS          ------------------------------------------------------------
E1X470_HALMS          ------------------------------------------------------------
A9EPV7_SORC5          ------------------------------------------------------------
Q67QH4_SYMTH          ------------------------------------------------------------
A9KHC2_LACP7          ------------------------------------------------------------
J9ZE06_LEPFM          ------------------------------------------------------------
Q023M6_SOLUE          ------------------------------------------------------------
TATC_DEIRA            ------------------------------------------------------------
D7BE12_MEISD          ------------------------------------------------------------
D7CQR8_TRURR          ------------------------------------------------------------
A5EVU4_DICNV          ------------------------------------------------------------
Q9PFU5_XYLFA          ------------------------------------------------------------
Q1H3X3_METFK          ------------------------------------------------------------
A9BXA9_DELAS          ------------------------------------------------------------
A1AVV9_RUTMC          ------------------------------------------------------------
TATC_HALNC            ------------------------------------------------------------
Q47AM9_DECAR          ------------------------------------------------------------
E5APW1_PARRH          ------------------------------------------------------------
Q2YAV6_NITMU          ------------------------------------------------------------
Q31E59_HYDCU          ------------------------------------------------------------
Q48AI0_COLP3          ------------------------------------------------------------
G4QJK5_GLANF          ------------------------------------------------------------
D3SCC9_THISK          ------------------------------------------------------------
H8GJD2_METAL          ------------------------------------------------------------
K0C6J4_CYCSP          ------------------------------------------------------------
D3RQL8_ALLVD          ------------------------------------------------------------
I3YA58_THIV6          ------------------------------------------------------------
F6A8L5_PSEF1          ------------------------------------------------------------
TATC_HAEIN            ------------------------------------------------------------
TATC_ECOLI            ------------------------------------------------------------
H2IVX2_RAHAC          ------------------------------------------------------------
D1BNH6_VEIPT          ------------------------------------------------------------
A8MIP1_ALKOO          ------------------------------------------------------------
E1R121_SEDSS          ------------------------------------------------------------
D2RIN1_ACIFV          ------------------------------------------------------------
C6XIZ5_HIRBI          ------------------------------------------------------------
A0A0H3LXY3_BARHE      ------------------------------------------------------------
E0TEC0_PARBH          ------------------------------------------------------------
Q28T34_JANSC          ------------------------------------------------------------
TATC_RHOCB            ------------------------------------------------------------
A1B0H6_PARDP          ------------------------------------------------------------
Q0AND8_MARMM          ------------------------------------------------------------
Q2GER9_NEOSM          ------------------------------------------------------------
B3PIX7_CELJU          ------------------------------------------------------------
Q0C0W0_HYPNA          ------------------------------------------------------------
Q3SRQ3_NITWN          ------------------------------------------------------------
B9JXD9_AGRVS          ------------------------------------------------------------
Q98LC7_RHILO          ------------------------------------------------------------
D9QLG6_BRESC          ------------------------------------------------------------
