CLUSTAL format seed alignment for MF_00905

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CPDA_RUTMC        ------------------------------------MMSHSFVQISDCHID---------
CPDA_VESOH        -------------------------------------MNYSLIQISDCHID---------
CPDA_PSEU9        -------------------------MAWFDDTYYFEQAQLRIAHITDCHLF---------
Q3IG69_PSET1      -------------------------MAWFDDTYTFNKPSLRIAHVTDCHLF---------
CPDA_PSYA2        ------------------------MPSYPVSTVNTPDGQVNVLQITDLHLSSHVPAS---
CPDA_PSYWF        MAPLPHSVSPRHTQVADNGRLSEPTDYHPPTEISTDDGTVNILQLTDLHLYFDTPKATHE
CPDA_ECO57        -------------------------MESLLTLPLAGEARVRILQITDTHLFA--------
CPDA_ECOLI        -------------------------MESLLTLPLAGEARVRILQITDTHLFA--------
CPDA_HAEIN        -------------------------MKNTFVYQ-AEKPVIKLLQITDPHLFK--------
CPDA_VIBVU        -------------------------MQHTSSDTLSENS-IKLLQITDTHLFA--------
D8JIA6_ACISD      ---------------------------MTFQVSTLSQKDHVIIQITDTHLLE--------
CPDA_NOSS1        ---------------------------------MNEKLPISIAQITDIHLLA--------
B1XQ99_SYNP2      --------------------------------------MVLIAQITDTHLLD--------
CPDA_PSEAI        --------------------------MSRHSNTPATDASVLLVQLSDSHLFA--------
Q2KTW6_BORA1      --------------------------MPEHP-LAAHDAPALLLQLSDSHLMA--------
CPDA_SYNPX        ---------------------------------------MRILQLSDPHLVA--------
Q3AIR5_SYNSC      ---------------------------------------MRILQLSDPHLVA--------
CPDA_SYNPW        --------------------------------------MPRLIQLSDPHLVA--------
CPDA_MYCTU        --------------------------MHRLRAAEHPRPDYVLLHISDTHLIGGDR-----
CPDA_RHOE4        ---------------------------MSVRSAEYPRPKHFLVHLSDTHLVA-QG-----
A1SEE2_NOCSJ      -----------------------------MQLGQYPAPRHVVAHLSDPHLLAGGA-----
CPDA_ARCNC        ---------------------------------------MIVVQVSDTHIKSKGK-----
Q4ZTD8_PSEU2      ---------------------------------------MLIAHISDTHVRPRGQ-----
Q2GBM7_NOVAD      ---------------------------------------MLIAQVTDIHLGFE-------
A5V3T9_SPHWW      ---------------------------------------MLIAQLTDLHIGFD-------
CPDA_STRAW        -----------------------------------------MAHLSDPHLTTG-------
A4F6Q6_SACEN      -------------------------------------MTMAIAHLSDPHTTTG-------
D2BEC1_STRRD      --------------------------------------MLTLAHVSDIHIGGS-------
E8WFB1_STRFA      -------------------------------------MTVLLAQISDLHLDGS-------
CPDA_RHOPA        ---------------------------------------MKFVVLTDTHFVARG------
Q89MQ1_BRADU      -------------------------------------MPFKFIHITDTHLANPG------
Q6CZA8_PECAS      ---------------------------------------MKLIQLSDLHLTAED------
Q1GM28_RUEST      --------------------------------------MTSFIQLTDTHIVSEGS-----
Q28NL1_JANSC      ----------------------------------MTHQFDKALIFTDLHITPPGE-----
CPDA_MORCB        ------------------------------MPNITNNHTFNIVQLSDLHLTGDIGQA---
A5FYX3_ACICJ      ------------------------------MSGGPGAPPLLVAQFSDLHLRAPGL-----
C6D6T3_PAESJ      ------------------------------------MEKLKFVHLTDTHMNAPGV-----
CPDA_SYNP6        ----------------------------MVEDFAGDAMTLSIAQITDLHLLVDPQAALRG
E1V834_HALED      ---------------------------------------MRLIQITDCHLHADPAARSRT
A7MRP8_CROS8      ---------------------------------------MIIAQLSDIHAAPDNDN----
CPDA_ENTLS        ---------------------------------------MLLAHISDTHFRS--------
B8J1S2_DESDA      ---------------------------------------MHILQLSDTHLRGDNS-----
A9WNR5_RENSM      ------------------------------MSTSNSYETLSILHLSDTHVLAKGLHSNVV
CPDA_COLP3        --------------------------MTITEPYSPNNQPITFAQITDSHLFSSVDGLHHG
CPDA_COXBU        ----------------------------------MEDNCIKIAQVSDLHLTSENCETSRG
Q8XSE2_RALSO      -------MRFIQSLLVLNEGDAALDRAMVEMTAARGNKTVTVVQITDPHLFADRDSE---
CPDA_FIBSS        ---------------------------MYILRSCMEKKVLKIGQISDAHIGDDDR-----
CPDA_XENBS        ---------------------------------------MKVVNLTDIHLTRNRDKK---
Q15YS5_PSEA6      -------------------------------------MSFKVAQISDCHLFADKRHAGYQ
