CLUSTAL format seed alignment for MF_00906

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ZAPC_IDILO        ----------MESESHWLWLFNTES--------GKLSVKLSDTDVFDTPYKPSQLV--NI
K2JUB0_9GAMM      -----------MSVEQGMWIVDDQSQQLQFSCSGSHGVLDDDSTAQPLPYRLKQLV--NL
ZAPC_ECOLI        --------MRIKPDDNWRWYYDEEHD--------RMMLDLANGMLFRSRFARKMLT--PD
ZAPC_SHIDS        --------MRIKPDDNWRWYYDKEHD--------RMMLDLADGMLFRSRFARKMLT--PD
ZAPC_SALTY        --------MRIKPDDNWRWYYDEEHD--------RMMLDLANGMLFRSRFSRKMLT--PD
ZAPC_PANAM        --------MKIKPDDKWRWFYDAEHD--------RMMLDLADGMLFRSRYARKMLT--PD
ZAPC_YERPE        --------MRIKPDDKWRWYFDTEHD--------RLMLDLANGMIFRSRFPSKMLT--PD
ZAPC_EDWI9        --------MNIKPGDRWCWFFDRQHD--------RLMLDLANGMVFRSRFPSKMLT--PD
ZAPC_DICP7        --------MKLIPDDNWRWYFDADQA--------RLMLDLANGMTFRSRFSATMLT--PD
ZAPC_XENBS        --------MKIRPDDQWRWYFDSEHS--------RVMLDLANGMVFRSRFLAKMLTDYAI
D2TZK2_9GAMM      --------MKIKPNNQWRWYYDDEHE--------RMMLDLANGMLFRSCFPAKMLV--AS
ZAPC_PROMH        --------MIIKPDDRWRWYFDDEQQ--------KLMLDLANGMIFRSRFPSKMLS--AT
ZAPC_ALIF1        ---------MLKPSDTWTWYYDNKAQ--------SLMLDLGMDMVFCVNLPHKVLV--EG
ZAPC_ALISL        ---------MLKPSDTWSWYYDNKAQ--------SLMLDLGMDMVFCVNLSPKVLI--NS
ZAPC_PHOPR        ---------MLKPNNSWMWYFDLKDN--------SLMLDLGSDMVFRVGIPAKHLI--PS
ZAPC_VIBVU        ---------MLKPSDKWSWYFDKPSG--------RLMLDLGDRYLFQTNLSDKLLV--DC
ZAPC_VIBCH        ---------MLKPSDKWSWYFSDSEG--------YLMLNLGDDMLFRTNLSRNLLV--DC
ZAPC_AERHH        --------MCIQPNDNWQWHYDAHDD--------RLMLDLSDRMIFATEYKGRQLV--PS
I9DUT5_9ALTE      ---------MLTPSEQWTWHYCPQKD--------RLLLEIDDQLQFCSDLSGANLH---S
H3ZAA9_9ALTE      ---------MLTPSEQWTWYYCPQQD--------RLLLDIDDQLQFSSELSAANLN---D
I1DYV2_9GAMM      ---------MLRPSERWYWTYCPTKD--------RLLLDISDDAQFCSPFAASQLI---S
ZAPC_SHEON        --------MLLLPQKDWHWKYNDSYG--------VLSVSLGSEIEFLTAYKAKSLI--PD
ZAPC_SHEFN        --------MLLMPNKDWHWEYNETCK--------QLSISLGSEMEFLTPYKTKLLI--PD
ZAPC_SHEWM        ----MVEIMLLMPKKDWQWRYSDTYG--------VLSVSLGSEMEFLTPYKSKSLI--PD
ZAPC_FERBD        --------MYITPEPCWAWMYHHDED--------KLALELGEDWLFLSPFSARHLI--PD
