CLUSTAL format seed alignment for MF_00904

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

D2T3K1_ERWP6          -----MITALLKKCAPQRRFLPWLVVAIVALTGLAKIPALFRHDSTLQIRASRQGVSLPD
E3DFH1_ERWSE          -------------------------MAIVALTGLAIIPALFRHDSTLQIRASRQGVSLPD
MZRA_ERWAC            -----MTTASIKKRDPRRRLLPWLIVAFVALIGLAMIPALFRHDSTLQIRASRQGVSLPD
MZRA_ERWT9            -----MIAAFIKRHAPQRRLSLWLALPVVALLALVMMPALFRHDSALQIRASRQGASLPD
MZRA_ERWBE            ------MLALLRPYLSTR-VLCVLVVCFSALMLVAFIPTLFRNDTALQIRASRQGTTLPD
MZRA_PANAA            ---------MKPLHAFPKRWLPWLIGGAFALVAISMMPSLMRHENVVQIRVSHAGAPMPD
D4GNS2_PANAM          ---------MKPLHAFPKRWLPWLIGGAFALVAVSMMPSLMRHENVVQIRVSHAGAPMPD
E1SEZ5_PANVC          ---------MKLLQAIPKRWIPWLIAGALALTALCVVPPLMQHETVVQIRVSHAGATLPD
MZRA_PANSA            ---------MKILTRIPRRLLPWLLGGALALVAVSFAPALLSHETVVQIRVANSGTPLPD
MZRA_ECOLI            ---------MQIPRMSLRQLAWSGAVLLLVGTLLLAWSAVRQQESTLAIRAVHQGTTMPD
B7LH35_ECO55          ---------MQIPRMSLRQLAWSGTVLLLVGTLLLAWSAVRQQESTLAIHAVHQGTTMPD
B7UJ03_ECO27          ---------MQIPRMSLRQLAWSGAVILLVSTLLLAWSAVRQQESTLAIRAVHQGTTMPD
Q0T0G9_SHIF8          ---------MQIPRMSLRQLAWSGTVLLLVGTLLLAWSAVRQQESTLAIRAIHQGTTMPD
MZRA_CITRI            ---------MRKPRVTLRHLAWSTMLLMVLGTGMLFWSAVRQQESTLAIRSIHQGASMPD
A8APZ0_CITK8          ---------MVKPHITLRQLAWTTSFLVLMSVLFLVWSTIRQQESTLAIRAIHQGVSMPD
MZRA_ESCF3            ---------MQLPRVTLRQMTWTTSAIVLLGITLLLWSAFRHQESTLAIRAINQGTTMPD
B5REI4_SALG2          ---------MLKPRITARQLIWISAFLLMLTILMMTWSTLRQQESTLAIRAVNQGASMPD
MZRA_SALA4            ---------MLKPRITARQLIWISAFLLMLTILMMTWSTLRQQESTLAIRAVNLGASMPD
A9MPT5_SALAR          ---------MLKPRITARQFIWISAFLLMLTVLMVAWSTLRQQESTLAIRAVNQGASIPD
MZRA_ENTLS            ---------MGLQNMTLRRFTLSMSALLLLCALLWLWAALEQQESSLAIRPVTPNTSMPD
L0LYB2_ENTBF          ---------MGLKQVTLRRFTLSLGALLLFCAILWLCAALQQKESTLAIRPLNQGASMPD
B5XTW3_KLEP3          ---------MVIKRPSLRQLSWLLGGSLVLCALFWLWLAVQQQEATLAIRPVGQGVSMPD