                                                              .:* *           

CPDA_RUTMC        -----NVE--YAMGVNTH-------------------------VNLKKIINKIINIDT--
CPDA_VESOH        -----DNK--YSMGVNTH-------------------------INLKKIISRISHINI--
CPDA_PSEU9        -----SDKQGEYFGVNTA-------------------------EHFTRALTDIAKQQP--
Q3IG69_PSET1      -----ADRNAEYFGVNTA-------------------------TYFQQALEHMALQQL--
CPDA_PSYA2        -----DDETSSEVAVCQY--------------------------SFEAIIKQALSKEIRC
CPDA_PSYWF        QDINKDSAHQTITGICQNNSAKRGNPHSADAINHSVTPVIHNYASFEACLTQALSEDVRC
CPDA_ECO57        ------QKHEALLGVNTW-------------------------ESYQAVLEAIRPHQHEF
CPDA_ECOLI        ------QKHEALLGVNTW-------------------------ESYQAVLEAIRPHQHEF
CPDA_HAEIN        ------DESAELLGVNTQ-------------------------ASFAQVLKEIQQENNEF
CPDA_VIBVU        ------SDEGSLLSVKTL-------------------------QSFQAVVEQVMARHVEF
D8JIA6_ACISD      ------YPHLEFVGMNPE-------------------------ESFHAIIQQILKKHPEA
CPDA_NOSS1        ------SESQRLQGISTT-------------------------ESFLAVMKRLEELRPEL
B1XQ99_SYNP2      ------HPEAEMRGVKTD-------------------------ASFQAVLAAVQQFKP--
CPDA_PSEAI        ------EDGARLLGMDTA-------------------------HSLEKVVERVAREQPRI
Q2KTW6_BORA1      ------DPDARMLGVNTD-------------------------ASLRAVIDLARRQEGQP
CPDA_SYNPX        ------ADAALVRERPAM-------------------------TLLDRALLEGQRSHP--
Q3AIR5_SYNSC      ------ADQGLVRGRPAL-------------------------AHFERALQLGGALNP--
CPDA_SYNPW        ------RAEGRVRGRSAL-------------------------SLFQKALAQALQEQP--
CPDA_MYCTU        -RLYGAVDA---------------------------------DDRLGELLEQLNQSGLRP
CPDA_RHOE4        -ELYDAVDA---------------------------------STRLREVLSGIVASGARP
A1SEE2_NOCSJ      -RQYGVIDT---------------------------------EAGLRLALTRLSRLETPP
CPDA_ARCNC        -LAYNKVDI---------------------------------HKALYNCILHINNLKPKP
Q4ZTD8_PSEU2      -LYQGVVDS---------------------------------NAMLAAAVDTINTLDPAP
Q2GBM7_NOVAD      -PDSPDEFN---------------------------------RQRLDRVLAELAAMDPRP
A5V3T9_SPHWW      -LENPDELN---------------------------------FHRVAAAIDYVMGLSVVP
CPDA_STRAW        ---LLAVDR---------------------------------VAAFSRALRCVLALDPRP
A4F6Q6_SACEN      ---AQGDES---------------------------------VERLRRGLDCVRALDRLP
D2BEC1_STRRD      ---PRS------------------------------------VERARAVMRHLEELPGPL
E8WFB1_STRFA      ---ERA------------------------------------TRRAERVMDHLRALPRPV
CPDA_RHOPA        -RRIYGLDP---------------------------------AERLSAAVARINREHPDI
Q89MQ1_BRADU      -LKLYGLDP---------------------------------RARLDAAIADINKHQSDA
Q6CZA8_PECAS      -GTLHGRDP---------------------------------ERQLKAAIADINAHHRDV
Q1GM28_RUEST      -LAYGRSDTATAL------------------------------ARAVDTINSRLPVLDPV
Q28NL1_JANSC      --TIIGLDP---------------------------------LARFQEGLAHALSRHPDA
CPDA_MORCB        ------------------------------------------PSYQRFLAVFQTAKHLNP
A5FYX3_ACICJ      -TANRIVET---------------------------------NMLAARAFAAFAALAPAP
C6D6T3_PAESJ      ------DNPFAKFNL---------------------------ADKVKRVFEHIKTASVSP
CPDA_SYNP6        -----------------------------------------CVTTPRAAAVFGNLKQRSP
E1V834_HALED      -----------------------------------------GVPHRQFVRVVEEAASWRP
A7MRP8_CROS8      ------------------------------------------LARFDNALAWLTPLEP--
CPDA_ENTLS        ----QNHKLYGFIDVN---------------------------AGNADVVSQLNGLRERP
B8J1S2_DESDA      -LSFRVVDT---------------------------------RRCLDAATAHLKTMAQKP
A9WNR5_RENSM      -----------------------------------------DTRQNLLEALRALVPVEEL
CPDA_COLP3        ----------------------------------------HNVLANLKKVLLSICDNPSI
CPDA_COXBU        ------------------------------------------RYSNAMNVFSAISLSGQH
Q8XSE2_RALSO      ------------------------------------LMGYRTYPMLSKTIDAIRGHDFRP
CPDA_FIBSS        -------------------------------------LVQDIDVRKNFLTAYNSESMKDL
CPDA_XENBS        ----------------------------------LFDVNTYDNFDFVCEEIHRIQNLTEI
Q15YS5_PSEA6      ----------------------------------------NINPYTTLQAVLKNVGLCHP
                                                                              