K2JAQ6_9GAMM      --------MILEPAPFWAWHYEQQED--------RLAIGLGGDLLFMTPYGSKWLI--PD
ZAPC_PSET1        ---------MLQASKQWQWISCAKKN--------RLLLDLNEDMQLCTPYKLRQLT--DS
A4CC92_9GAMM      ---------MLQASAQWNWYACPTNK--------CLMLDLGDEMEFCTPFKLRLLT--DD
ZAPC_PSEA6        ---------MLLPNTNWFWYTHENE----------LRLDLGDTLTFVAPFALKNLV--NL
F4ARZ3_GLAS4      ---------MLLPNTNWFWYTHENE----------LRLDLGDTLTFVVPFALKNLV--NL
K7A1Y2_9ALTE      -------------MSDWYWFSENRQ----------LMLSMGEEWQCTTAYGQQQII--DL
ZAPC_PSYIN        MCKKTHRIIDFRPQANWYWLFDHNRA--------ILTLNMGD-RVIDIVYKPEMLI--LK
M4U756_9GAMM      --------MIYLPQADWQWSIDPQDN--------SVSVLMGD-DSVELVYQARMFI--SL
ZAPC_TOLAT        --------MILLPDENWRWVFDEQRQ--------SLLLDLSDDMQFVVSVPPKQLA--QK
F7NRV8_9GAMM      ---------MLSLCPDWCWQYCVEQD--------RLVLQLSNSHHIQTAFSAKELK---M
A6FJ69_9GAMM      --------MLLEPSNKWYWQYDCASR--------FIVIQLSDGLAMSCHLDKRNMN--NL
K6YU76_9ALTE      ---------MLLPSGHWKWYIDKQSH--------FLMIELNAGLSFQTAFVDSQLQ---V
                                    *                  :                :     

ZAPC_IDILO        HFNEQMMDIEDATTFQIVSETLEAYPADKMPCAPQNAALNATAWCRFGRPQMPQSWHFQK
K2JUB0_9GAMM      PTSALSFSIEDATHYQQALDYFEPF-TEFDDAERHQIALCVAAWLRFGRPHMPQSWHFQQ
ZAPC_ECOLI        AFSPAGFCVDDAALYFSFEEKC--RDFNLSKEQKAELVLNALVAIRYLKPQMPKSWHFVS
ZAPC_SHIDS        AFSPAGFCVDDASLYFSFEEKC--RDFNLSKEQKAELVLNALVAIRYLKPQMPKSWHFVS
ZAPC_SALTY        AFCPTGFCVDDAALYFSFEEKC--RDFELTKEQRAELVLNALVAIRYLKPQMPKSWHFVA
ZAPC_PANAM        AFTESGFCVDDAALYFTFEEKC--RQSPLSSDQRAELVLNALVAARFLKPLMPKSWHFSA
ZAPC_YERPE        AFDESAFCVDDAALYFEFEDQC--RQIKLSNEQRSELVLNALVACRFLKPLMPKSWHFVQ
ZAPC_EDWI9        AFDASSFCVDDAASYYHFAERC--QASGLDTAQCAELVLNALVAQRFLKPIMPKSWYFTP
ZAPC_DICP7        AFNPSDFCVEDAALFFTYQEKC--LTLNIDAQAKAELVLNALVANRFLKPLMPKSWHFAA
ZAPC_XENBS        TMEEMPFSVDDAALYYAFEEHF--RCINIASELRAELALNGVVAFRFMKPQMPKSWYFSS
D2TZK2_9GAMM      AYGEMIFNIDDAGLYHCIEEQV--QKLSLSNEHSAELILNALVAFRFLKPQMPRSWYFLP
ZAPC_PROMH        AHQSSPFTVDDAALYYGYDEQI--RQIDMPSESRAELALNALIAHRFLKPLMPKSWYFEV