MZRA_KLEP7            --------MMVMKRPSLRQFSWLLGGSLLLGALFWLWLAVQQQEATLAIRPVGQGIGMPD
A0A198H104_9ENTR      ---------MVISPLSLRRLSYALIVLVFFSAMLLIWTALQHQESTLAIRPVNQGASVPD
MZRA_ENT38            ---------MVISPLALRRLSYGLIALVLLSALILVWTALQRQESTLAIRPVSQGASVPD
MZRA_CROS8            ---------MAFTRALSRRLTLMLSAGALLAAMLLCWAALQKHETTLEIRAVSQGATIPD
I2B4Y0_SHIBC          ----------MSNRFLLRHLTW---LFLCLAIAVAMWSVLQHKEATLEIRATQSGVATPD
MZRA_SERP5            -MIK------RPRWQY-----VLLIALALLALATLLVPCMVRTESELRIRAGQQGLSLPD
W0LBG2_9GAMM          -MAQ------RPRWQY-----ALIIALALLALTIVLVPYMVHTESELRIQSVHQGLSLPD
A1JR44_YERE8          -MINFRGRFGRPVWHY-----LILPVTVLLLAALLFTPIIMRTESALKIRPNQQGLSLPD
MZRA_YERPP            -MINFRGRFGRPLWHY-----LVLPVVLLLLAVILLTPMIVQTESTLKIRPNQQGLSLPD
MZRA_RAHSY            -MNR--RLLKRSFIWP-----LLLMLLAAATMIGLAVSRLPAPTSALQIRPARAGVALPD
H2ITH2_RAHAC          -MNR--RLLKRSFIWP-----LLIILVAVA-MIGLTVSRLPAQAGTLQIRPARAGVALPD
MZRA_DICZ5            -MNS--PGLRKPTIWR-----PLLLLFPLLALLLSMSSPRLPDEVMLHITPLHQGMTLPD
C6CKG0_DICC1          -------MLRKPLIWR-----ALLHLLPLAVLLLTMSSQRLPDEVMLHITPLHQGASLPD
MZRA_DICD3            MMTN--RRFRKPSAWR-----LLLLLLPL-VVLLSMSSRRLPDEVMLHITPLHQGAPLPD
MZRA_DICP7            -MIN--RRMKTGFVFH-----LLLLLLPL--VVLVTSSRRTADDVTLHIIPQHQGAALPD
MZRA_PECCP            -MSI--RWLFPKLTPRKVARILILLALPIIALTQSQSLRHSQDDAMLHIKP-YDGAALPD
A0A0H3I4I7_PECPM      -MSI--RGLFPKLSPRKVGRILLLLALPLIALTQSQSLRHSQDDAMLHIKP-YEGSALPD
Q6D9H4_PECAS          -MSI--RWLSPTLSPRKIGRILLLLALPIIALTQSQPPRHSQDDAMLHIKP-YDGAALPD
D0ZB98_EDWTE          ---MNQANSQPFTRRQGWKRMLGLLLFIVAALTAVILPQLGHKEVSLQIRATHSGLATPD
MZRA_EDWI9            ---MNQANSQPFTRRQGWKRILGLLLFIVAALTVVILPQLGHKEVSLQIRATHNGLATPD
D4F0V6_EDWTA          ------------------------MLFIVAALAAVILPQLSHKEVSLQIRATHSGLATPD
G9Y3L5_HAFAL          -------MTLLLIQRLGWKRALLLLALIIGVFAWWIAPHLTHKETTLQISATQAGLATPD
W0HMB6_9GAMM          -MMKVSGCFGLMKRSR----------LGLLAVAVLVSLTLCRDDNTLQITVARERGSLPD
                                                                    : *         **

D2T3K1_ERWP6          GFYVYQTLSTQGIHIKSITPEQDSLVIRFDSPEQSCAAERVLRELFPQGFDIAHQPGQG-
E3DFH1_ERWSE          GFYVYQTLSTQGIHIKSITPEQDSLVIRFDSPEQSCAAERVLRELFPQGFDIAHQPGQG-
MZRA_ERWAC            GFYVYQTLSAQGIHIQSITPEQDSLVIRFDSPEQSYAAERVLRKLFAQSFDIAHQPGPG-
MZRA_ERWT9            GFYVYQTLSAQGIHIKSITPEQNSLVIRFDSQEQSYAAERVLRELLAQDFDIAHHHNQS-
MZRA_ERWBE            GFYVYQRLNAEGIRIKSITPDNDSLVIRFDTEEQSMAAEKVLHQLLPYGFDIGQMDPSG-
MZRA_PANAA            GFYLYQQLSAQGIRIKSITPSGDALIIHFDNEEQSLAAQKVLRRLLPDGFIVAQHDQAA-
D4GNS2_PANAM          GFYLYQQLSAQGIRIKSITPSGDALIIHFDNEEQSLAAQKVLRRLLPDGFIVAQHDQAA-
E1SEZ5_PANVC          GFYLYQQLSAQGIRIKSITPAGDALIIHFDSEEQSLAAQKVLRRLLPQGFIVAQHDHAQ-
MZRA_PANSA            GFYLYQQLSAQGVRIKSITPSGDALVIHFENEEQSLAAQKVLRRLLPQGFVVAAGHQAS-
MZRA_ECOLI            GFSIWHHLDAHGIPFKSITPKNDTLLITFDSSDQSAAAKAVLDRTLPHGYIIAQQDNNSQ
B7LH35_ECO55          GFSIWHHLDAHGIPFKSITPKNDTLLITFDSSDQSAAAKAVLDRTLPHGYIIAQQDNNSQ
B7UJ03_ECO27          GFSIWHHLDAHGIPFKSITPKNDTLLITFDSSDQSAAAKAVLDRTLPHGYIIAQQDNNSQ
Q0T0G9_SHIF8          GFSIWHHLDAHGIPFKSITPKNDTLLITFDSSDQSAAAKAVLDRTLPHGYIIAQQDNNSQ
MZRA_CITRI            GFSIWHHLDAHGIRFKSITPENDTLLITFDSSAQSAAAKAVLDKTLPRGYIIAQRENASQ
A8APZ0_CITK8          GFSIWHHLDANGIRFKSITPQNDALLITFDSSAQSAAAKAVLDRTLPHGYIIAQQNGDSQ
MZRA_ESCF3            GFSVWHHLDANGIRFKSITPKNDTLLITFDSSAQSAAAKVVLDRTFPHGYIIAQQDEDNQ
B5REI4_SALG2          GFSVLHHLDANGIHFKSITPKNDMLLITFDSPAQSAAAKTVLDQTLPHGYVVAQQDDYNE
MZRA_SALA4            GFSVLHHLDANGIHFKSITPKNDMLLITFDSPAQSAAAKTVLDQTLPHGYVVAQQDDDNE
A9MPT5_SALAR          GFSVLHHLDANGIHFKSITPKNDMLLITFDSPTQSAAAKAVLDQTLPHGYVVAQQDDDNE
MZRA_ENTLS            GFSIWHHLDANGIRFKSITPQDDALVIKFESSEQSAAAKEVLDRSLPHGYVIALQEDDAI
L0LYB2_ENTBF          GFSIWHHLDANGIQFKSITPQKDALLIKFESSAQSAAAKKVLDSTLPHEYIIAQQDDDRD
B5XTW3_KLEP3          GFSVWHHLDANGIRFKSITPQKDGLLIKFDSTAQGAAAKEVLGRALPHGYIIALLEDDNS
MZRA_KLEP7            GFSVWHHLDANGIRFKSITPQKDGLLIKFDSTAQGAAAKEVLGRALPHGYIIALLEDDNS
A0A198H104_9ENTR      GFSIWHHLDANGIRFKSITPQDDVLLIKFDSSAQSAAAKVVLDRTLPHGYIIAQQEDNSQ
MZRA_ENT38            GFYIWHHLDANGIQFKSITPQDDVLLIKFDSSAQSAAAKVVLDRSLPRGYIIALQDDQSQ
MZRA_CROS8            GFSVWHHLDANGIRFKSITPQDDILLIKFDTSDQSEAARKVLYRSLPRGFVIAQQEEKSL
I2B4Y0_SHIBC          GFFVWHHLNANGIAFKSITPHKDALLIKFDSAQQSNEARAVLLRSLPQGYVIAQDDNANF
MZRA_SERP5            GFYVYQRLDQRGIRIKSITPEGDGLVIRLDSPEQQLLAREALQNILPPGYIIALSESPVP
W0LBG2_9GAMM          GFYVYQRLDEYGIRIKSITPEGNNLVIRLDSPEQQWQAREALQTILSPGYTISLSESSTP
A1JR44_YERE8          GFSLYQHLDQRGIRIKSITPENDSLVVSLESPEQQQEAITALQDILPNGYVIVSSESKKR
MZRA_YERPP            GFYLYQHLNGRGIHIKSIIPENDSLVVSLEFPEQQMQAIEVLQDVLPAGYAIVASESKKR
MZRA_RAHSY            GFYVYQRLSQRGIHIKSITPLNDALVVQLDTASQRKLAETVLQDILPAGFVIQYYEPQHA
H2ITH2_RAHAC          GFYVYQGLSQHGIHIKSITPLDNALVVQLDTASQRKMAETVLQDILPAGFVIQYYEPPHA
MZRA_DICZ5            GFYIYQRLNERGIAIKSITPENNSIIVRLSSPEQSGAAKEILSIALPNTVVIAQRTHGTI
C6CKG0_DICC1          GFYIYQRLNERGIAIKSITPENDSIIVRLSSPEQGGAAKEILTTVLPNAIVIAQRIHGAT