CPDA_RUTMC        DALLISGDLTHNGTITSYKTLQQILFPVQIK-------LLVISGNHDIDNNLNTIFSKNL
CPDA_VESOH        DVLLITGDLTHKGSITSYKALQQMLYPIQIK-------LLIIPGNHDNKNNLSATFSKNL
CPDA_PSEU9        DALIFGGDLTQDHSFNSYLLFAELIHNSDLDC-----PVFWVPGNHDEIDQLNLISGGQI
Q3IG69_PSET1      DAVVFGGDLTQDHSVESYLLFSELISNSTLTC-----PVFWLPGNHDEIALLEQISGGQI
CPDA_PSYA2        DLIVVTGDLVNKVEPAIYDHIFTVLQDTGIP-------FACIAGNHDVTDETGEDLPFYQ
CPDA_PSYWF        DLIVVTGDLVSEIHPQLYQHLYQRLHQSGIP-------FACIAGNHDVTDEIGKDLPFEQ
CPDA_ECO57        DLIVATGDLAQDQSSAAYQHFAEGIASFRAP-------CVWLPGNHDFQPAMYSALQDAG
CPDA_ECOLI        DLIVATGDLAQDQSSAAYQHFAEGIASFRAP-------CVWLPGNHDFQPAMYSALQDAG
CPDA_HAEIN        DVILATGDLVQDSSDEGYIRFVEMMKPFNKP-------VFWIPGNHDFQPKMAEFLNQPP
CPDA_VIBVU        DYLLATGDISQDHSAASYQRFADGIAPLEKA-------CFWLPGNHDYKPNMSSVLPSPQ
D8JIA6_ACISD      DAIIHTGDLAQAPTPITYKRYIQYMQTLGLP-------FFQTLGNHDNVDHFPLHKEN--
CPDA_NOSS1        DLLLMTGDLSDDGTPESYENLQHYLNSLQIA-------TYWLPGNHDCAIAMDKILNLGM
B1XQ99_SYNP2      DRLILTGDLAHHGEAISYERLRDLVEATQIP-------SYWLPGNHDDPELMAGILQGDY
CPDA_PSEAI        DLILATGDVSQDGSLDSYTRFRRLSAPLAAP-------LRWFAGNHDEREPMQRATEG--
Q2KTW6_BORA1      ELMLLTGDLAQDGSPQAYRRLQ--AHLRGAP-------VRCLPGNHDAPEVMRQIL----
CPDA_SYNPX        DLVLISGDLCQDESWGGYVRLGRLLDRHVN------VPVGLLPGNHDDPLLLKAVLGRRF
Q3AIR5_SYNSC      DLVLVTGDLCQDESWGGYARLRRALSQHVR------CSVALLPGNHDHPLLLDAVLGRRW
CPDA_SYNPW        DLLLVTGDCCHDETWCGYVRLRDAVDAAIQQQAARTVCLGFTAGNHDHPQRLRAVLGRHW
CPDA_MYCTU        DAIVFTGDLADKGEPAAYRKLRGLVEPFAAQL---GAELVWVMGNHDDRAELRKFLLD--
CPDA_RHOE4        DALIFTGDLTDQGHPDAYAELKAIVEPVAAEI---DAQVIWAMGNHDDRSTFRSLLLG--
A1SEE2_NOCSJ      HALVFTGDLADKAEPAAYSRLRELVEPAAAEM---GAAVVWVMGNHDERAPYARGLFGVE
CPDA_ARCNC        DLVIFTGDITDNGTNEEYKLFKETVKLL-------DVPFYVIPGNHDNAENLKREFEEYD
Q4ZTD8_PSEU2      DLILFSGDLVDEGRPEEYAMARELLQPL-------RQKLLMIPGNHDHRQNLRDAFAEHD
Q2GBM7_NOVAD      DLLLATGDLIDRGDRESYERLRDAFSNL-------PFPVHYALGNHDERETFSAVFPEAA
A5V3T9_SPHWW      DRLFLTGDLTDHGDVASYERLKGLIDGC-------GFPVHLCVGNHDDRAAMKQVFPDLP
CPDA_STRAW        ACVVVTGDLVDRGEAEEYEVLREVIARF-------PLPVHLVPGNHDDPGTLLEAFGGGP
A4F6Q6_SACEN      DCVVITGDVADGGHRQEYEAVRAVIADF-------PVPVHLTTGNHDDPRGLAEVFGGTD
D2BEC1_STRRD      DAVIVTGDIADHGTAEEYGTARELLTS--------RYPTVLCPGNHDVRPAFREVLLGQD
E8WFB1_STRFA      DAVLVTGDIADHGAEAEYEEAARILAA--------PFPVLTCPGNHDARPAYRTALLGEE
CPDA_RHOPA        AFVIVTGDLAHWGEEPAYDNLASVLAGL-------RAPTILMMGNHDKREAFAKFFPGVP
Q89MQ1_BRADU      AFAVVTGDLTHWGEPESYANFADAMAAL-------KIPYIAMVGNHDKRVACLDGLKAAP
Q6CZA8_PECAS      DLVVISGDLSDDGSAASYAFLASALAEL-------QTPWRVTMGNHDDRESFLAQFPTLA
Q1GM28_RUEST      DCVVVTGDLTDHGSAEEYAHLRQLLAPLNVP-------VRAIPGNHDTREAMRAAFATED
Q28NL1_JANSC      QHIVLLGDLTHTGDPAEYARLVPALADCPIP-------LTVTMGNHDLRDHLRNAFPTAL
CPDA_MORCB        DLWLLTGDLVNDGNSDAYDWLFNQLQATKIP-------YLAVAGNHDVTHEIGIHLAHQE
A5FYX3_ACICJ      DALVITGDLADRGEAEAYRLLAGLIERHVRV------PVILIPGNHDDRAAMRATLGDRL
C6D6T3_PAESJ      AFVVITGDLTHEGNVQDYEYIRTIVDEGSALL---GVPVHVVLGNHDHRAPFREGFLKEE
CPDA_SYNP6        DLLLLSGDLSEDGSPASYERLRDWVEELGCP-------AIAIAGNHDQPERLTEICGRSP
E1V834_HALED      DMVLVTGDVSQDETAASYALAERELARLDCP-------WSWLPGNHDEPARMAECRPFDE
A7MRP8_CROS8      DVLVISGDLTDDHWRDGYSAIAARLETLPCR-------TLILPGNSDDCAAMRAVWPSLA
CPDA_ENTLS        DAVVVSGDIVNCGRPEEYQVARQVLGALRYP-------LLLIPGNHDDKACFLEYLRPLC
B8J1S2_DESDA      DIIVLSGDLADSGDLNAYHILYDALSPLGIP-------VYALPGNHDRRDRMRDVLQGWC
A9WNR5_RENSM      DLVVVSGDVSDDGTAESYRMVQELVENFASHR---GARAIYTMGNHDGRPGFWEVLGNGH
CPDA_COLP3        KYIIFTGDLTQDHTEQSYQNFVDCVLECHITV-----PIYYLAGNHDEPKLLDKYFSASP
CPDA_COXBU        DMIFITGDISDDYTENSYKQLLEMLKKLTCR-------VFVIPGNHDDVNLMNKIIPEKY
Q8XSE2_RALSO      DACFLTGDISQDESADSYELARFELERLGIP-------VFWIPGNHDDRGRAEAVFGQSE
CPDA_FIBSS        DLLVLSGDLADNASTDAYSFIAGVIKDSKVP-------VCIIPGNHDNLEVMEKVFDLKD
CPDA_XENBS        ELIIVSGDIANDGDVEAYRYFLNKMESLKTP-------YISILGNHDLNKNFEITLAEEK
Q15YS5_PSEA6      DMVIVSGDVSAENDAVKGLASYQLFSQLWQQSK-ISAPLLVIPGNHDHLEALNNELNHLA
                     .  **                                   ** *             

