CLUSTAL format seed alignment for MF_00908

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SEQA_ECOLI      MKTIEVDDELYSYIASHTKHIGESASDILRRMLKFSAASQPAAPVT--------------
SEQA_SHIFL      MKTIEVDDELYSYIASHTKHIGESASDILRRMLKFSAASQPAAPVT--------------
SEQA_ECOL6      MKTIEVDDELYSYIASHTKHIGESASDILRRMLKFSAASQPAAPVT--------------
SEQA_SHIDS      MKTIEVDDELYSYIASHTKHIGESASDILRRMLKFSAASQPAAPVT--------------
SEQA_SALTY      MKTIEVDDELYSYIASHTKHIGESASDILRRMLKFSATTQPTASAV--------------
SEQA_ENT38      MKTIEVDDELYAYIASHTRHIGESASDILRRMLKFSAASQPATPVS--------------
SEQA_PANAA      MKTIEVDEELYRYIASHTQHIGESASDILRRMLKFTAGQPAAVNDT--------------
SEQA_PROMH      MKKIEIDDELYRYIASETRHIGESASDILRRLLKLDAKQPVQPVVV--------------
SEQA_HAMD5      MKLIEVDEELYRYIAAHTQYIGESASEILRRMFSLTQKKQTEIKIK--------------
SEQA_AERHH      MKTIELDDDLYFYIASQTRHIGESASDILRRLLEQPANQAAPVT----------------
SEQA_TOLAT      MKTIEVDDQIYRYIASRTLHIGESASDILRRLLALPLDTEPTVAL---------------
SEQA_PHOPR      MKSIEVDEELYRYIASQTQHIGESASDILRRLLMVPAEQQLEVVVP--------------
SEQA_ALIF1      MKTIEVDEELYRFIASQTQHIGESASDILRRLLMQSSPSDLAVSAP--------------
SEQA_VIBCH      MKTIEVDEDLYRYIASQTLHIGESASDILRRLLNVDGE-LATAAPA--------------
SEQA_VIBA3      MKTIEVDEDLYRFIAGQTERIGESASDILRRLLLVDNQGTVPIEEI--------------
SEQA_HAEIN      MKIIEVDEELYQYIASQTRSIGESASDILRRLLSLPVHTSIVNDLI--ITSAETDQ----
SEQA_HAEP3      MKIIEVDEELYQYIAAQTQSIGESASDILRRLLNLPTHATSSVDFFESVASAETPKSAVH
SEQA_MANSM      MKIIEVDEELYQYIASQTKSIGESASDILRRLLNLPVSGVNLTAVDLTQSTMNSTNEEKG
SEQA_ACTSZ      MKIIEVDEELYQFIASHTQSIGESASDILRRLLNLPTSSVSSVALE--TVAVESAEAANP
SEQA_HAEDU      MKTIEVDDELYHYIASRTQAIGESASDILRRLLRLPSSPQPFVLVQ--------------
SEQA_HAEPS      MKTIEVDDELYHYIASRTQAIGESASDILRRLLRLPASPQPFVLVQ--------------
SEQA_PSYIN      MKNIEIEDDLYKYILANIEAFGETPSQILRRLLSLPNASPDNATPI-----------TSS
SEQA_IDILO      MKRIDIDDDLYTYIASHTRQIGESASDILRRLLDVN------------------------
SEQA_PSET1      MKQIDIDDELYQYIASNTQSIGESASTILRRLLNLSGEKIQTANVELNQNNQTTTTLP--
SEQA_COLP3      MKNIEIDEELYQYIATNTQFIGESASAILRRLLNLGVEAKLETVTVNEPSDVVEVNILPE
SEQA_SHEDO      MKYIEVDEELYRFIASKTERIGESASDILRRLLTLPVDTVTP------------------
SEQA_SHEON      MKYIEVDEELYRHIASKTERIGESASDILRRLLGLSVDTVEQ------------------
SEQA_SHEFN      MKYIEIDEELYRFIASKTERIGESASDILRRLLNLSVENVDV------------------
SEQA_SHEAM      MKYIEVDEELYRYIAGKTERIGESASDILRRLLGLSVAEVSE------------------
SEQA_SHEHH      MKYIEVDEELYRHIASKTEHIGESASDILRRILGLQVESVVQ------------------
SEQA_SHEWM      MKYIEVDEELYRLIASKTERIGESASEILRRLLGLEVEASATQE----------------
SEQA_FERBD      MKYIEIDDELYRYIASNTQQIGESASDILRRLLGLEVTAEAE------------------