ZAPC_ALIF1        AFSECKFSVDDASAYQMFVEHI--SYLPLSEPRKVELALNCVAAKRFHKPMLPKSWFFET
ZAPC_ALISL        AFDDCKFSVDDASAYQMFVEHI--SYLPLSEPRKVELALNCVAARRFHKPMLPKSWFFET
ZAPC_PHOPR        ASEQCEFTVDDASIFQNYKENV--SHLEISEPRKAELALNAVAASRFHKPMMPKSWFFDT
ZAPC_VIBVU        AFSYNDFTVDDASAFQTFKECL--SSLDLSEYRRDELTLYCVAAKRFHKPVQPKSWFFHS
ZAPC_VIBCH        AFIENPFTVDDASDFQLYKEHI--ACLPLSEPRKAELALYCVAAKRFHKPVQPKSWFFDV
ZAPC_AERHH        SFTTQPFCVDDAALYYQLMDRV--AELEWSVPHQVQLVLNAIAVSRFYKPLMPQSWFFGE
I9DUT5_9ALTE      RIQQQPFSLEEAESYWRFHDAL--LPVISDDALRLELTLHAL-ANRYRQLSAHKSWYFAT
H3ZAA9_9ALTE      KPVRQPFSLAEAEAFWRFHEAL--QPVIADDALRFELCLHAL-ANRYRQLSAHKSWYFAT
I1DYV2_9GAMM      QPVQQALSMAEAEMFWAIDDSL--QLLALPPTVRLEICLTAL-SSAFVLPQGHKSWYFQA
ZAPC_SHEON        ALSSMEFNISHAKFYMSLLDKL-PKTLTLTDAAVVQIALNATAAHFMLTPQMPKSWFFDT
ZAPC_SHEFN        ALTATEFNLEHAKFYIKMLETL-PKVLHISDAGIVQTALNATAAHFLLQSQMPKSWFFDV
ZAPC_SHEWM        ALSELEFSVEHAKFYIDFIELL-SKSLTISDAMKVQLALNGTAAHFLLKPQMPKSWFFDT
ZAPC_FERBD        SLHGAAFSAQHADYYNDVLDRL-RKQLPNSAPEVVQIALNLTAAHFFSLPMMPKSWFFQT
K2JAQ6_9GAMM      ARLGGSFDLDDANYYESVIAAL-EQVELWSDPQRVQIALNACAIRRFAKPSMPKSWFFAE
ZAPC_PSET1        TFKNPYFSLEDAAFYEQVYQYLVQFKL-WNPAQLCQISLNATAVKFQLKPVLAKSWFFEQ
A4CC92_9GAMM      VLENPHFSLRDADFYQQVSSYLASFEL-WNQAQICQIAINATAAKFYLKPVLAKSWFFKS
ZAPC_PSEA6        PSDKQLFSLEDTEHYVALAESLDNSGLELSDGELVQILLNATAALKFHKPIGMKSWLYKT
F4ARZ3_GLAS4      PTEKQLFSLEDTEHYVALAESLDNNGIPLTEGQLVQILLNATAALKFHKPVCMKSWLYKA
K7A1Y2_9ALTE      PKSQQLFNLSDMECYLLLAEHLVASGGQFSDAQLTHILINATAATMFHKPVSPKSWFLDE
ZAPC_PSYIN        FDQPVFFTIEDVANYMDLFEGP--ALGDYWPALRSQIILHALVANQFHKPIMPKNWLFES
M4U756_9GAMM      PQKILSFSLEDVAHYTLLKEQF--CAEQYTADQSCSIILHILAVTLFHKPIMPKSWQYQT
ZAPC_TOLAT        QAFTEHFSLDDSSLYFHFLECL--GEFPFTDPERVQIVLNAVAAVKYTRPLVSQSWYYRD
F7NRV8_9GAMM      LPEQQRLCMEQAQLLMDFAEAL---EGLLPDTELLTVAAQAVAALSFVKAPVQKSHLFNF
A6FJ69_9GAMM      CKGRINFCAEDSSYYYYFLEAL--KDLDFNVPEKVQIALNAVTSLRFQKVKMPQSWFFDY
K6YU76_9ALTE      IPENLYFEILHSQCFIESLEAVNQSNVPFEQSVKTQIALNATAAKCFHKPVIHKSWLYEK
                        :   .                                          :.     