CPDA_RUTMC        FSQFTLRKWEI---------------------ISTNSVQTSKTSGF-----LTKNELKKL
CPDA_VESOH        FSQFTLGKWEI---------------------ININSVQVSKTSGF-----LTKDELIKL
CPDA_PSEU9        QRAKHIVAQGF--------------------ELILINSKGNTPAGW-----VTPSHLEEI
Q3IG69_PSET1      KAAKRLVANNLTNNLTNNLTNNLTNNASTDIELLLINSKGLTPAGW-----VTSEHLNEI
CPDA_PSYA2        RTLITRAADPR-------LLSRHLIESEHWQLLLLDSSITGKVEGE-----ITATDIDWV
CPDA_PSYWF        RSFEPHEPDSR-------LLSRYSMKLNGWEILFINSSVPGQIFGR-----IGNKNLYWL
CPDA_ECO57        ISPAKRVFIGE-----------------QWQILLLDSQVFGVPHGE-----LSEFQLEWL
CPDA_ECOLI        ISPAKRVFIGE-----------------QWQILLLDSQVFGVPHGE-----LSEFQLEWL
CPDA_HAEIN        MNAAKHLLLGE-----------------HWQALLLDSQVYGVPHGQ-----LSQHQLDLL
CPDA_VIBVU        ITTPEQVELNA-----------------HWQLILLDSQVVGVPHGR-----LSDQQLLML
D8JIA6_ACISD      -HQEPVVICLG-----------------NWRVILLNSAVKGQINGH-----LSPEQLQNL
CPDA_NOSS1        VSRRKSFQRG------------------NWNFILLNSSVTDCVYG-----YLSATTLDWL
B1XQ99_SYNP2      LSPDKNVALG------------------NWKLLLLDSFLENPEYGEG---FLDTAQLAWL
CPDA_PSEAI        SDLLEQIVDVG-----------------NWRVVLLDSSIPGAVPGY-----LEDDQLDLL
Q2KTW6_BORA1      ADWISPVYDLP-----------------GWRIIMLDSTVPGEDFGH-----LDEAQLAVL
CPDA_SYNPX        CTAPAELIVQG------------------TRLVLLNSHRSGCSAGW-----LGPHQLQWL
Q3AIR5_SYNSC      TTAPADLLVQG------------------VRVLLLSSHQVGSAAGA-----LGSLQLQWL
CPDA_SYNPW        VVAPGVMDAGC------------------WRLLVVSSHRAGGCAGV-----IGGVQLSWL
CPDA_MYCTU        EAPSMAPLDRVCM-------------IDGLRIIVLDTSVPGHHHGE-----IRASQLGWL
CPDA_RHOE4        EDATDHPVDNVYD-------------LDGLRVITLDSSVPGHHYGE-----ISDRQLDWL
A1SEE2_NOCSJ      GADADAPQDRVHE-------------VAGLRIVALDTSVPGYHHGE-----LADDQLAWL
CPDA_ARCNC        WFEENNHLSLVIE-------------DFPIRIIGLDSSIKGKSYGG-----LSEERLLWL
Q4ZTD8_PSEU2      YFINDQDCSFVYSG------------SAPVRIIGLDISVPEQHHGD-----MTDTAIRWL
Q2GBM7_NOVAD      FT--DGFLQYIVD-------------AGPLRIIVLDTLEEGRHGGA-----FCDVRARWL
A5V3T9_SPHWW      VE--DGFVQYVID-------------EPEVRIIVLDTLDPGHHGGA-----FGHRRAGWL
CPDA_STRAW        HTGGARAFPYAVE-------------YPNATVVVLSSTVPGAPSGR-----LGDEQLDRL
A4F6Q6_SACEN      VLGGAREARYAVD-------------YPGFTLVALDSHMPGSPGGR-----LGADQLAWL
D2BEC1_STRRD      ---GDGPVNQVLR-------------LDGLTVALCDSSIPGRPEGV-----LEDETIAWL
E8WFB1_STRFA      P--GTGPVNRVHH-------------IAGVAILMCDSTVPGRDEGR-----LDEETLAWI
CPDA_RHOPA        RDASGFVQTVQVFE------------AATIVTLDTLNEAAPNHEGF-----LCEARLAFL
Q89MQ1_BRADU      RDSNGFVQGTRITE------------HGLFVFLDTLDETS--HAGE-----MCAKRLGWL
Q6CZA8_PECAS      DE-NGFVQSVTAVG------------DDYVILLDSLHSGE--VAGT-----LCSVRLAWL
Q1GM28_RUEST      WMPASGPIQWHHD-------------FGPFAMVGLDTLVEGAPYGM-----VCEAGLGFL
Q28NL1_JANSC      NPDGFAQTARDLG---------------PLRLLILDTHDYDNQAPLEQDGWLCETRLAWL
CPDA_MORCB        RIHVPILPDRRLKN----CFRYTFQAGHDWQILLLNSSVSGEIFGL-----LTHETLLWL
A5FYX3_ACICJ      AADDEAGVNRPAEH-------------LPVRLLPLDSTIGGESHGR-----LGDGQLRFL
C6D6T3_PAESJ      PSEQAYYYSHTIQ---------------GVRLIGLNSQVKGQHHGE-----IDAEQLAWL
CPDA_SYNP6        FMGEPVYSIQG------------------WRIIALDSYQPKRIDGR-----LRGDQLDWL
E1V834_HALED      SVDLGQR-----------------------RLLLLDTQVPGQTHGA-----LGAARLEAL
A7MRP8_CROS8      QEGPLHAVVDTPA----------------LRVIGLDSTVDGSAAGS------VAAHLDWL
CPDA_ENTLS        PQLGSDPQNMRYAI-----------DDFATRLLFIDSSLAGHAKGW-----LTDNTVAWL
B8J1S2_DESDA      PAAPEVSPHICYTV-----------EMDELRLVMVDSMHPGSHSGH-----LFPAVEGWL
A9WNR5_RENSM      PDSPAEQDGGQLPV-------YGSSVLGGFRIISLDTSVPGRTHGY-----LDRGQLDWL
CPDA_COLP3        FQADKEINLSHWQ-------------------VQLVDSKSATPAGY-----VGEQALVKL
CPDA_COXBU        LFSPETVTSFN-----------------TFDFLFVNTVVNGEIHGL-----LTDQDLSLF
Q8XSE2_RALSO      RIHRLSKLTTA-----------------DWDFIHLETCRRGADEGY-----LSDPDFERF
CPDA_FIBSS        KVHNGKCYYRYDLD---------------GRSIFFLDSADGTVSSD---------QLSWL
CPDA_XENBS        PKYIISSREYNND---------------NWYITAVDTVVEGEDYGF-----ITQDNLAEL
Q15YS5_PSEA6      GWPLSTSAGPYWK-------------------VHGLNTKTDDSSGE-----ISMRQLQYL
                                                                             .