SEQA_PSEA6      MKNIEIEDDLYAYIASQTQHIGETASDILRRLVMPENTVVKT------------------
                ** *::::::*  *  .   :**:.* ****:.                           

SEQA_ECOLI      ----KEVRVASPAI----------------------------------------------
SEQA_SHIFL      ----KEVRVASPAI----------------------------------------------
SEQA_ECOL6      ----KEVRVASPAI----------------------------------------------
SEQA_SHIDS      ----KEVRVASPAI----------------------------------------------
SEQA_SALTY      ----KGTPAAQP-V----------------------------------------------
SEQA_ENT38      ----KEVR-ASNVV----------------------------------------------
SEQA_PANAA      ----QPVSAPAPSK----------------------------------------------
SEQA_PROMH      ----TESVQAPVVK----------------------------------------------
SEQA_HAMD5      ----KTPKIHQSSV----------------------------------------------
SEQA_AERHH      ------------------------------------------------------------
SEQA_TOLAT      ------------------------------------------------------------
SEQA_PHOPR      ----VRP---KGII----------------------------------------------
SEQA_ALIF1      ----VEVQ-KKGIV----------------------------------------------
SEQA_VIBCH      ----AEP---KGIV----------------------------------------------
SEQA_VIBA3      ----VEP---KGIV----------------------------------------------
SEQA_HAEIN      -KPKQAINVKEVNI----------------------------------------------
SEQA_HAEP3      AEPVLTEKTTEVSQPKVEPV----------------------------------------
SEQA_MANSM      TQLPAEKNVVAETPKPSSEQ----------------------------------------
SEQA_ACTSZ      ETPSAVKNDFVLEPVAEKS-----------------------------------------
SEQA_HAEDU      PNIAEELNASTKST----------------------------------------------
SEQA_HAEPS      ENMINELKDLAKLP----------------------------------------------
SEQA_PSYIN      VTPSAPRQEAVNDESSVFEA----------------------------------------
SEQA_IDILO      ------------------------------------------------------------
SEQA_PSET1      -KVPPVAEQTPALAAK--------------------------------------------
SEQA_COLP3      SEEKAVKIETAEVKEP--------------------------------------------
SEQA_SHEDO      --FEPNAIDEPSLDVAHHQASNFAASNQEQQTGHGHAGEPSAVQTPESNDYAKAQPHSSG
SEQA_SHEON      --AQPQAISQPSLEAA----------------------------TPE-------------
SEQA_SHEFN      --SLPTDISHPSLESQ----------------------------SPVNRHPVFDQAKAA-
SEQA_SHEAM      --VAPVDISEPGMEHE-----------------------------PVQVREAE-------
SEQA_SHEHH      --DAPEEISHPSLERVS--------------------------PKPVKV-----------
SEQA_SHEWM      -KDEPEVISQPGLEET--------------------------------------------