MZRA_DICD3            GFYIYQRLNERGIAIKSITPENDSIIVRLSSPEQSGAAREILSTALPYAIVIAQRSNGTS
MZRA_DICP7            GFYIYQRLNEHGIGIKSITPEDDSIIVRLSSPEQSRAASEVLKSALPQASVIARQPD-AI
MZRA_PECCP            GFYVYQRLNEKGIAIKSITPEQDSLIVRLASPEQSIAARDVLRLSLPKVTITAQQATTPT
A0A0H3I4I7_PECPM      GFYVYQRLNEKGIAIKSITPEQDSLIVRLASPEQSIAARDVLRLSLPKVSVTAQQATTPT
Q6D9H4_PECAS          GFYVYQRLNEKGIAIKSITPEQDSLIVRLASPEQSIAARDVLRLSLPKVTITAQQATSPT
D0ZB98_EDWTE          GFFVYQKLDENGVSITSITPDREGLVVRLAHPEQQALALQVLQRELPPGYSIADKILHRS
MZRA_EDWI9            GFFVYQKLDENGVSITSITQDREGLVIRLAHPEQRTLALQVLQRELPPGYSIADKILHRS
D4F0V6_EDWTA          GFFVYQKLDENGIDIASITPDRDGLVVRLARPEQHSLALQVLLRELPPGYSIADKILHRS
G9Y3L5_HAFAL          GFFVYQKLDEHGISIKSITPDSNGLLVHLAKPEQQEEAMQVLQSVLPRGYSIAYKTHRRS
W0HMB6_9GAMM          GFFLYQLLEDRGIRVKSITPAKDSMIIHLDTPEQAQAAQLVLQSHLPEGYAILKSRRYSA
                      ** : : *.  *: . **    : ::: :    *   *   *   :.             

D2T3K1_ERWP6          ATSWINHISLL--PQSVG---
E3DFH1_ERWSE          ATSWINHISLL--PQSVG---
MZRA_ERWAC            AASWINRISLL--PQFVG---
MZRA_ERWT9            ATGWINRISFK--PQSIG---
MZRA_ERWBE            SSQLMNRLSLR--KQSVG---
MZRA_PANAA            HLSLA----------------
D4GNS2_PANAM          HLSLA----------------
E1SEZ5_PANVC          HLSLA----------------
MZRA_PANSA            QQNQDANRSIY--S-------
MZRA_ECOLI            AMQWLTRLRDN--SHRFG---
B7LH35_ECO55          AMQWLTRLRDN--SHRFG---
B7UJ03_ECO27          AMQWLTRLRDN--SHRFG---
Q0T0G9_SHIF8          AMQWLTRLRDT--SHRFG---
MZRA_CITRI            AVQWLSRLRDA--PHRMG---
A8APZ0_CITK8          AVQWLTRLRDN--PHRFG---
MZRA_ESCF3            ASQWLSLLRDT--SHRFG---
B5REI4_SALG2          TVQWLSRLRES--SHRFG---
MZRA_SALA4            TVQWLSRLRES--SHRFG---
A9MPT5_SALAR          AVQWLSRLREN--SHRFG---
MZRA_ENTLS            APQWLSRLRDA--PHRLG---
L0LYB2_ENTBF          ATTWLSLLRDT--PHRFG---
B5XTW3_KLEP3          ATAWLSRLRDA--PHRLG---
MZRA_KLEP7            PTAWLSRLRDA--PHRLG---
A0A198H104_9ENTR      PAAWLSLLRDT--SHRFG---
MZRA_ENT38            TAVWLTRLRDT--SHRFG---
MZRA_CROS8            TPAWLTRLRHD--IQRLG---
I2B4Y0_SHIBC          ADRLLSRLKPE--SRHLG---
MZRA_SERP5            THWVREFARAP---LNLG---
W0LBG2_9GAMM          NHW---FIRSP---LNLG---
A1JR44_YERE8          QRLLPAFRNNL---QNVG---
MZRA_YERPP            HRLLPVFRSNQ---QNLG---
MZRA_RAHSY            TAWGAKLDRER---LKFG---
H2ITH2_RAHAC          KAWIAKSDRDP---LRFG---
MZRA_DICZ5            RVARS----------------
C6CKG0_DICC1          PIARS----------------
MZRA_DICD3            PVTRS----------------
MZRA_DICP7            PIWRQKLSQQP---FKLG---
MZRA_PECCP            PFWQQKLTQKQ---SKLG---
A0A0H3I4I7_PECPM      PFWQQKLTQKQ---SKLG---
Q6D9H4_PECAS          PFWQQKLTQKQ---SKLG---
D0ZB98_EDWTE          LFHKSERPAAA-LSYSAGRNS
MZRA_EDWI9            LFYKSERPAAATLSYSAGHNR
D4F0V6_EDWTA          LFHRSERAGEA-LSYSGGNDH
G9Y3L5_HAFAL          LFQSSESDVKD-PPRQARLNS
W0HMB6_9GAMM          WQWLYRPAADE---ERLG---