CPDA_RUTMC        NFNLTQSI---AKYILIVLHHPIVPMNSTWDDSLSLENPK--ALFNVLDKYP-KIQAILF
CPDA_VESOH        ELNLAQSI---AQYILITLHHPTVPMNSTWDDSLSLENPE--ALFNVLDKYH-KIQAILF
CPDA_PSEU9        MACLVDSD---NRHIAFCHHNP-LPINGYLDKHMLENGP---QLLNLLVNNG-RVDALFH
Q3IG69_PSET1      SDCLAQPV---SKQLVFCHHNP-LPINGYLDKHMLENGP---QLLNTLVNNG-NVAALIH
CPDA_PSYA2        REQLASC----TKPALIALHHHVLPVDSEWIDSHMAKNAE--EFWQHILPFE-NLRVIIN
CPDA_PSYWF        SQKLANS----HHPVIIAMHHHLLPMHSAWIDAHITQDAT--EFWQTVAPFN-ALKAVVG
CPDA_ECO57        ERKLADAP---ERHTLLLLHHHPLPAGCSWLDQHSLRNAG--ELDTVLAKFP-HVKYLLC
CPDA_ECOLI        ERKLADAP---ERHTLLLLHHHPLPAGCSWLDQHSLRNAG--ELDTVLAKFP-HVKYLLC
CPDA_HAEIN        KETLGKNP---ERYTLVVLHHHLLPTNSAWLDQHNLRNSH--ELAEVLAPFT-NVKAILY
CPDA_VIBVU        EHHLQASP---EKNTLILLHHHPLLVGSAWLDQHTLKDAE--AFWQIVERFP-MVKGIVC
D8JIA6_ACISD      AALLEEFS---DNPVLLACHHHPFAMKSKWIDHHKLQNSN--ALLTTLAPFK-NVKALIC
CPDA_NOSS1        DSELKMLP---NNPTLIALHHPPLSVNSAWIDRSCLQNSQ--ELFAVIDRYP-QVKLVLF
B1XQ99_SYNP2      AERLEHHQ---NSPVAIAIHHHVVPAGVDWLDQIDMTNRA--EFWQIVQHHP-QVKTVFF
CPDA_PSEAI        RRAIDSAG---ERFLLVSFHHHPVPIGSDWMDPIGLRNPQ--ALFDLLAPYP-QLRCLLW
Q2KTW6_BORA1      DQAIKDAG---PRHVLVALHHNLARVDGNWQDPMMVDNAA--AVFARLSAHP-QTRIALW
CPDA_SYNPX        QERLADPLR-RDLPLVVALHHPPVAIGHPVMDTMNLSDHH--QLAAILQPHA-ALRAVVF
Q3AIR5_SYNSC      EQRLRCSER-LDLPLVVALHHPPIAIGDAGMDAIRLLDQA--CLEALLRPHR-ALRAVLF
CPDA_SYNPW        NTQLREAET-LGKFVVVALHHPPVPIGDASMDTIGLSDGE--QLMDSLKRWP-AVRVVLF
CPDA_MYCTU        AEELA-TPAP--DGTILALHHPPIP-SVLDMAVTVELRDQ-AALGRVLRGT--DVRAILA
CPDA_RHOE4        RSELA-VPAP--DGTILALHHPPVP-CIQDLAVLVELRDQ-SRLADVLRGS--DVRAILA
A1SEE2_NOCSJ      AEVLA-TPAP--HGTLLALHHPPIPIPMMPAAEIIELLDQ-HRLADVLGGT--DVRCILG
CPDA_ARCNC        EKQLNKFPD---KKVLLFIHHPPVKIGIEHMDVQNLQIGR-ERLADLLGKYE-QVLALAC
Q4ZTD8_PSEU2      DSTLALEPD---KPTLIMMHQPPFSSGIPYIDAYRCERG--ERLAEVVSRYP-AIERIVC
Q2GBM7_NOVAD      KARLDEAPD---TRTLIVQHHPPVEVGIAWMNTDPAEPWV-ERLGQCLRGRT-NVVGVVC
A5V3T9_SPHWW      KARLAEVPG---KPVLIVLHHPPIETGIPWMTAHQTEPWV-VMLDKAIGDRP-G-VTMIS
CPDA_STRAW        EELLSRRPE---VPAFVCLHHPPVDIGIPYLDGMNLADA--DAFGEVIGRHP-QVVRVLA
A4F6Q6_SACEN      DDVLARRPD---VPAVVCVHHPPVAVGIPYLDGMGMEDA--AEFAGVIARHR-NVARVLA
D2BEC1_STRRD      EAVLAESPA---TPVIVGMHHPAVALGIPYVDTIGLREP--ERLEGVLRRHP-QVVAVLA
E8WFB1_STRFA      DTTLTELPGG--TRSLIAFHQPPVELHHPLPDSCMLERP--GDLAALLDAHP-AVAAVLT
CPDA_RHOPA        EHALAEAPAD--RPLLLFQHHPPFDTGLRYMDTIRLA-NPDAEWEVIARTR--KPDYLFM
Q89MQ1_BRADU      ASTLAAAPAD--MPFVVFMHHPPFPVGVHAMDEISLK-QSPEFAEVIAPYRS-RIRHLFF
Q6CZA8_PECAS      EQQLLAAEG---KNVFLFLHHPPMSIGLPALDDVRLAPEAADALSQICHRVG-NVRHISA
Q1GM28_RUEST      ARSLKTTPD---KPLVVATHHPWIPSGMADMDRNNLRNGP--AMLDLLREHD-APVHVIS
Q28NL1_JANSC      DAELARAADD-GKDVVVFAHHPPCPVGFWAMDAIGLANAD--ALLSRLHAAP-HVKHLIC
CPDA_MORCB        DQTLTTHF----EQTIIALHHHPTKVSSDWIDAHLLKNHQ--DFWHVIKKHA-HVHTILC
A5FYX3_ACICJ      RDRLAADP----RPAAILLHHPPIATGIAHMDAIGLENAA-ALEAAIAPHAA-RVAGLWC
C6D6T3_PAESJ      EDTLSTPAE---NGTIVALHHPMLNINGMPADHVLANRDQ----LGNVLEGT-DVIGVVA
CPDA_SYNP6        DQRLGEDSS----PTLLMLHHPPVLIGVTKMDAIGLKDGP--EFLEVIAHHQ-QVRLVLS
E1V834_HALED      AERLAEDE----RPTLVAMHHPPVSVGSRWVDALGLVDAE--AFWEVLATHE-RVEAILC
A7MRP8_CROS8      AHQLDQAGG---RQTLLFLHHHVFMSGIPSMDAAACRDAQ--ALGALLRHHPAKPLAIAT
CPDA_ENTLS        EAQLSDAGD---KPTAVFMHHPPLPLGNAQMDPIACENGH--RLLALVERFP-SLVRIFC
B8J1S2_DESDA      ARTLAQRPD---VQTLVFMHHPPFMTGMGAMDEPFENQGA---LAAIAGDNP--QIRLCF
A9WNR5_RENSM      TEELGSASE---AGTVLVLHHPPVEPVTPLHDGIELQNPE--DLLEVLHGSD--VRLILS
CPDA_COLP3        KDAIQKNKN-----QLLMMHHHPIDVGYFIDKHGLQNKDA---FWQVINSYD-NIKAIAC
CPDA_COXBU        QNHLENSGN---KKKCIIMHHNPIPLNRKIYDKYMLLNYQ--DFLRIICLYD-NVKLVIF
Q8XSE2_RALSO      VSDVEASAGA-GKQIAVVMHHHPVPTQTPLLDGYMLQDGE--RLLSFLDDQR-QVRLVIC
CPDA_FIBSS        EQETAKIDG----EVLLFLHHPPCLCGHKFMDLRYSMKNI-AEVQATLSKIK-NLKHIFV
CPDA_XENBS        ERKIITNSN---FNIAIFMHHHAMPVGTPIVDSCMLNNAK--AILELCEKHR--VKFIGS
Q15YS5_PSEA6      NEQVNLHPQ---QHHLLVVHHHPYACGGWMDNHPWRNRDE---FIQNVEQQP-QIKAVIY
                                  .  *:                                       