SEQA_FERBD      --SIPERISEPSMEGV--------------------------------------------
SEQA_PSEA6      -----VVAAKPSATTK--------------------------------------------
                                                                            

SEQA_ECOLI      ----------VEAKPVKTIK-------------DKVRAMRELLLSDEYAEQKRAVNRFML
SEQA_SHIFL      ----------VEAKPVKTIK-------------DKVRAMRELLLSDEYAEQKRAVNRFML
SEQA_ECOL6      ----------VEAKPVKTIK-------------DKVRAMRELLLSDEYAEQKRAVNRFML
SEQA_SHIDS      ----------VEAKPVKTIK-------------DKVRAMRELLLSDEYAEQKRAVNRFML
SEQA_SALTY      ----------AEAKPVNPVK-------------DKVRAMRELLLSDEYAEQKKAVNRFML
SEQA_ENT38      ----------AEAKTVAPVK-------------DKVRAVRELLLSDEYAEQKKAVNRFLL
SEQA_PANAA      ----------AAPSAGNESR-----------PQDRVRAVRELMLSDEYAEQKRAVNRFML
SEQA_PROMH      ----------QDADLKPVAP-----------AKNPVREMRELLLSDSYAEKTKSVDRFLQ
SEQA_HAMD5      ----------KATLF------------------SRIQILNDILSSETYASKNKVIARFML
SEQA_AERHH      -----------EPVTTAQPH-----------TVADAMGLEALLDSGELQKEEKSINRFMQ
SEQA_TOLAT      -----------GHEANAEQT-----------DEVSTDVLTMLLDNAQLAKEESAIARFML
SEQA_PHOPR      ----------VSKDAGNEH------------KLDRVKEMRTLLISDEFAVQGKAIGRFMM
SEQA_ALIF1      ----------VSKDAGKEA------------SVDRVKAVRTLLISDEFSALDKAIDRFLT
SEQA_VIBCH      ----------VSKDAAFDT------------KIDGVKAMRSLLISDEFAGLKNAIDRFML
SEQA_VIBA3      ----------VSKEVGFTPE-----------KFDGVKEMRSLLISDEFASLKKAIDRFML
SEQA_HAEIN      ----------KTTKKQSITA-----------INQIVEKVQTLLNSTEFQEESKAVVRFLA
SEQA_HAEP3      -------EPPKAVKKQSDEA-----------INHIVDKVRALLNSAEFKEEPKAVVRFLS
SEQA_MANSM      -------EIRTPARKQSTQS-----------IQHIVTKVKNLLQSEAFQEESKMVVRFLN
SEQA_ACTSZ      -------SLEKTVKKQPEQV-----------ICHIVNKVRQVIESEAFQHETKAVVRFLA
SEQA_HAEDU      ----------NQAKKQTN-------------IEKTVQKFERVLKSDTFVNETKNVRRFLM
SEQA_HAEPS      ----------KQKKQLHQ-------------QDKVIKQVEFVLASSLFNNETKGVNRFLY
SEQA_PSYIN      -------VTPKVLDRANISL-----------PEPLAHGVNALFDSEVFKTEAVVTNKFMM
SEQA_IDILO      -----------SSEPEADS------------KSEPTESVFNRLNEQDVRIQKSVVARFLY
SEQA_PSET1      -----------PSAVAEKS------------VQQKNANVFNVLNKEELAMQKGVVGRFLF
SEQA_COLP3      -----------KSKAVVKV------------TAESHETVFNFINKEELAMQRGAVGRFLL
SEQA_SHEDO      YQPGQLEGHKSEPQTLAQLNSQPLAVGQSSQSATSQVDFNALVNEHLLSQQKGAVGRFMW
SEQA_SHEON      ------------PQFVPQV-----------ETFVAAADFHQLVDEHKLEQQKGAVGRFLF
SEQA_SHEFN      ----------VEKVIADQNSANEHYPVDEDIASSTSIDFDAMVSQHLLSQQKGAVGRFMY
SEQA_SHEAM      ------------PEPVPEV----------EVAAQTEIDFSDLLSEAGLAAQKGAVGRFLY