B0T1Q5_CAUSK          ------------------------------------------------------------
C7JE44_ACEP3          ------------------------------------------------------------
Q2G9D2_NOVAD          ------------------------------------------------------------
TATC_MAGMM            ------------------------------------------------------------
D5BQU2_PUNMI          ------------------------------------------------------------
I3TKT9_TISMK          ------------------------------------------------------------
Q2RTH4_RHORT          ------------------------------------------------------------
Q6MGQ9_BDEBA          ------------------------------------------------------------
B2A204_NATTJ          ------------------------------------------------------------
A5D1I5_PELTS          ------------------------------------------------------------
B0TFS8_HELMI          ------------------------------------------------------------
D5X7P7_THEPJ          ------------------------------------------------------------
B8D1R3_HALOH          ------------------------------------------------------------
Q0AZ46_SYNWW          ------------------------------------------------------------
TATC_CARHZ            ------------------------------------------------------------
TATC_KORVE            ------------------------------------------------------------
C1F555_ACIC5          ------------------------------------------------------------
E8X125_GRATM          ------------------------------------------------------------
I3ZCY6_TERRK          ------------------------------------------------------------
D0LGH0_HALO1          ------------------------------------------------------------
Q2IM06_ANADE          ------------------------------------------------------------
A7H6D7_ANADF          ------------------------------------------------------------
B2V5Y3_SULSY          ------------------------------------------------------------
TATC_PELCD            ------------------------------------------------------------
F2LUZ5_HIPMA          ------------------------------------------------------------
D3UFV2_HELM1          ------------------------------------------------------------
B9LA52_NAUPA          ------------------------------------------------------------
E6X1G9_NITSE          ------------------------------------------------------------
TATC_CAMJE            ------------------------------------------------------------
A0A5B9TTD1_SULMU      ------------------------------------------------------------
A8Z6M5_CAMC1          ------------------------------------------------------------
B5YKH3_THEYD          ------------------------------------------------------------
E6W513_DESIS          ------------------------------------------------------------
E4TGB2_CALNY          ------------------------------------------------------------
E6VUV0_PSEA9          ------------------------------------------------------------
Q1MQT5_LAWIP          ------------------------------------------------------------
C8X1I2_DESRD          ------------------------------------------------------------
C6BSE0_DESAD          ------------------------------------------------------------
TATC_DESAH            ------------------------------------------------------------
A9A055_DESOH          ------------------------------------------------------------
C4XP92_DESMR          ------------------------------------------------------------
Q2LXN7_SYNAS          ------------------------------------------------------------
                                                                                  

I7CPH1_NATSJ          E
TATCT_HALVD           -
M1XZE0_NATM8          D
D3S1J6_FERPA          -
Q0W4Y5_METAR          -
Q97ZU3_SACS2          -
A8MCQ5_CALMQ          -
TATC_CENSY            -
Q6KZY6_PICTO          -
D3SVL3_NATMM          -
Q9HN36_HALSA          -
M1XNN2_NATM8          -
Q8TKC1_METAC          -
TATC_METAR            -
F8A8M8_THEID          -
C7N7W2_SLAHD          -
E1QWP7_OLSUV          -
E3HCZ3_ILYPC          -
B3QTN4_CHLT3          -
A6LCU1_PARD8          -
A6L6V5_BACV8          -