CPDA_RUTMC        GHAHQAAEFSRL-------GVKIISCPSTALQFNNETRI-----------------GFNH
CPDA_VESOH        GHAHQAAEFKRL-------GVKIISCPSTALQFNNETRI-----------------GFNY
CPDA_PSEU9        GHVHNDYQQQFR-------ELDIYATPASSVQFTKHSATWQ-----QEDK------GAAY
Q3IG69_PSET1      GHVHNDYTQCFR-------ELDIYATPASSVQFTKHSKAWQ-----QQNN------GPAY
CPDA_PSYA2        GHTHQEQTRHHQ-------GVTVYSTPSTCYQFKPFEDNFA-----YDKKV---RPGYRW
CPDA_PSYWF        GHVHQSSTRSYQ-------GVQLYSTPSTGYQFKPGCDDFT-----LDDEA---KPGYRW
CPDA_ECO57        GHIHQELDLDWN-------GRRLLATPSTCVQFKPHCSNFT-----LDT----IAPGWRT
CPDA_ECOLI        GHIHQELDLDWN-------GRRLLATPSTCVQFKPHCSNFT-----LDT----IAPGWRT
CPDA_HAEIN        GHIHQEVNSEWN-------GYQVMATPATCIQFKPDCQYFS-----LDT----LQPGWRE
CPDA_VIBVU        GHVHQDMNVMHK-------GIRVMATPSTCVQFKPKSDDFA-----LDT----VSPGWRE
D8JIA6_ACISD      GHVHQDSLNTWQ-------GIEFFSTPSTSVQFKPFSNEFA-----LDQ----NAPGYRY
CPDA_NOSS1        GHIHQEFRRQRH-------NVHYLGSPSTCYQFQSQSTTFA-----INQ----ELPGFRL
B1XQ99_SYNP2      GHVHLEYSVTQG-------GIPCFGTPSTCTQVTPPDQEPI-----EGDRQLWEQPGFRL
CPDA_PSEAI        GHIHQEFDRQRG-------PLRLLASPSTCVQFAPGSSDFT-----LDR----LAPGYRW
Q2KTW6_BORA1      GHIHQEFDCRHH-------HLRLLGTPSTCFQFTLNNGQHA-----IDA----KAPGYRW
CPDA_SYNPX        GHIHQHWHGTWPQRP----DVPLLGCPSTLRSFQCVQPCPL-----GRAE----DPGGRL
Q3AIR5_SYNSC      GHIHQHWQGSWSTRP----DVLLLGCPSTLCSFKAVQPCPL-----GRAD----DPGGRL
CPDA_SYNPW        GHIHQHWKGMAAPRS----DLSLLGCPSTLVSFHPVQPCPL-----GRAW----DPGGRL
CPDA_MYCTU        GHLHYSTNATFV-------GIPVSVASATCYTQDLTVAAG-------GTRGRDGAQGCNL
CPDA_RHOE4        GHLHYSTTATFA-------GIPVSVASSTCYTQDLNVEVG-------GQRGRDGAQGCNL
A1SEE2_NOCSJ      GHFHYSTYSTFA-------GIPVSVASATCYTSDPAPLER-------FVSGVNGHQAMTM
CPDA_ARCNC        GHVHRVSTTLWN-------KIIVLTAASPSHQVALDLRK------DAKAEFVMEPPSVQL
Q4ZTD8_PSEU2      GHIHRFMQLRFG-------GTLMCTAPSTTTAIALRLHP------EAADASYVEPPALLL
Q2GBM7_NOVAD      GHIHRAITTAWE-------GTVVATCPSTAPQVALDLRPIDPDVPDQRNLIIADPPGYAL
A5V3T9_SPHWW      GHIHRSITTSWR-------GRMLAVAPSTAPQVALEMAPIDPERPDERPMIVAEQPGVAL
CPDA_STRAW        GHVHRAVTGEFA-------GSTMVTAPSTYLQSNLNLRVG------GPVGYVDEPTAFLL
A4F6Q6_SACEN      GHVHRAVVADFA-------GATLTTAPSTHIQIGFTTGED------VPPLHAD-PASFLL
D2BEC1_STRRD      GHAHTPASTTFA-------GLPLIVAPGVVSTALLPQEYAS-----PDPRDFDLPPQIAM
E8WFB1_STRFA      GHAHTAAASAFA-------GRPLIVGPAVTWTLRMPWEGDH-----AADR--DQPPGLAF
CPDA_RHOPA        GHLHRPISGVWR-------GIPFHIQRGLAHQVAFDL-VA-----EGHIPGSHEPPDYAH
Q89MQ1_BRADU      GHVHRPIFGSYG-------KIPFSTLRGTNHQVWFELDAA-----AAEHLASHEPPAYGV
Q6CZA8_PECAS      GHVHRPASGGWR-------GISFSTIRGTNHQSALRF--------APGFEVSLEAPQYAI
Q1GM28_RUEST      GHLHRAMSALVD-------GVLHQVAPAPCHAVHLDQRADA------VNSLVLEPGQVTV
Q28NL1_JANSC      GHIHRTIHASASSPAGG--GLPVTILKSPCHQVPMILGQGT------FADSVDEPGAYGI
CPDA_MORCB        GHVHQVHTLHPLPAH----QVQLLSCPSTDRQFMPFVDNFQ---------IADTPAGCRM
A5FYX3_ACICJ      GHVHRMIHGRLA-------GAPVVIAPSVAHQVQFDLTPDG------PSALVLEPPAFVM
C6D6T3_PAESJ      GHVHTNNVGTYK-------GICHVAATGTAFGGEAAEDNHF---------KMVDFCGYNI
CPDA_SYNP6        GHAHQAFIQGRG-------LTTFLGCPATAMQFDQPE----------------LPAGWRS
E1V834_HALED      GHIHQAFECRRATPHG---EVAIYACPATSDQFLPGAETFA--------VDAAALPGFRV
A7MRP8_CROS8      GHVHRPAAGMLA-------GIPAYICGSVCPANPLWLGGSH-------VPAVFDPPALMV
CPDA_ENTLS        GHNHNLTMTQYR-------QATIATLPATVHQVPYCHEDTR-------PYYDMSPPSCLM