SEQA_SHEHH      ------------AKVITKM------------TSTAVSDFTSLIDADVLAAQKGAVGRFLF
SEQA_SHEWM      ------------ADVEDK---------------PRFIDLHSSINKEELAAAKGAVGRFLF
SEQA_FERBD      ------------EEAAPVR-----------SAVAEAGVFEELVDDEQLPRQKGAVGRFLY
SEQA_PSEA6      ---------------------------------KPVGDVFSQITTDELSEYPKMVERFLK
                                                      .   .             :*: 

SEQA_ECOLI      LLSTLYSLDAQAFAEATE--SLHGRTRVYFAADEQTLLKNGNQ--------TKPKHVPGT
SEQA_SHIFL      LLSTLYSLDAQAFAEATE--SLHGRTRVYFAADEQTLLKNGNQ--------TKPKHVPGT
SEQA_ECOL6      LLSTLYSLDAQAFAEATE--SLHGRTRVYFAADEQTLLKNGNQ--------TKPKHVPGT
SEQA_SHIDS      LLSTLYSLDAQAFAEATE--SLHGRTRVYFAADEQTLLKNGNQ--------TKPKHVSGT
SEQA_SALTY      ILTTLYSLDHHAFAEATE--SLHGRTRVYFAADEQTLLKNGNQ--------TKPKHVPGT
SEQA_ENT38      VLTTLYSLDNKAFAEATE--SLHGRTRVYFAADEQTLIQNGNQ--------TKPKQVPGT
SEQA_PANAA      ILSTLYRLDTAAFAEATT--SLQGRTRIYFAGDEHTLLQSGTH--------TKPKHVPGT
SEQA_PROMH      ILSTLYSLDSATFTQSAE--TVHGRTRIYFAGDEKTLLDSGRH--------TKPRHIPGT
SEQA_HAMD5      ILSTLYDLDSKAFSVAAE--SLQGRKRAYFSGSKNFLLKNGTH--------TKPKQIPKT
SEQA_AERHH      VLSTLYRDDPVGFTQATE--IK-GRKRVYFSRDPDALRASGST--------TKPKPVPET
SEQA_TOLAT      ILSALYRSQPDAFRHAAD--IK-GRKRIYFAEDPQALLDNGKT--------TKPKPVPET
SEQA_PHOPR      ILSSLYRIDSDGFIEAAA--IK-GRTRVYFADNEEALLASGKT--------TKPKAIPET
SEQA_ALIF1      VLSELYKIDSKAFSEATE--VK-GRTRVYFADNQETLIASGKT--------TKPREIVGT
SEQA_VIBCH      ILSTLHRIDSASFSEATM--FK-GRKRVYFADNEQTLLASGQT--------TKPKAIPNT
SEQA_VIBA3      VLSTLHKIDPLSFSEATQ--VK-GRKRVYFADNEATLLANGNT--------TKPKAIPQS
SEQA_HAEIN      ILRVLYRTNPESFAQATE--SLQGRTRVYFARDEATLLMAGNH--------TKPKQIPDT
SEQA_HAEP3      ILRTLYRTNPESFAQATE--SLQGRTRVYFARDEGTLLVAGNH--------TKPKQIPDT
SEQA_MANSM      ILSVLYRTNPESFAQATEQETSQGRTRTYYARDEATLLAAGNH--------TKPRQIPDT
SEQA_ACTSZ      ILTALYRTNPEGFSLAIESEQVQGRTRVYFARDEATLLAAGTH--------TKPKQIPDT
SEQA_HAEDU      LLSALHISDQQGFANATA--VVTGTERTYFATNEDMLLRCGNG--------VKAKKIPDS
SEQA_HAEPS      LLSALYKADPESFSHATE--NVQGSERIYFARDEQTILATGSS--------VKAKQIPES
SEQA_PSYIN      LLATMYYENKNAFEDAAD--KTKGRTRDYLGQNLNALLAADSEEEQNFFKASKPRNIPHT
SEQA_IDILO      ILSMLYRCHPSEFSQVLD---IRGRDRQYFARSEEALLTSGNS--------TNPKQIPDS
SEQA_PSET1      ILSAFYRTHKTDFRAVLD---IKGRDRVYFATSKEDLVNSGSS--------MNPKNITDS
SEQA_COLP3      ILAALYRAHPDQFGVVTD---ISGRDRLYFANSENKLAESGSS--------TKPRQIPES
SEQA_SHEDO      LLEGLAALAPSQFNKVLL---VQGKGRLYFARSKDELLASSAS--------ANPKEIGTT
SEQA_SHEON      LLESLYQLNKTQFAQILQ---IQGRDRLYFARSREELLKASAT--------ANPKEIGQT
SEQA_SHEFN      LLSSLESTAGSDFDKVLN---VQGKGRLYFARSKQALLNSSKS--------SNPKEIASS