C6X0T6_FLAB3          -
C7PMH2_CHIPD          -
C6XV03_PEDHD          -
G2Z214_FLABF          -
G8R5N0_OWEHD          -
A3UAJ3_CROAH          -
A0A6N4SQV5_CYTH3      -
C6VXQ9_DYAFD          -
C8WRE5_ALIAD          -
D5EP26_CORAD          -
B1ZP28_OPITP          -
D6Z185_DESAT          -
TATC_AKKM8            -
D6ZGM8_MOBCV          -
E8N7E5_MICTS          -
C7MCX3_BRAFD          -
C7NHS2_KYTSD          -
E6SAM0_INTC7          -
TATC_XYLCX            -
A6W980_KINRD          -
TATC_ROTMD            -
C5CBV5_MICLC          -
E1VW56_GLUAR          -
A9WSH2_RENSM          -
B2GIN3_KOCRD          -
D3Q548_STANL          -
D7GEA7_PROFC          -
TATC_FRACC            -
D2ATT8_STRRD          -
Q47P16_THEFY          -
A0LU67_ACIC1          -
D2S6F0_GEOOG          -
C6WIE9_ACTMD          -
C8XAP1_NAKMY          -
B1VDV8_CORU7          -
D5UPM4_TSUPD          -
TATC_MYCTU            -
Q0SIG7_RHOJR          -
F6EP00_HOYSD          -
TATC_CORK4            -
Q8NQE5_CORGL          -
C7PVW6_CATAD          -
G2P670_STRV4          -
B1W318_STRGG          -
D2Q3I8_KRIFD          -
A1SK21_NOCSJ          -
Q2G128_STAA8          -
D5SQP1_PLAL2          -
E8R5A8_ISOPI          -
Q6AN67_DESPS          -
D6Z4B1_DESAT          -
B1HXK1_LYSSC          -
D6XUT8_BACIE          -
Q8EQG3_OCEIH          -
D5WSC2_KYRT2          -
C5D4F0_GEOSW          -
Q5WJP1_BACSK          -
TATC_BACHD            -
C0ZK48_BREBN          -
E3EID4_PAEPS          -
C6CVH0_PAESJ          -
D8K211_DEHLB          -
E6SMD5_THEM7          -
E8N519_ANATU          -
A5URY8_ROSS1          -
B9L0C4_THERP          -
D1CCN1_THET1          -
C7LYQ4_ACIFD          -
Q7UFI8_RHOBA          -
B3E195_METI4          -
Q1AUL3_RUBXD          -
Q7U568_SYNPX          -
TATC_ORYSJ            -
TATC_MAIZE            -
K3XJC3_SETIT          -
Q114K5_TRIEI          -
B0CFY2_ACAM1          -
E0UC67_GLOV7          -
C1A4F6_GEMAT          -
B3E7M3_GEOLS          -
E1X470_HALMS          -
A9EPV7_SORC5          -
Q67QH4_SYMTH          -
A9KHC2_LACP7          -
J9ZE06_LEPFM          -
Q023M6_SOLUE          -
TATC_DEIRA            -
D7BE12_MEISD          -
D7CQR8_TRURR          -
A5EVU4_DICNV          -
Q9PFU5_XYLFA          -
Q1H3X3_METFK          -
A9BXA9_DELAS          -
A1AVV9_RUTMC          -
TATC_HALNC            -
Q47AM9_DECAR          -
E5APW1_PARRH          -
Q2YAV6_NITMU          -
Q31E59_HYDCU          -
Q48AI0_COLP3          -
G4QJK5_GLANF          -
D3SCC9_THISK          -
H8GJD2_METAL          -
K0C6J4_CYCSP          -
D3RQL8_ALLVD          -
I3YA58_THIV6          -
F6A8L5_PSEF1          -
TATC_HAEIN            -
TATC_ECOLI            -
H2IVX2_RAHAC          -
D1BNH6_VEIPT          -
A8MIP1_ALKOO          -
E1R121_SEDSS          -
D2RIN1_ACIFV          -
C6XIZ5_HIRBI          -
A0A0H3LXY3_BARHE      -
E0TEC0_PARBH          -
Q28T34_JANSC          -
TATC_RHOCB            -
A1B0H6_PARDP          -
Q0AND8_MARMM          -
Q2GER9_NEOSM          -
B3PIX7_CELJU          -
Q0C0W0_HYPNA          -
Q3SRQ3_NITWN          -
B9JXD9_AGRVS          -
Q98LC7_RHILO          -
D9QLG6_BRESC          -
B0T1Q5_CAUSK          -
C7JE44_ACEP3          -
Q2G9D2_NOVAD          -
TATC_MAGMM            -
D5BQU2_PUNMI          -
I3TKT9_TISMK          -
Q2RTH4_RHORT          -
Q6MGQ9_BDEBA          -
B2A204_NATTJ          -
A5D1I5_PELTS          -
B0TFS8_HELMI          -
D5X7P7_THEPJ          -
B8D1R3_HALOH          -
Q0AZ46_SYNWW          -
TATC_CARHZ            -
TATC_KORVE            -
C1F555_ACIC5          -
E8X125_GRATM          -
I3ZCY6_TERRK          -
D0LGH0_HALO1          -
Q2IM06_ANADE          -
A7H6D7_ANADF          -
B2V5Y3_SULSY          -
TATC_PELCD            -
F2LUZ5_HIPMA          -
D3UFV2_HELM1          -
B9LA52_NAUPA          -
E6X1G9_NITSE          -
TATC_CAMJE            -
A0A5B9TTD1_SULMU      -
A8Z6M5_CAMC1          -
B5YKH3_THEYD          -
E6W513_DESIS          -
E4TGB2_CALNY          -
E6VUV0_PSEA9          -
Q1MQT5_LAWIP          -
C8X1I2_DESRD          -
C6BSE0_DESAD          -
TATC_DESAH            -
A9A055_DESOH          -
C4XP92_DESMR          -
Q2LXN7_SYNAS          -