B8J1S2_DESDA      GHMHRPIITQWQ-------GRLCMTAPSAAMQIDLDLSPEG------GDTFRMEAPGYLL
A9WNR5_RENSM      GHYHHGLVDSVLLGDQ---LIPVLVAPGIVNVNDVLASEGH--------ERALRSSGAQL
CPDA_COLP3        GHVHGDMTLTNAITSPINEPVVLYTCPATSIQFDPTVDGVAALS---------KGPGYRL
CPDA_COXBU        GHVHNDYTISYR-------QTLFSSAPATCYQIKKFESDII----------IEEKYGYKN
Q8XSE2_RALSO      GHVHGDYQLQYG-------SQTIEVCPATCFQWEKGTRTAK----------AEDWRGFRI
CPDA_FIBSS        GHYHSEMTIQLE-------DKTVYVTPSTQMQIDPNITVFC---------LSSAAPRWRL
CPDA_XENBS        GHAHTPRVWHHN-------NMTACVSPAVSFQWLSGTNTVK----------ISKGFGFNV
Q15YS5_PSEA6      GHIHQASETRSQ-------DCVFMSAPSTCWQWANSKEFSA----------SGEAPGYRV
                  ** *                       .                                

CPDA_RUTMC        YTLYDNG------QLTIDTQWI--------------------------------------
CPDA_VESOH        YTLYDNG------QLTINTQWI--------------------------------------
CPDA_PSEU9        RMLHLNAEQQKV-HIRTDVVWLNE------------------------------------
Q3IG69_PSET1      RMLYINSSQGQV-HINTDVIWLSA------------------------------------
CPDA_PSYA2        LQLANNG------KVASWVERLDT------------------------------------
CPDA_PSYWF        LSLKANG------TLQSWVVRLEDNAG---------------------------------
CPDA_ECO57        LELHADG------TLTTEVHRLADTRFQPDTASEGY------------------------
CPDA_ECOLI        LELHADG------TLTTEVHRLADTRFQPDTASEGY------------------------
CPDA_HAEIN        IELHSDG------SIRTEVKRIQQAEFFPNMQEEGY------------------------
CPDA_VIBVU        LTLHANG------EITTQVQRLASGSFLPDFTSSGY------------------------
D8JIA6_ACISD      IRLKNDG------SFETEVFRLENFQGLINTNISGY------------------------
CPDA_NOSS1        LKLYADG------TWTTKIERVPYSLPIEPTVTVSY------------------------
B1XQ99_SYNP2      FELHDDG------RFQTKVQRIPWFA----------------------------------
CPDA_PSEAI        LRLHDDG------RLETGISRVDDVVFEVDYDTAGY------------------------
Q2KTW6_BORA1      IKLYADG------SIATGIRRLDAAAWASLQATPTLELA---------------------
CPDA_SYNPX        LEIHNDG------SLSHQVLRWSPC-----------------------------------
Q3AIR5_SYNSC      VELTADG------AIQHRVLRWSSV-----------------------------------
CPDA_SYNPW        LDLMEDG------SVQERLMRWSACEQAAG------------------------------
CPDA_MYCTU        VHVYPDT------VVHSVIPLG-GGETVGTFVSPGQARRKIAESGIFIEPSRRDSLFKHP
CPDA_RHOE4        VHVYDET------IVHSVVPLG-AHVTVGEPVDADEGARRLSAAGIRILESEK-------
A1SEE2_NOCSJ      VHLYDDR------VVHTVVPVDEAPEVSGYPADVRAQVEALTHEQRRDLLSRKDS-----
CPDA_ARCNC        HYWTEEQ------GLTTHTSYIGKFEGPYPFYNEKGELID--------------------
Q4ZTD8_PSEU2      HHWKADT------GLITHWVPIGRFEGPFDFA----------------------------
Q2GBM7_NOVAD      HWFNGR-------ELITHWDTAEDHQVLARYDANLQGMIQHMLAE----RPGAQAAE---
A5V3T9_SPHWW      HLWTGE-------GFVTHHAQVGAPDVLARYDRRLQPLVQALAEEHDTIRPGAAAA----
CPDA_STRAW        HHLTGTG------CVTHTAQVSHAGGLIGGY-----------------------------
A4F6Q6_SACEN      HLIDGAS------AVTHTLPIPPATG----------------------------------
D2BEC1_STRRD      HVFDD-G------RLTTHMRLVR-------------------------------------
E8WFB1_STRFA      HVLDDDG------RLTTHYRVVA-------------------------------------
CPDA_RHOPA        VSVEADR------IVIHQCSFMYDGPLFSLHDSVALHRVSF-------------------
Q89MQ1_BRADU      VLIDGEN------LVVHSHDFLDESLRFPFEPPAGVDGRGYALNIPAR------------
Q6CZA8_PECAS      FLTTKDG------HTVHFHDFPCY------------------------------------