SEQA_SHEAM      ALECLHQAAPSRFEQVLQ---IQGRDRLYFATSKEALLKASQS--------ANPKEIGSS
SEQA_SHEHH      ILDTVHRASPVQFEQVLQ---IQGRDRLYFATSKDALLKASKS--------ANPKEIGQS
SEQA_SHEWM      ILEAVYLASPEQFAQVLK---IKGRDRLYFATSKQSLLKASKS--------ANPKEIGQS
SEQA_FERBD      LLDCLYRQHPSAFDGVLA---IRGRDRLYFSQSKEALLKASPS--------ANPKQIGAS
SEQA_PSEA6      ILSVLESMHGAQFDEVLT---LSGRNRVYFAKDKETLLQASSV--------TNPKQIGES
                 *  .       *          *  * * . .   :   .           :.: :  :

SEQA_ECOLI      PYWVITNTNTGRKCSMIEHIMQSMQFPAELIEKVCGTI-------
SEQA_SHIFL      PYWVITNTNTGRKCSMIEHIMQSMQFPAELIEKVCGTI-------
SEQA_ECOL6      PYWVITNTNTGRKCSMIEHIMQSMQFPAELIEKVCGTI-------
SEQA_SHIDS      PYWVITNTNTGRKCSMIEHIMLSMQFPAELIEKVCGTI-------
SEQA_SALTY      PYWVITNTNTGRKCSMIEHIMQSMQFPAELIEKVCGTI-------
SEQA_ENT38      PYWVITNTNTGRKRSMVEHIMQSMQFPAELIEKVCGTI-------
SEQA_PANAA      PYWVITNTNTGRKRSMVEHIMLSMQFPSELAEKVCGTI-------
SEQA_PROMH      PFWVITNSNTERKRTMVQSIMQDMQFPANEIDKVCGTI-------
SEQA_HAMD5      PYWVITNTNSERKRTMLKNMMIAMKFPNEIAKKVSQTI-------
SEQA_AERHH      PFWVITNTNTSRKQNMVAQLMTSMGYGDEVIARVCGAI-------
SEQA_TOLAT      PYWVITNTNTGRKRLIIEQLMQAMGYSADLIAEVCNKV-------
SEQA_PHOPR      PYWVITNTNTDRKRQMVDQLMVKMNYNTDIIEKVCGVI-------
SEQA_ALIF1      PFWVITNTNTNRKRHMVELLMERMGFQHDLTEKVCAAI-------
SEQA_VIBCH      PFWVITNNNTSRKQQMVEQVMVRMGFPSDIIEKVTHSI-------
SEQA_VIBA3      PFWVITNNNTSRKRQMVEQLMSRMNFQAELIEKVTGSI-------
SEQA_HAEIN      PYWVITNTNSGRKMLMLEGAMQSMELPETLIDEVRSYFTVN----
SEQA_HAEP3      PYWVITNTNSGRKMLMLEGAMQSMHLPEYLIDEVRPYFVSN----
SEQA_MANSM      PYWVITNTNSGRKMLMLERTMQFMELPEELIDEVRPYFAVV----
SEQA_ACTSZ      PYWVITNNNSGRKMIMLEGVMHGMQLPDELIEDIRGYFIVN----
SEQA_HAEDU      PFWVVTNNSTARKGLILTAVMQSMQMPSHLIDRVRVLFA------
SEQA_HAEPS      PFWVITNNNTERKGIILCALMNAMELPEELVARIKAQFN------
SEQA_PSYIN      PFWVITNANTGRKRIIITQMMASMGYPHYLIERIKEEI-------
SEQA_IDILO      PFWVITNTNTTKKKAMLTQVAEKLGYQSADAEKIRDFL-------
SEQA_PSET1      EYWVMTNSNTTRKKMMLHEVALCLGYSTEQAEKIRDYL-------
SEQA_COLP3      PFWVITNSNTTRKKMMLTKASISLGYSDSDVEKIRELL-------
SEQA_SHEDO      GYWVTTNNNTAKKQAILVEVLTKLHCDETLASAIADRICDKVAG-
SEQA_SHEON      GFWVTTNNNTAKKRAILAEALVQFGCDAEIANGIAERV-------
SEQA_SHEFN      GFWVTTNNNTAKKQTILTEVLEHLGCDSERAKSIAEHI-------
SEQA_SHEAM      GFWVTTNNNTAKKRTILEEALVQLGCDPVRAKSLGELALA-----
SEQA_SHEHH      GFWVTTNNNTAKKRTILSEVLLQFGTDEAQVTDIIEKI-------
SEQA_SHEWM      GYWVTTNNNTAKKRTILTEVLHQYGTVEAQIESITRNI-------
SEQA_FERBD      PFWVSANNNTAKKRAILEEVLEILGCQKALAARIAEQV-------
SEQA_PSEA6      TFWVMTNNNTAKKASLIKEVAEVLGYNANDGQRLAALFAPELYED
                 :** :* .: :*  ::                :