ZAPC_IDILO        SD---ISEWPLERRLCELNSGFDQGLFLILDTDDEFATCLLLSEGMQLSA-IKSLRQYHV
K2JUB0_9GAMM      AH---TDNWPVNKRLCELNSGFAQGLFYIIARDDEFSECMLIDGDMPLSD-IKTLHRYQT
ZAPC_ECOLI        HG-EMWVPMPGDAACVWLSDTHEQVNLLVVESGENAALCLLAQPCVVIAG--RAMQLGDA
ZAPC_SHIDS        HG-EMWVPMPGDAACVWLSDTNEQVNLLVVESGENAALCLLAQPCVVIAG--RAMQLGDA
ZAPC_SALTY        HG-EMWTPGTGDAASVWLSDTAEQVNLLVVEPGENAALCLLAQPGVVIAG--RTMQLGDA
ZAPC_PANAM        HR-QPMQPAVGEMVAVTLADSGEQARLLVVENGDNAALCLLAQPALTLAG--KGMVLGDA
ZAPC_YERPE        QP-KVLIPQNGELTLVTVLDNGENVRLLVVEPSCSASLCLLAQSQVVLAG--RQLVLGDA
ZAPC_EDWI9        QP-GRYVPEMGELVGVQLLDTPDWGRLLVIAPGASASLCLLAQPSLALAG--KRLMLGEA
ZAPC_DICP7        LGHGEYCPQLGELVWVRLNERLEDACFMVVDTGDKASLCLLAQAELALSG--KVMVLGEA
ZAPC_XENBS        FS-VMTKPEQGEIVQVRLQDCGTEVLFMVAEVGDSASLCLLAQQKLELSD--RVMNFCDP
D2TZK2_9GAMM      VH-CHDDLVLGDVVQVHIEDSEQQALFLVAEAGKYASLCLLIEPKLVLKD--RVMRFCDP
ZAPC_PROMH        SH-SSTRPYLAQVVETALKDSNEKVLFLVAEVGEQACLCLLAQPQLALFD--RTLTFCDP
ZAPC_ALIF1        QSDAGYAPEEG--EVISLKNDLGEGHFIIVENYECASMCMLVDMDAFALNPTKYMAFCEP
ZAPC_ALISL        QG-AGYYPEEG--EIVSLKNDLGEGHFIIVENYECASMCMLVDMDAFALNPTKYMAFCEP
ZAPC_PHOPR        QS-VSCDPENS--DIVTLQTPLGMAKFIVIENSGCASLCMMVDVEPLALSSTKEIRFCDT
ZAPC_VIBVU        TG-SDYQPSEG--ELVQLQNGLNQGLFIVLEAGDNASLVSCVELEGFMLSGSKSLSYGEA
ZAPC_VIBCH        QG-TGYTPQQG--QLISLRNSLNSGIFIALEVGENATLCAYSDLVSFALNGSKTLEFGQV
ZAPC_AERHH        TH-PAIIPETG--ALVCMGTPHGKGEFLVIEAGEQASVCLNLTDDLILTT-SKTLPRFGV
I9DUT5_9ALTE      QR----SQDSGLYQLVQLQGKDTITALVVASDLE-CVECLLLEAGESLAG--KLLARSTV
H3ZAA9_9ALTE      QR----AQDSGLYQLVQLQGKDTLLALVVASDLE-CVECLLLEDGESLAG--KQLSRHTV
I1DYV2_9GAMM      YS----EYSPKAFELVRLHGSNSQYALVVATEGQ-SSSCLLLGEVDTLAG--KTLPRLHL
ZAPC_SHEON        S--EVCVYSDVGKVFELKCQKQRALVLVVENTL-QSALVMLLSPECVLSG-AKTLGQFET
ZAPC_SHEFN        S--DECVYCEVGKLFQLNCGYSKVLALVVDNGL-QAATVMILSQYCQLSD-SKSLVQFDT
ZAPC_SHEWM        S--SMCVYSELGKVFQLKCRGAIAQVLVVETSI-QASLVMLLSNELPLND-NKSLMQFEC
ZAPC_FERBD        S--AHIAYACNGKLVELDTGSERARFAVVDGGE-QSSLLMLLEQSLALGN-KKTMKQFEL
K2JAQ6_9GAMM      NP-QEHRLGCVPALVSLQTAFGRGQCLAIECFESNSTLCMLLDGPLGLSD-SQTLECFQV
ZAPC_PSET1        YT-GSTPSTEAVINLTSKAQS---GEFLIVEHSSDASVCINLSENFQLDD-NLSLVQFEA
A4CC92_9GAMM      YT-GSVQSTEAIVLLQSKMVE---GQFLIVDHTEQASLCLNLEKNYQLDE-NLSLQQFEV
ZAPC_PSEA6        QS-TSGVHYQLALLEPTDTAYPELGQVIVIEQDGACATCMLISNEFAVNS-SKKFSKFEM
F4ARZ3_GLAS4      QN-TSGAHFQLAMLEASFDDNAELGQVVVLEQDDSCATCMLISEDFMISD-RKALAKFEI
K7A1Y2_9ALTE      IE-SFGFHHRLARVVNKFNT----GVVLVLTDEHNLATCMLISSKLQLNE-NKFLRQFDL