Q1GM28_RUEST      YNWHDVTG-----GLVSDLLPIGDYPGPWPFYD---------------------------
Q28NL1_JANSC      LLALKDT------VVVHTDDFAISDGSVQTY-----------------------------
CPDA_MORCB        IQIDNKG------IVSSYIQIVQNTHSFCLNNAN--------------------------
A5FYX3_ACICJ      HRWDGAS-------FTSQMVFVDSYPGPFPFLS---------------------------
C6D6T3_PAESJ      VSVYEEG------VTVQTVVMPGMQDEFFRFPIEALMAHN--------------------
CPDA_SYNP6        LELEPDG------SWRSQIHWVDTDSIHFA------------------------------
E1V834_HALED      FDLGDAL--------STRVERVAL------------------------------------
A7MRP8_CROS8      HRLEKGT-------LASHFMAVSPVNGR--------------------------------
CPDA_ENTLS        HRQVGEQWVSYQ-HSLAHYAGPWLYDEHISCPTDERRSPC--------------------
B8J1S2_DESDA      HHYEHGILNTHVCQIPSDVTFAGPYPFVGSVNPSGPAR----------------------
A9WNR5_RENSM      HTLFASAPTAAAARVRSLPLNLGVVEELFDLGPEELAEISARISARPDEGSDG-------
CPDA_COLP3        FSLYADG------QLNTEVVML--------------------------------------
CPDA_COXBU        YFLFEEF-------IETNCIWIK-------------------------------------
Q8XSE2_RALSO      FEFSSAG-------YQSTLISV--------------------------------------
CPDA_FIBSS        IEWGENF-------METKVYFSNTP-----------------------------------
CPDA_XENBS        IDFSPDL------SITSCIY----------------------------------------
Q15YS5_PSEA6      IELADNG------QVDSHIIRI--------------------------------------
                                                                              

CPDA_RUTMC        -----------------
CPDA_VESOH        -----------------
CPDA_PSEU9        -----------------
Q3IG69_PSET1      -----------------
CPDA_PSYA2        -----------------
CPDA_PSYWF        -----------------
CPDA_ECO57        -----------------
CPDA_ECOLI        -----------------
CPDA_HAEIN        -----------------
CPDA_VIBVU        -----------------
D8JIA6_ACISD      -----------------
CPDA_NOSS1        -----------------
B1XQ99_SYNP2      -----------------
CPDA_PSEAI        -----------------
Q2KTW6_BORA1      -----------------
CPDA_SYNPX        -----------------
Q3AIR5_SYNSC      -----------------
CPDA_SYNPW        -----------------
CPDA_MYCTU        PMVLTSSAPRSPVD---
CPDA_RHOE4        -------AGRSIV----
A1SEE2_NOCSJ      ----PFYTGELGVPGHT
CPDA_ARCNC        -----------------
Q4ZTD8_PSEU2      -----------------
Q2GBM7_NOVAD      -----------------
A5V3T9_SPHWW      -----------------
CPDA_STRAW        -----------------
A4F6Q6_SACEN      -----------------
D2BEC1_STRRD      -----------------
E8WFB1_STRFA      -----------------
CPDA_RHOPA        -----------------
Q89MQ1_BRADU      -----------------
Q6CZA8_PECAS      -----------------
Q1GM28_RUEST      -----------------
Q28NL1_JANSC      -----------------
CPDA_MORCB        -----------------
A5FYX3_ACICJ      -----------------
C6D6T3_PAESJ      -----------------
CPDA_SYNP6        -----------------
E1V834_HALED      -----------------
A7MRP8_CROS8      -----------------
CPDA_ENTLS        -----------------
B8J1S2_DESDA      -----------------
A9WNR5_RENSM      -----------------
CPDA_COLP3        -----------------
CPDA_COXBU        -----------------
Q8XSE2_RALSO      -----------------
CPDA_FIBSS        -----------------
CPDA_XENBS        -----------------
Q15YS5_PSEA6      -----------------