ZAPC_PSYIN        SVGEQPRVHKGDHIILKSSAIKEAKKYFVLDNDENFILCMLIEKSHGLTF-NRNFVQFQI
M4U756_9GAMM      CAIEALDIRSRECVYLTSDQEKVTAKYFVIDVDDKFALCLLVDTQHILTS-RKTLRQGQI
ZAPC_TOLAT        VD--MLSGEPELGEVFSVVTEFTYGDVMIISPGSNASLCIVISQAIQLDA-DKSLRQSSV
F7NRV8_9GAMM      SS----IECHTNLMSIAKLEGASRAKVVLVAKADPMVDCLLLESMELLNG--KQLAAGQL
A6FJ69_9GAMM      ND---SDVSFSTGDIITLSLKGHNVQFVILEADERVSTCMLLEDTVQLSD-AKKLARFDV
K6YU76_9ALTE      HP---SCLVGPEQQLAWLSCNQESYLVLTLQQQGSLALCLNLSEDFKTAD-NKIHKQFSL
                                                                              

ZAPC_IDILO        IKVTLNRLLPATVDLALSAQSNWGQQLA--
K2JUB0_9GAMM      VKVLHNRLLPATIELIASTR-----RLA--
ZAPC_ECOLI        IKIMNDRLKPQVNVD---SFSLEQAV----
ZAPC_SHIDS        IKIMNDRLKPQVNVD---SFSLEQAV----
ZAPC_SALTY        IKIMNDRLKPQVHCH---SFSLEQAV----
ZAPC_PANAM        IKVMNDRLQPHQQEK---TTRYARAV----
ZAPC_YERPE        IKIMNNRLLPLMVEEVNTTTAYDRAV----
ZAPC_EDWI9        IKVMHDRLLPLSTHPETLSDDTTLACAG--
ZAPC_DICP7        IKIMHDRLCPVDEGADHAQSSLHFAHAG--
ZAPC_XENBS        IKIMNDRLMPYVEPT--RETIYGRVI----
D2TZK2_9GAMM      IKIMNNRLMIYQPPA--SSLLYERAVS---
ZAPC_PROMH        LKIMNDRLSEYHKQSEPRSFLYEKVI----
ZAPC_ALIF1        IKVMHDRMAPMQVVNSS-YYAMVG------
ZAPC_ALISL        IKVMNDRMAKMQVVNSS-YYALVG------
ZAPC_PHOPR        IKVMNNRITAYEEDAIL-NLALVG------
ZAPC_VIBVU        IKVMHDRMSTAARMNTLMPMALVG------
ZAPC_VIBCH        IKVMHDRMSDVNTLLYTPQMAMVS------
ZAPC_AERHH        IKVMNNRMSPRPVAQAQYRQVS--------
I9DUT5_9ALTE      IRVLRNRATPIEQDVNLARTA---------
H3ZAA9_9ALTE      IRVLRNRALPTEVDVGYARTA---------
I1DYV2_9GAMM      LRLLNNRLLPLQQGAQYRQSA---------
ZAPC_SHEON        IKVMHNRLHPLR--AQRHVVAA--------
ZAPC_SHEFN        IKVMHNRLHPLR--KARQVVAA--------
ZAPC_SHEWM        IKVMHDRLHPLK--VSRAIAAA--------
ZAPC_FERBD        IKVMNDRLSPCQSLKHRRIVAA--------
K2JAQ6_9GAMM      VKVMNNRLWPSQWQQQLDPLRRVS------
ZAPC_PSET1        IRVLNNRVHPLLNQHIHSKIA---------
A4CC92_9GAMM      IRVLNDRIYPLNIRNSVKKRA---------
ZAPC_PSEA6        IKVMNDRLIPCLVDIPVYKRA---------
F4ARZ3_GLAS4      IKVMNDRLIPFLADIPEYKRA---------
K7A1Y2_9ALTE      IKLAKNRLEPLLAETSSQLTA---------
ZAPC_PSYIN        VKVTYDKIFATKADCNTLSQYV--------
M4U756_9GAMM      VKVSLDKITLIDDGDAG-------------
ZAPC_TOLAT        CKLMNSKLLPYQAATQYLSKMA--------
F7NRV8_9GAMM      VRVQQNRLMPVQFAPLYALTA---------
A6FJ69_9GAMM      IRVMNDRVQLHNAVAKKVTDDSFSFVQIMA
K6YU76_9ALTE      INVHSDRLVSLEQINDDPIEQSNEHIN---
                   .:  .: