CLUSTAL format seed alignment for MF_00909

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

FTSZ1_ARCFU           -------------------------------------------------MFMKSIVEEAL
Q8TI85_METAC          ---------------------------------------------------MRSIVEEAL
FTSZ1_HALVD           ---------------------------------------------------MDSIVGDAI
FTSZ1_HALSA           ---------------------------------------------------MDSIVQDAI
FTSZ1_PYRFU           ---------------------------------------------------MLKLVENVV
FTSZ_METTH            ----------------------------------------------------MKFINDAI
FTSZ1_METJA           ----------------------------------------------------MKFLKNVL
B1L6L0_KORCO          ---------------------------------------------------MIRTATRRV
Q74ML8_NANEQ          -----------------------------------------------------------M
Q9HKT7_THEAC          ----------------------------------------------MCLTSVIWMIVFSK
FTSZ_THEAC            ----------------------------------------------------MGDITDLL
Q8TJB2_METAC          --------------------------------------------------------MQSI
FTSZ2_HALSA           --------------------------------------------------------MQDI
FTSZ2_METJA           --------------------------------------------------MIYKFNIRNL
FTSZ2_PYRFU           ------------------------------------------------------MLEKLL
FTSZ2_THEKO           ------------------------------------------------------MVFKLL
Q74M90_NANEQ          ------------------------------------------------------MVMDDI
B1L6V7_KORCO          -------------------------------------------------MGKEEKINSSG
Q819Q7_BACCR          ------------------------------------------------------MLEFDT
A0A0F7RD19_BACAN      ------------------------------------------------------MLEFDT
FTSZ_BACSU            ------------------------------------------------------MLEFET
FTSZ_STAAM            ------------------------------------------------------MLEFEQ
Q2RK72_MOOTA          ------------------------------------------------------MLEFED
A5I4W6_CLOBH          ------------------------------------------------------MLDFDV
FTSZ_SYNY3            MTLNNDLPLNNIGFTGSGLNDGTEGLDDLFSSSIVDNEPLEALVETPTFASPSPNLKRDQ
Q7NNW0_GLOVI          -----------MGIFDSNPDEKIQAAAYFQSKSHVRLNETSAGSYRAMAPQPGMGMRIDE
FTSZ_ENTFA            -----------------------------------------------------MEFSLDN
Q8DNV9_STRR6          -----------------------------------------------------MTFSFDT
FTSZ_STRCO            ----------------------------------------------------------MA
FTSZ_MYCTU            ----------------------------------------------------------MT
Q8G7W7_BIFLO          ------------------------------------------------------MSEIAQ
Q5SJC5_THET8          ------------------------------------------------------------
Q9RWN5_DEIRA          ------------------------------------------------------------
D1BA07_THEAS          --------------------------------------------------------MAEL
D1B7F4_THEAS          -------------------------------------------------------MAHPL
Q89FV3_BRADU          -------------------------------------------------------MTISI
Q89XY9_BRADU          ----------------------------------------------------------MA
A9CIB1_AGRFC          -------------------------------------------------------MTIQL
A9CGZ3_AGRFC          --------------------------------------------------------MTQS
FTSZ_CAUVC            -------------------------------------------------------MAISL
Q3J4L5_RHOS4          ------------------------------------------------------MALNLM
FTSZ_RICPR            -------------------------------------------------------MVLNI
Q748E1_GEOSL          ------------------------------------------------------------
Q8KGD8_CHLTE          ------------------------------------------------------------
FTSZ_ECOLI            ------------------------------------------------------------
A0A384LQ43_YERPE      ------------------------------------------------------------
FTSZ_BUCAI            ------------------------------------------------------------
Q8E9Q1_SHEON          ------------------------------------------------------------
FTSZ_COXBU            ------------------------------------------------------------
FTSZ_PSEAE            ------------------------------------------------------------
FTSZ_HAEIN            --------------------------------------------------------MLYP
Q5NI93_FRATT          ------------------------------------------------------------
Q63QK2_BURPS          ------------------------------------------------------------
Q7VUQ8_BORPE          -----------------------------------------------------------M
FTSZ_NEIMB            ----------------------------------------------------------ME
Q2S524_SALRD          ------------------------------------------------------MDQDFS
B5YFS8_THEYD          --------------------------------------------------------MFEI
Q8F8E5_LEPIN          -------------------------------------------------------MIRFE
FTSZ_THEMA            --------------------------------------------------MGFDLDVEKK
Q6MT25_MYCMS          ----------------------------------------------------------MT
FTSZ_AQUAE            --------------------------------------------------------MEEF
Q8A262_BACTN          --------------------------------------------------------MDEI
Q0PAI3_CAMJE          ------------------------------------------------------MSEFLV
FTSZ_HELPY            -------------------------------------------MVHQSEMENYNIGQASI
A9WH25_CHLAA          -------------------------------------------------------MQSTA
FTSZ_MYCPN            ----------------------------------------------------MDWIQTAG
FTSZ_MYCGE            ----------------------------------------------------MDENETQF
                                                                                  

FTSZ1_ARCFU           ARAE----REKKERIEGRG-------FEDVEDEILQVLHELKTVIKVIGVGGGGCNTITR
Q8TI85_METAC          ARSA----LEGRAVQGEYSDSDYSNENLEVDAELEEILRSLKTTIKVIGCGGGGSNSIQR
FTSZ1_HALVD           DEAE-AEDMGDESAQVDGAA-NINRSGTMTDDELKAVLKDLQTNITVVGCGGAGGNTVNR
FTSZ1_HALSA           DEAEESEDSASEPADVAGGGGDTVPTGTMTDNELEDVLQELQTNITVVGCGGAGSNTVDR
FTSZ1_PYRFU           GRVS----EEENKVPEVQVP------QSSIDEELKKIVEQIKARIYVVGVGGAGCNTVNR
FTSZ_METTH            KESE----KREK--PSSSSM------NSEIDRELREIIENSRAKIYVVGTGGAGNNTVTR
FTSZ1_METJA           EEGS----KLEE---FNELE------LSPEDKELLEYLQQTKAKITVVGCGGAGNNTITR
B1L6L0_KORCO          DEGV------REIPQKVSP----------EDSSLKEFLEKVKARIVIMGVGGGGSNTITR
Q74ML8_NANEQ          EEFI------RAAQERAKMD---------EKQQIDEYLNRIKKKIKVIGVGGAGCNTINR
Q9HKT7_THEAC          RIIY-----TRDYSSHMVDQNESAEDIWTKDEDLTRIIEDRNFRIKVFGFGGSGSNTINR
FTSZ_THEAC            SKVS-----IDDVYDEWEDQ---ASGSLPEDAEIENVYKTLNVKIKVIGCGGGGSNTVNR
Q8TJB2_METAC          VQEA-----MKFSEKEKEYR--------KNSSSEEDIEEFGQPRIMIVGCGGAGNNTVNR
FTSZ2_HALSA           VQDA-----LDNAEAEQ-----------REMDGDGDGDEFGDPRIVIVGCGGAGNNTVNR
FTSZ2_METJA           RMII-----MKLVKDALS----------RSDTTRYLKDEFGEARIVVVGCGGAGNNTINR
FTSZ2_PYRFU           EQAG-----IKLDFDGEEE----------KKSEIVDEFSGYKINIAVVGVGGSGNNTISR
FTSZ2_THEKO           EQAG-----IKIDLDDEPKK--------VQTAPQFDDDDENEIRIVIVGVGGSGNNTITR
Q74M90_NANEQ          LKEA-----LET-------------------MKDINLSKARAANIKVVGVGGAGCNIIEW
B1L6V7_KORCO          SNRI-----ISSDEFLKSAR--------SVEIDDPDDEDSVTGNLVIVGVGGCGSNTIDN
Q819Q7_BACCR          T-------------------------------------QDQLANIKVIGVGGGGNNAVNR
A0A0F7RD19_BACAN      T-------------------------------------QDQLANIKVIGVGGGGNNAVNR
FTSZ_BACSU            N-------------------------------------IDGLASIKVIGVGGGGNNAVNR
FTSZ_STAAM            G-------------------------------------FNHLATLKVIGVGGGGNNAVNR
Q2RK72_MOOTA          GD------------------------------------LNQFAAIKVVGVGGGGSNAVNR
A5I4W6_CLOBH          D-------------------------------------VQQFAQIKVIGCGGGGNNAVNR
FTSZ_SYNY3            IV------------------------------------PSNIAKIKVIGVGGGGCNAVNR
Q7NNW0_GLOVI          IV------------------------------------PSSVALIKVVGVGGGGGNAVNR
FTSZ_ENTFA            N-------------------------------------INNGAVIKVIGVGGGGGNAVNR
Q8DNV9_STRR6          A-------------------------------------AAQGAVIKVIGVGGGGGNAINR
FTSZ_STRCO            AP------------------------------------QNYLAVIKVIGVGGGGVNAINR
FTSZ_MYCTU            PP------------------------------------HNYLAVIKVVGIGGGGVNAVNR
Q8G7W7_BIFLO          NE------------------------------------FNDKTNIKVVGVGGAGGNAVNR
Q5SJC5_THET8          ---------------------------------------MEGAVIKVIGLGGAGNNAVNR
Q9RWN5_DEIRA          ---------------------------------------MQAARIRVIGLGGAGNNAVNR
D1BA07_THEAS          LQID--------------------RSG-----------RSYREIIKVVGVGGGGNNALNH
D1B7F4_THEAS          FGIVPSE----------------GRSGGNPDGADPGHVRAPKEVIKVVGVGGGGGNALAH
Q89FV3_BRADU          NVPD---------------------------------IHELKPRITVFGVGGAGGNAVNN
Q89XY9_BRADU          SNTD---------------------------------IHEMKARIVVFGVGGAGGNAVNN
A9CIB1_AGRFC          QKPD---------------------------------ITELKPRITVFGVGGGGGNAVNN
A9CGZ3_AGRFC          PRAT---------------------------------IARNTPNIAVVGVGGGGGNAINN
FTSZ_CAUVC            SAPR---------------------------------TTELKPRIVVFGVGGAGGNAVNN
Q3J4L5_RHOS4          MNNA---------------------------------REELKPRITVFGVGGAGGNAVNN
FTSZ_RICPR            KAPE---------------------------------NIVLKPTITVFGVGGAGSNAVNN
Q748E1_GEOSL          -MFE------------------------------FDESIDQCAKIKVVGVGGSGGNAVNT
Q8KGD8_CHLTE          MAFEL-------------------------DPGLFDSDQDSGVNIKIVGVGGCGGNAVNN
FTSZ_ECOLI            -MFE------------------------------PME-LTNDAVIKVIGVGGGGGNAVEH
A0A384LQ43_YERPE      -MFE------------------------------PME-LTNDAVIKVIGVGGGGGNAVEH
FTSZ_BUCAI            -MFE------------------------------PSE-LSNNAIIKVIGVGGGGSNAVEH
Q8E9Q1_SHEON          -MFE------------------------------IMDTHSDDAVIKVIGVGGGGGNAVEH
FTSZ_COXBU            -MFE------------------------------LGETSPQNAQIKVIGIGGGGGNAIEH
FTSZ_PSEAE            -MFE------------------------------LVDNIAQTAVIKVIGVGGGGGNAVNH
FTSZ_HAEIN            EYPE------------------------------YDNFNESGALIKVVGVGGGGGNAVNH
Q5NI93_FRATT          -MFD------------------------------FNDSMVSNAIIKVVGVGGGGGNAVQH
Q63QK2_BURPS          MEFE------------------------------MLETETNGTIIKVIGVGGAGGNAVQH
Q7VUQ8_BORPE          MNFE------------------------------MLENNAKGTVIKVVGVGGAGGNAVAH
FTSZ_NEIMB            FVYD------------------------------VAESAVSPAVIKVIGLGGGGCNAINN
Q2S524_SALRD          SKFS------------------------------FDDAANEEAKICVVGVGGGGGNAINN
B5YFS8_THEYD          EEVE-----------------------------------RPVAKIKVIGVGGAGTNAVNT
Q8F8E5_LEPIN          EETK-----------------------------------TSPAVIKVFGVGGGGMNAVTR
FTSZ_THEMA            KENR-------------------------------NIPQANNLKIKVIGVGGAGNNAINR
Q6MT25_MYCMS          NEFK-------------------------------QIAR-----IKVLGVGGAGNNAIRR
FTSZ_AQUAE            V---------------------------------------NPCKIKVIGVGGGGSNAVNR
Q8A262_BACTN          VQFDF--------------------------------PTDSPKIIKVIGVGGGGGNAVNH
Q0PAI3_CAMJE          EEMQH----------------------------------NKGAKIKVIGCGGGGGNMINH
FTSZ_HELPY            EEVSDP--------------------------------AYKGAKIVVIGVGGGGSNMIKH
A9WH25_CHLAA          SSFH----------------------------------ARAPINIKLIGLGGCGGNLVST
FTSZ_MYCPN            AGTQLP---------------------------------ENNIKIAVFGIGGAGNNIIDD
FTSZ_MYCGE            NKLNQV---------------------------------KNKLKIGVFGIGGAGNNIVDA
                                                                  : :.* ** * * :  

FTSZ1_ARCFU           MYEEGIE-------------------GAELIALNTDVQHLYYTKAN----RRILIGKRRT
Q8TI85_METAC          MMGEGIQ-------------------GADLVALNTDAQHLLHIRSG----KKILIGKKKT
FTSZ1_HALVD           MHEEGIK-------------------GAKLVAANTDVQHLVEIGAD----TKILMGEQKT
FTSZ1_HALSA           MATEGIH-------------------GADLVAANTDVQHLVDIEAD----TKILMGQQKT
FTSZ1_PYRFU           MMEVGVT-------------------GAKIIAVNTDAQDLLKVKAH----QKILIGKELT
FTSZ_METTH            LSEIGVE-------------------GAETIAVNTDAQDLFYSVAN----RKLLIGKNVC
FTSZ1_METJA           LKMEGIE-------------------GAKTVAINTDAQQLIRTKAD----KKILIGKKLT
B1L6L0_KORCO          LNAIGID-------------------SVETVAVNTDAQHLLITTAD----RKLLIGKELC
Q74ML8_NANEQ          LYELGLQ-------------------DVELIAVNADVKDLAKIKAH----KKVLIGEEVT
Q9HKT7_THEAC          LMRENLV-------------------GVKLIACNTDAAHLLRIRAH----AKILLGKNLT
FTSZ_THEAC            LYDDALK-------------------NADLIAINTDASHLRSIKVK----HKLLIGQKTT
Q8TJB2_METAC          LYNIGIE-------------------GAETVCINTDKQHLDNVRAD----KKILVGKTLT
FTSZ2_HALSA           LYNIGVE-------------------GADTVAINTDKQHLKMIKAD----TKILVGKSLT
FTSZ2_METJA           LMEIGIQ-------------------GAETIAINTDKQHLEVIQAD----KKILIGATLT
FTSZ2_PYRFU           LYDLGVQ-------------------GADLIAMNTDAQHLAITKAH----KKVLLGKHIT
FTSZ2_THEKO           LYDLGVQ-------------------GAELIAMNTDAQALKHAKAH----KKLLLGKDLT
Q74M90_NANEQ          LYKKKIE-------------------NVDLIAMNTDAVHLKSMKVDPERVKRILLGPDIT
B1L6V7_KORCO          ISKLGIR-------------------GIKLVAINTDKVHLDGINAP----YKVLIGDSIT
Q819Q7_BACCR          MIEHGVQ-------------------GVDFIAVNTDAQALNLSKAE----TKMQIGGKLT
A0A0F7RD19_BACAN      MIEHGVQ-------------------GVDFIAVNTDAQALNLSKAE----TKMQIGGKLT
FTSZ_BACSU            MIENEVQ-------------------GVEYIAVNTDAQALNLSKAE----VKMQIGAKLT
FTSZ_STAAM            MIDHGMN-------------------NVEFIAINTDGQALNLSKAE----SKIQIGEKLT
Q2RK72_MOOTA          MIAAGLR-------------------GVEFISVNTDAQALRLCQAE----QKIQIGAKLT
A5I4W6_CLOBH          MIIDGLK-------------------NVEFIAINTDKQALMLSQAS----QKIQIGDKLT
FTSZ_SYNY3            MIASGVT-------------------GIDFWAINTDSQALTNTNAP----DCIQIGQKLT
Q7NNW0_GLOVI          MIASNVV-------------------GVEFWAINTDAQSLTQSSAP----QRLQIGQKLT
FTSZ_ENTFA            MIEENVK-------------------GVEFITANTDVQALKHSKAE----TVIQLGPKYT
Q8DNV9_STRR6          MVDEGVT-------------------GVEFIAANTDVQALSSTKAE----TVIQLGPKLT
FTSZ_STRCO            MIEVGLK-------------------GVEFIAINTDAQALLMSDAD----VKLDVGRELT
FTSZ_MYCTU            MIEQGLK-------------------GVEFIAINTDAQALLMSDAD----VKLDVGRDST
Q8G7W7_BIFLO          MIAEGLQ-------------------NVEFVAVNTDAKDLLRSDAD----VKISLSDKSS
Q5SJC5_THET8          MIEAGLS-------------------GVEFIAANTDAQVLAKSLAD----HRIQLGEKLT
Q9RWN5_DEIRA          MIESGLE-------------------GVEFIAGNTDAQVLAKSHAE----VRIQLGDRLT
D1BA07_THEAS          IIRSGIK-------------------GVEFISANTDVAHMELSDAD----IKIILGKELT
D1B7F4_THEAS          MIGLGLS-------------------GVTTVVANTDVRAMEMVDAQ----VKIVLGRELT
Q89FV3_BRADU          MITAGLQ-------------------GVDFVVANTDAQALTMSKAQ----RIVQMGTAVT
Q89XY9_BRADU          MITAGLQ-------------------GVEFVVANTDAQALAMSKAT----RLIQLGTTVT
A9CIB1_AGRFC          MITAGLQ-------------------GVDFVVANTDAQALTMTKAD----RVIQLGVNVT
A9CGZ3_AGRFC          MIAEGIS-------------------GVDFIAANTDAQALKKTNAP----RLVQLSSELT
FTSZ_CAUVC            MIEAGLE-------------------GVEFVVANTDAQQLQFAKTD----RRIQLGVQIT
Q3J4L5_RHOS4          MIEQQLE-------------------GVEFVVANTDAQALQQSRAT----SKIQMGVKVT
FTSZ_RICPR            MIHANLQ-------------------GANFVVANTDAQSLEHSLCI----NKIQLGVSTT
Q748E1_GEOSL          MIDSQVG-------------------GVDFLVANTDVQALRISKAP----TKIQIGRQLT
Q8KGD8_CHLTE          MMDRKIS-------------------GAEFVVFNTDRQALLNSKAP----IRVQIGKKAT
FTSZ_ECOLI            MVRERIE-------------------GVEFFAVNTDAQALRKTAVG----QTIQIGSGIT
A0A384LQ43_YERPE      MVRERIE-------------------GVEFFAVNTDAQALRKTAVG----QTIQIGSGIT
FTSZ_BUCAI            MVRERIE-------------------GVEFFAINTDAQALRKIEVG----QTIQIGNNIT
Q8E9Q1_SHEON          MVKHNIE-------------------GVEFVVTNTDAQALRKSGAG----STIQLGRDVT
FTSZ_COXBU            MIAENID-------------------GVEFVCANTDSQALGRSNAR----VVLQLGDEIT
FTSZ_PSEAE            MAKNNVE-------------------GVEFICANTDAQALKNIAAR----TVLQLGPGVT
FTSZ_HAEIN            MVMNMVKQEMGGTFVGESSLTSEEHGRIVFYAVNTDAQALRKSQVQ----QTVQIGGETT
Q5NI93_FRATT          MCEEVSD--------------------VEFFALNTDGQALSKSKVQ----NILQIGTNLT
Q63QK2_BURPS          MINKGVQ-------------------GVDFVVMNTDAQALSRSRAP----SVIQLGN---
Q7VUQ8_BORPE          MIRSGVS-------------------GVDFICANTDAQALAATNAP----VQIRLGR---
FTSZ_NEIMB            MVANNVR-------------------GVEFISANTDAQSLAKNHAA----KRIQLGTNLT
Q2S524_SALRD          MVQKGIH------------------GSVEFIAVNTDSQALSENRAP----QKIQAGQDLT
B5YFS8_THEYD          MISSGIY-------------------GVEFIAVNTDIQHLEISLAP----VKVQIGKELT
Q8F8E5_LEPIN          MSNSSLK-------------------GVEFAILNTDEQVLLRSPVE----NKIILGTKVT
FTSZ_THEMA            MIEIGIH-------------------GVEFVAVNTDLQVLEASNAD----VKIQIGENIT
Q6MT25_MYCMS          MFEENVQ-------------------GVEFYIINTDAQILESSPVP----NKIILGEKTT
FTSZ_AQUAE            MYEDGIE-------------------GVELYAINTDVQHLSTLKVP----NKIQIGEKVT
Q8A262_BACTN          MYREGIH-------------------DVTFVLCNTDNQALAESPVP----VKLQLGRSIT
Q0PAI3_CAMJE          MVKMGLN-------------------DLDLIAANTDAQAISISLAK----TKIQLGEKKT
FTSZ_HELPY            LVEYGVHQ------------------DVTPIATNTDGQHLKNNPAP----VKILLGKEST
A9WH25_CHLAA          LKLQNDQ--------------------VDLVVANTDLQDLAGRTTI---PTRILLGPQQT
FTSZ_MYCPN            MLRMHPELQTA---------------NVQFFALNTDLQHLKTKRYV---QNKAVIQFEES
FTSZ_MYCGE            SLYHYPNLASE---------------NIHFYAINSDLQHLAFKTNV---KNKLLIQDHTN
                                                       *:*   :                    

FTSZ1_ARCFU           RGLGAGSLPQVGEEAARESEDEIKKLVEG-SDMVFVTCGLGGGTGTGAAPVVAEAAQEAG
Q8TI85_METAC          RGLGAGSLPQIGEDAAIESIDEINKIVQG-SDMVFITAGLGGGTGTGSAPIVAEAARDAG
FTSZ1_HALVD           QGRGAGSLPQVGEEAALESQEEIYDAIEG-SDMVFVTAGLGGGTGTGSAPVVAKAARESG
FTSZ1_HALSA           KGRGAGSLPQVGEEAAIESQGEIRDSIAG-SDMVFVTAGLGGGTGTGSAPVVAKAAREQG
FTSZ1_PYRFU           RGLGAGNDPKIGEEAAKESERELRDALEG-ADMVFITCGLGGGTGTGAAPVIAEIARKMG
FTSZ_METTH            GGLGAGGVPEVGEECAEESEDDIRRELEG-ADMVFVTCGLGGGTGTGSAPVISKLAKKAG
FTSZ1_METJA           RGLGAGGNPKIGEEAAKESAEEIKAAIQD-SDMVFITCGLGGGTGTGSAPVVAEISKKIG
B1L6L0_KORCO          GGNGSGGDPHIGEEAARESADEIEEFLSG-SDLLFIMAGLGGGTGTGASPVIAEIGKRVG
Q74ML8_NANEQ          RGLGTGRDPELGEQAARESEKVIKELLQG-TDMVFITFGLGGGTGTGAGPVIADIAKQMG
Q9HKT7_THEAC          RGLGAGADPTVGEMAAKESESEILRHIDE-TSIVFITAGFGGGTGTGAAPYVAKLAKDRG
FTSZ_THEAC            KGLGTGADPKVGEEAAIEEIVAIKKIVQN-TDITFVTAGLGGGTGTGCAPVIARAAKEAG
Q8TJB2_METAC          RGLGAGGYPETGKKAAELARGTLEEVLKN-VDLVFITAGLGGGTGTGVAPVVAEVAKEQG
FTSZ2_HALSA           NGLGAGGDPSMGERATEMAQGTIKEVLGD-ADLVFVTAGMGGGTGTGAAPVVSKIAKEQG
FTSZ2_METJA           RGLGAGGYPEIGRKAAEMAKNILEEQLKG-ADLVFVTAGMGGGTGTGSAPVVAEVAKENG
FTSZ2_PYRFU           QGKGSGGDPKVGYLAAEASAQEIAAAVDG-YDLVFITAGMGNGTGTGAAPVVARIVKETA
FTSZ2_THEKO           QGKGSGGDPEVGYRAAEASAHEIAETIGD-ADLVFITAGMGNGTGTGAAPVVARVIKERA
Q74M90_NANEQ          KGHGAGGKPEVAEQAARESAKEIKQLLEG-ADLVWVVAGMGGGTGTGAAPVVAEIAQNVG
B1L6V7_KORCO          HGLGAGGRPEVARACAEQDAHKISDALGNRPDLVFIAAGMGGGTGTGAAPVVAKIAKDKG
Q819Q7_BACCR          RGLGAGANPEVGKKAAEESKEQIQEALRG-ADMVFVTAGMGGGTGTGAAPVVAQVAKELG
A0A0F7RD19_BACAN      RGLGAGANPEVGKKAAEESKEQIQEALRG-ADMVFVTAGMGGGTGTGAAPVVAQVAKELG
FTSZ_BACSU            RGLGAGANPEVGKKAAEESKEQIEEALKG-ADMVFVTAGMGGGTGTGAAPVIAQIAKDLG
FTSZ_STAAM            RGLGAGANPEIGKKAAEESREQIEDAIQG-ADMVFVTSGMGGGTGTGAAPVVAKIAKEMG
Q2RK72_MOOTA          KGLGAGANPEIGKKAAEESREELAQRLQG-ADMVFVTAGMGGGTGTGAAPVVAQIAKEAG
A5I4W6_CLOBH          KGLGAGANPEIGKKAAEESKEEISQAIKG-ADMVFITAGMGGGTGTGAAPVIAEIAKSMG
FTSZ_SYNY3            RGLGAGGNPAIGQKAAEESRDEIARSLEG-TDLVFITAGMGGGTGTGAAPIVAEVAKEMG
Q7NNW0_GLOVI          RGLGAGGNPSIGQKAAEESREEIMTALEG-ADLVFITAGMGGGTGTGAAAIVAEAAKEVG
FTSZ_ENTFA            RGLGAGSQPEVGQKAAEESEQVISESLQG-ADMIFITAGMGGGTGTGAAPVVAKIAKELG
Q8DNV9_STRR6          RGLGAGGQPEVGRKAAEESEETLTEAISG-ADMVFITAGMGGGSGTGAAPVIARIAKDLG
FTSZ_STRCO            RGLGAGANPAVGRKAAEDHREEIEEVLKG-ADMVFVTAGEGGGTGTGGAPVVANIARSLG
FTSZ_MYCTU            RGLGAGADPEVGRKAAEDAKDEIEELLRG-ADMVFVTAGEGGGTGTGGAPVVASIARKLG
Q8G7W7_BIFLO          RGLGAGADPERGAKAAQDHQSDIEEALRG-ADMVFVTCGEGGGTGTGASPIVARAAHQQG
Q5SJC5_THET8          RGLGAGANPEIGEKAALEAEDLIAEALEG-ADLVFITAGMGGGTGTGSAPVVADIAKRLG
Q9RWN5_DEIRA          RGLGAGADPKVGEEAAVEDRDRIKEYLDD-TDMLFITAGMGGGTGTGSAPVVAEIAREMG
D1BA07_THEAS          RGLGAGANPEVGQKAALESREEIRSAIEG-ADMVFITAGMGGGTGTGASPVIANIAREAG
D1B7F4_THEAS          KGLGAGANPEVGHKAAVESREEIRRVLEG-SDMVYFAAGMGGGTGTGALPVMAAMAREMG
Q89FV3_BRADU          QGLGAGSQPNVGAAAAEEVIDELRDHLSG-ANMVFVTAGMGGGTGTGAAPVIAKTARDMG
Q89XY9_BRADU          AGLGAGSQPELGRAAAEEVIDTIREHLTG-AHMVFVTAGMGGGTGTGAAPIIARTARELG
A9CIB1_AGRFC          EGLGAGSQPEVGRAAAEECIDEIIDHLNG-THMCFVTAGMGGGTGTGAAPVVAQAARNKG
A9CGZ3_AGRFC          GGLGAGADPEVGRQAAIDSLDEIMDHLSG-YDMCFITAGMGGGTGTGAAPVIAEACRAKN
FTSZ_CAUVC            QGLGAGAHPEVGMSAAEESFPEIGEHLDG-AHMVFITAGMGGGTGTGAAPIIAKCARERG
Q3J4L5_RHOS4          EGLGAGARPSVGAAAAEETIEEIVDHLAG-AHMCFITAGMGGGTGTGAAPIIAQAARELG
FTSZ_RICPR            RGLGAGASPEVGALAAQESENEIRSSLEN-SNMVFITAGMGGGTGTGSAPIIARIAKELG
Q748E1_GEOSL          KGLGAGADPSKGREAALEDREQVAELLKG-ADMIFVAAGMGGGTGTGAAPVIAEVAKEVG
Q8KGD8_CHLTE          NGLGAGADPAKGRLAAEDDRELIAMQLRG-ADLVFIAAGMGKGTGTGAAPVVASIARNMG
FTSZ_ECOLI            KGLGAGANPEVGRNAADEDRDALRAALEG-ADMVFIAAGMGGGTGTGAAPVVAEVAKDLG
A0A384LQ43_YERPE      KGLGAGANPEVGRNSAEEDREALRAALDG-ADMVFIAAGMGGGTGTGAAPVVAEVAKELG
FTSZ_BUCAI            KGLGAGANPEIGRTSAEEDKELLKSALDG-SDMVFIAAGMGGGTGTGAAPVVAEIAKELG
Q8E9Q1_SHEON          KGLGAGANPEVGRAAAEEDRENIRAAIKG-SDMIFIAAGMGGGTGTGAAPVVAQIAREEG
FTSZ_COXBU            KGLGAGADPSVGRQAAEEARDRIREILEG-TDMVFLTAGMGGGTGTGAAPIFAEVAKELG
FTSZ_PSEAE            KGLGAGANPEVGRQAALEDRERISEVLEG-ADMVFITTGMGGGTGTGAAPIIAEVAKEMG
FTSZ_HAEIN            KGLGAGANPNIGRKAAEDDQDEIRKMLEG-ADMVFIAAGMGGGTGTGAAPVVAKIAKELG
Q5NI93_FRATT          KGLGAGANPEIGKRAATEDRAKIEQLLEG-ADMVFITAGMGGGTGTGGAPVVAEVAKEMG
Q63QK2_BURPS          TGLGAGAKPEMGRAAAEEARERIADALRG-AHMVFITAGMGGGTGTGAAPVVAQIAKEMG
Q7VUQ8_BORPE          TGLGAGAKPEQGRASAETAREEIRAALNG-AHMVFITAGMGGGTGTGAGPVVAEVAKELG
FTSZ_NEIMB            RGLGAGANPDIGRAAAQEDREAIEEAIRG-ANMLFITTGMGGGTGTGSAPVVAEIAKSLG
Q2S524_SALRD          SGLGAGARPSVGAEAIEESSEEIRQALDG-YDMAFITAGMGGGTGTGGAPVVAAIARSLD
B5YFS8_THEYD          KGLGAGSDPELGKKSAFEDKDTLLSCIEG-SDLIFITAGMGGGTGTGAAPVIASLAKELG
Q8F8E5_LEPIN          RGMGAGGDPELGLKAAEEDKERIQSIVRG-SDMVFITAGMGGGTGTGAAPVIAKIAKEMK
FTSZ_THEMA            RGLGAGGRPEIGEQAALESEEKIREVLQD-THMVFITAGFGGGTGTGASPVIAKIAKEMG
Q6MT25_MYCMS          KGLGAGGNPEVGKAAAIESEEELRKVVEG-ADLIFIAAGMGGGTGTGAAPVIAKIAQESG
FTSZ_AQUAE            RGLGAGAKPEVGEEAALEDIDKIKEILRD-TDMVFISAGLGGGTGTGAAPVIAKTAKEMG
Q8A262_BACTN          QGLGAGNRPERARDAAEESIDDIKEQLNDGTKMVFITAGMGGGTGTGAAPVIARIAKEMD
Q0PAI3_CAMJE          KGLGAGMLPEVGAESARESFEEIKASLSQ-SDIVFIASGFGGGTGTGATPVIAQAAKEIG
FTSZ_HELPY            GGLGAGGIPDIGRKAAEESANEIKEAIKD-AKLVIISTGLGGGTGTGATPTIVKIAKEVG
A9WH25_CHLAA          AGKGAGGRPDVGAAATVESEPMLAKALSG-ADLVVIVAGMGGGTGTGAAPVVARLARQLG
FTSZ_MYCPN            KGLGVGGDPQKGAVLAHHFLEQFHKLSDS-FDFCILVAGFGKGTGTGATPVFSKFLSNKG
FTSZ_MYCGE            KGFGAGGDPAKGASLAISFQEQFNTLTDG-YDFCILVAGFGKGTGTGATPVFSKILKTKK
                       * * *  *  .          .         :  .  * * *:***  . .        

FTSZ1_ARCFU           --------ALTIAVVTFPFSAEGAVRRANAEAGLERLREVADTVIVIPNDRLLEVV-PNY
Q8TI85_METAC          --------ALTIAVVTLPFSVEGHVRRTNAEAGLERLRDVADTVIVVPNDKLIEVV-PRL
FTSZ1_HALVD           --------ALTIAIVTTPFTAEGEVRRTNAEAGLERLRDVSDTVIVVPNDRLLDAV-GKL
FTSZ1_HALSA           --------ALTIAIVTTPFTAEGEVRRTNAEAGLERLRDVADTVIVVPNDRLLDSV-GKL
FTSZ1_PYRFU           --------ALTVSVVTLPFTMEGIRRAKNAEYGLKRLVKYSDTVIVIPNDKLLEVA-PKL
FTSZ_METTH            --------ALTIAVATMPFSAEGLKRRENAERGLEKLQSAADTVIVIPNDKLLEVA-PNL
FTSZ1_METJA           --------ALTVAVVTLPFVMEGKVRMKNAMEGLERLKQHTDTLVVIPNEKLFEIV-PNM
B1L6L0_KORCO          --------AAVVSVVTLPFTAEGAKKREIAMKGLAKLASVSDTIVVVNNDKILEIA-KEL
Q74ML8_NANEQ          --------ILTVAVVSWPFSSEGNLTLRNAQWGLARLEETTDTHIVIPNDKLLEIA-PNL
Q9HKT7_THEAC          --------ALTIAFATLPFSSEGYVRMKNAAEGIRKLVKNSDAAIVIPNDKLIEKY-NDV
FTSZ_THEAC            --------SIVISVVTLPFESEGPLRMDNAVIGLEKLAQFSDTLVAIPNQKLLSEV-PNA
Q8TJB2_METAC          --------AIVVGMVSSPFRVE-RARIFKAEEGLEDLRRAADTVIVLDNNRLLNYV-PNL
FTSZ2_HALSA           --------AIVVGMVSTPFNVE-RARTVKAEEGLEKLREKADSIIVLDNNRLLDYV-PNL
FTSZ2_METJA           --------AIVVGVVTYPFKIE-RARMKKADEGIARMSEVCDTVIIIDNNKLLDLV-PNL
FTSZ2_PYRFU           RNNGRFQEPLVVSVVTFPFKTEGTVRIEKAKWGIQRLLEYSDTVIIIQNDKLLELV-PKL
FTSZ2_THEKO           RHNGRFREPLVISVVTYPFKNEGKIREEKAKAGIKALLYYSDTVVIIENDKLLQLV-PKL
Q74M90_NANEQ          --------ALVTSFAITPFRFE-GRRLQIAWEGIRRLTEFSNTTVILDNNKLFEVA-RGL
B1L6V7_KORCO          --------AKIIAFVTLPFRTEGRHKYKLAQEGIRQLRKWADTVVLISNDKLLKLA-GDR
Q819Q7_BACCR          --------ALTVGVVTRPFTFEGRKRATQAASGIAAFKENVDTLIVIPNDRLLEIVDKNT
A0A0F7RD19_BACAN      --------ALTVGVVTRPFTFEGRKRATQAASGIAAFKENVDTLIVIPNDRLLEIVDKNT
FTSZ_BACSU            --------ALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNT
FTSZ_STAAM            --------ALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKST
Q2RK72_MOOTA          --------ALTVGVVTRPFSFEGRKRAKQAEAGVEELKTKVDTLIIIPNDRLLQVADKQT
A5I4W6_CLOBH          --------ILTVGVVTKPFPFEGRKRLLHAEMGINTLKERVDTLVTIPNERLLSIVDKKT
FTSZ_SYNY3            --------CLTVGIVTRPFTFEGRRRAKQAEEGINALQSRVDTLIVIPNNQLLSVIPAET
Q7NNW0_GLOVI          --------ALTVAVVTRPFTFEGRRRMQQADSGIEALQGRVDTLIVIPNDKLLSVISEQT
FTSZ_ENTFA            --------ALTVGVVTRPFSFEGPKRGRFAAEGIALLKENVDTLLIISNNRLLEVVDKKT
Q8DNV9_STRR6          --------ALTVGVVTRPFGFEGSKRGQFAVEGINQLREHVDTLLIISNNNLLEIVDKKT
FTSZ_STRCO            --------ALTIGVVTRPFTFEGRRRANQAEDGIAELREEVDTLIVIPNDRLLSISDRQV
FTSZ_MYCTU            --------ALTVGVVTRPFSFEGKRRSNQAENGIAALRESCDTLIVIPNDRLLQMGDAAV
Q8G7W7_BIFLO          --------ALTIAVVTRPFSFEGPQRSASAEYGIDNLRKEVDALIVIPNDRLLELSDRSI
Q5SJC5_THET8          --------ALTVAVVTRPFSFEGPKRMRAAEEGIKKLKERVDAMVVVQNDRLLSAVDKKM
Q9RWN5_DEIRA          --------ILTVAIVTRPFKFEGPKRMRVAEEGMSKLADRVDGMIVVNNEKLLTAVDKKV
D1BA07_THEAS          --------ALVVAVVTKPFMFEGKRRITQALAGIERLKEQVDALIVIPNDRLLQLADKKT
D1B7F4_THEAS          --------ILTVAVVTKPFTFEGAKRMNNALAGIRELEPAVDSLIVIPNDRLIEISDARM
Q89FV3_BRADU          --------ILTVGVVTKPFHFEGGRRMRTAEAGINELHKVVDTLLIIPNQNLFRVANEKT
Q89XY9_BRADU          --------ILTIGVVTKPFYFEGQRRMRFAEAGVEELLKTVDTLLIIPNQNLFRVASEKT
A9CIB1_AGRFC          --------ILTVGVVTKPFHFEGGRRMRLAEQGIEELQKSVDTLIVIPNQNLFRIANDKT
A9CGZ3_AGRFC          --------ILTVGVVTLPFSFEGARRMRAAEYGFANLLNTADTVIVIPNQNLLRIADAGT
FTSZ_CAUVC            --------ILTVGVVTKPFHFEGRHRMRLADSGIQELQRYVDTLIVIPNQNLFRVANERT
Q3J4L5_RHOS4          --------VLTVGVVTKPFQFEGAKRMRQAEDGIDALQKVVDTLIIIPNQNLFRLANERT
FTSZ_RICPR            --------ILTVGVVTKPFHFEGGHRMKTADKGLIELQQFVDTLIVIPNQNLFRIANEQT
Q748E1_GEOSL          --------ALTVGVVTKPFSREGKQRLSKADEGIRELKKHVDSLIVIPNDRLIGLAGKSM
Q8KGD8_CHLTE          --------ILTIGVVTRPFSFEGQIKARIADSGITELRKYIDTLIIVENEKILSIADEGV
FTSZ_ECOLI            --------ILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDKLLKVLGRGI
A0A384LQ43_YERPE      --------ILTVAVVTKPFNFEGKKRMAFAEQGIAELSKHVDSLITIPNDKLLKVLGRGI
FTSZ_BUCAI            --------ILTVAVVTKPFNFEGKKRMIVAEQGIIELSKYVDSLIIIPNDKLLKVLSRGI
Q8E9Q1_SHEON          --------ILTVAVVTKPFPFEGKKRMAYAEQGIAELAKHVDSLITIPNEKLLKVLGRGT
FTSZ_COXBU            --------ILTVAVVTKPFVFEGKKRMDVAEEGIKALGNYVDSLITIPNNKLLNVLGKNI
FTSZ_PSEAE            --------ILTVAVVTRPFPFEGRKRMQIADEGIRALAESVDSLITIPNEKLLTILGKDA
FTSZ_HAEIN            --------ILTVAVVTKPFTFEGKKRMQFAELGIKDLSQYVDSMIIIPNQQIQKVLPKNA
Q5NI93_FRATT          --------ILTVAVVTKPFPFEGPRRMKAAEQGIDELTKHVDSIITVPNEKLLSVLGKGA
Q63QK2_BURPS          --------ILTVGVVSKPFEFEGGKRMRVAEAGSQQLEDHVDSLIVVLNDKLFEVMGDDA
Q7VUQ8_BORPE          --------ILTVGVVTKPFTFEGNKRLRMAEDGIGELGKHVHSLIVVLNENLYELMDDDA
FTSZ_NEIMB            --------ILTVAVVTRPFAYEG-KRVHVAQAGLEQLKEHVDSLIIIPNDKLMTALGEDV
Q2S524_SALRD          --------ILTVAIVTKPFDCEGSRRMNTAQEGIELLRENVDTLIVIPNERLLDIADPDT
B5YFS8_THEYD          --------ILTVAVVTKPFYFEGKKRLHNAVVGIKELKKYVDTIIVIPNDRIYMVVEKGT
Q8F8E5_LEPIN          --------CLVVGVVTLPFSFEGRRRMEFARKGIEQLRSHVDTLILINNDSIFRVVDKNT
FTSZ_THEMA            --------ILTVAIVTTPFYFEGPERLKKAIEGLKKLRKHVDTLIKISNNKLMEELPRDV
Q6MT25_MYCMS          --------ALVIGIVTKPFIFEGRHRNVNAKEGLEELRKYVDSVIVVSNDKLLEYI-GSI
FTSZ_AQUAE            --------ILTVAVATLPFRFEGPRKMEKALKGLEKLKESSDAYIVIHNDKIKELSNRTL
Q8A262_BACTN          --------ILTVGIVTIPFIFEGEKKIIQALDGVERIAQHVDALLVINNERLREI-YADL
Q0PAI3_CAMJE          --------ALTVSVVTMPFAFEGKQRKKLAESGLLELKKESDSILVIQNEKLLSIIDKKA
FTSZ_HELPY            --------ALTIAIVTKPFKYEGNQKRKRAEEGLKELEQSSDSILVIPNDKILLTMKKNA
A9WH25_CHLAA          --------ALTLAFVTMPFQVEKGQRSRIAEQGLASVSKEADAVVVVSNQKILNFVDPRT
FTSZ_MYCPN            --------VLNLSIVSYPAMCEGLKAREKAAKGLERLNQATDSFMLFRND---------R
FTSZ_MYCGE            --------ILNVAIVTYPSLNEGLTVRNKATKGLEILNKATDSYMLFCNE---------K
                                  ...  *   *       *  *   .    .  : . *:          

FTSZ1_ARCFU           PMQLAFKVADEILMRAVKGITELITKPA-LINLDFADVRTVME------KGGVAMIGLGE
Q8TI85_METAC          PLQAAFKVSDEVLMRAVKGITELITKPG-LVNLDFADIRTVMQ------NGGVAMIGLGE
FTSZ1_HALVD           PVRQAFKVSDEVLMRSVKGITELITKPG-LVNLDFADVKTVME------RGGVAMIGLGE
FTSZ1_HALSA           PVREAFKVSDEVLMRSVKGITELITKPG-LVNLDFADVRTVME------KGGVAMIGLGE
FTSZ1_PYRFU           PIQMAFKVADEILVQAVKGITELITKPG-LVNLDFNDVRAVMK------DGGVAMIGIGE
FTSZ_METTH            PLNKAFMVADEILGRAVKGITELITKPG-LVSLDFADVRSIMK------GSGMAMIGMGE
FTSZ1_METJA           PLKLAFKVADEVLINAVKGLVELITKDG-LINVDFADVKAVMN------NGGLAMIGIGE
B1L6L0_KORCO          PLYQAFFISDEIVARAVKGVVELVVKPG-LVNVDLADLRNVIE------SGGPAVLTFGE
Q74ML8_NANEQ          PIAVAFKLSDEVLANTIKKTTELILKPG-QVTRDFADLKVILE------NGGLGMVGFGE
Q9HKT7_THEAC          PVYKAFKFEDEVISTGIKGITDLIMNTG-TINLDFNDLRKVMK------DAGYAAIGMGS
FTSZ_THEAC            EMKVAFAYADKVLADTIRSIVEIITKTG-IINIDYSDIKTVMQ------SGGVALIGMGQ
Q8TJB2_METAC          PIDQAFSVMDQLIAETVKGITETITVPS-LINLDYADIRTIMS------CGGVAVMLVGE
FTSZ2_HALSA           PIGKAFSVMDQIIAETVKGISETITQPS-LINLDYADMTAIMN------QGGVAVMLVGE
FTSZ2_METJA           PINDAFKVADEIIAQAVKGITETIAVPS-LINIDFADVKAVMS------GGGVAMIGVGE
FTSZ2_PYRFU           PLQSAFRFADELIARMVKGIVETIKLNS-IVNIDFADVYSIMK------GGGPALIGIGE
FTSZ2_THEKO           PINAAFRFADEIIARMVKGITETIKLPS-MVNIDFADVYSIMH------NGGAALIGIGE
Q74M90_NANEQ          NVQQAFALSNELVAQTVSGVVEIVTGAA-DINRDLADIKAIME------EGHVAAIGIGE
B1L6V7_KORCO          PLDEAFMIADMTLAVMVKGIAEIIRKRT-MVNVDLNDIRTLMS------VGGVAAVGIGE
Q819Q7_BACCR          PMLEAFREADNVLRQGVQGISDLIATPG-LINLDFADVKTIMS------NRGSALMGIGS
A0A0F7RD19_BACAN      PMLEAFREADNVLRQGVQGISDLIATPG-LINLDFADVKTIMS------NRGSALMGIGS
FTSZ_BACSU            PMLEAFREADNVLRQGVQGISDLIATPG-LINLDFADVKTIMS------NKGSALMGIGI
FTSZ_STAAM            PMMEAFKEADNVLRQGVQGISDLIAVSG-EVNLDFADVKTIMS------NQGSALMGIGV
Q2RK72_MOOTA          SILEAFRIADDVLRQGVQGISDLIAVPG-LINLDFADVKTIMT------DTGSALMGIGR
A5I4W6_CLOBH          SLMDSFKLADDVLRQGVQGISDLITIPG-LVNLDFADVRTIMV------DKGLAHMGVGK
FTSZ_SYNY3            PLQEAFRVADDILRQGVQGISDIIIIPG-LVNVDFADVRAVMA------DAGSALMGIGV
Q7NNW0_GLOVI          PVQEAFRIADDILRQGVQGISDIITIPG-LINVDFADVRAIMA------DAGSALMGIGM
FTSZ_ENTFA            PMLEAFREADNVLRQGVQGISDLITAPG-YVNLDFADVKTVME------NQGTALMGIGV
Q8DNV9_STRR6          PLLEALSEADNVLRQGVQGITDLITNPG-LINLDFADVKTVMA------NKGNALMGIGI
FTSZ_STRCO            SVLDAFKSADQVLLSGVQGITDLITTPG-LINLDFADVKSVMS------EAGSALMGIGS
FTSZ_MYCTU            SLMDAFRSADEVLLNGVQGITDLITTPG-LINVDFADVKGIMS------GAGTALMGIGS
Q8G7W7_BIFLO          GIIEAFKTADTALLAGVQGITDLISMNS-YIHVDFNDVNSILR------GAGTALFGIGS
Q5SJC5_THET8          TLKDAFLIADRVLYHGVKGITDVINLPG-LINVDFADVKALLE------GAGQVLMGIGA
Q9RWN5_DEIRA          SFREAFLIADRVLYYGVKGISDVINVEG-MINLDFADVRNLLA------NSGTVLMGIGA
D1BA07_THEAS          SLTDAFKLADEVLRQAVDGVTSLILKPG-LVNVDFADLKTVMS------NAGSAIMGIGE
D1B7F4_THEAS          TIQESFAMANDVLRQAVQGVTDLIVRPG-LVNVDFADVRAVMR------CAGRAVMGIGS
Q89FV3_BRADU          TFADAFAMADQVLYSGVACITDLMVKEG-LINLDFADVRAVMR------EMGKAMMGTGE
Q89XY9_BRADU          TFADAFALADQVLYSGVACISDLIVKEG-LINLDFADVLSVMK------EKGKAMMGRGE
A9CIB1_AGRFC          TFADAFAMADQVLYSGVACITDLMVKEG-LINLDFADVRSVMR------EMGRAMMGTGE
A9CGZ3_AGRFC          TFENALKTADKVLSLGVRCITDLILREG-LVNLDFADVRYVMK------NGGRALMGTAQ
FTSZ_CAUVC            TFAEAFGMADQVLHSGVRSITDLMVLPG-LINLDFADVRTVMT------EMGKAMMGTGE
Q3J4L5_RHOS4          TFTEAFALADDVLYQGVKGVTDLMVRPG-LINLDFADVRAVMD------EMGKAMMGTGE
FTSZ_RICPR            TFADAFKMADDVLHAGVRGVTDLMIMPG-LINLDFADIKAVMS------EMGKAMMGTGE
Q748E1_GEOSL          SIIDAFKPADDVLRQAVQGISDLITTSG-FINVDFADVKAIMS------ERGMAMMGIGI
Q8KGD8_CHLTE          SATEAYNMANDVLFRAVKGIADIITHHG-HVNVDFADVRSIMQ------SAGDAVMGSAA
FTSZ_ECOLI            SLLDAFGAANDVLKGAVQGIAELITRPG-LMNVDFADVRTVMS------EMGYAMMGSGV
A0A384LQ43_YERPE      SLLDAFGAANDVLKGAVQGIAELITRPG-LMNVDFADVRTVMS------EMGYAMMGSGV
FTSZ_BUCAI            SLLDAFSAANNVLKGAVQGIAELITRPG-LMNVDFADVRTVML------EMGYAMMGTGI
Q8E9Q1_SHEON          SLLDAFAAANNVLLGAVQGIAELITRPG-LINVDFADVKTVMS------EMGNAMMGTGV
FTSZ_COXBU            TLLNAFKAANNVLLGAVQGIADLITRPG-LINVDFADVRTVMS------EMGMAMMGTGV
FTSZ_PSEAE            SLLAAFAKADDVLAGAVRGISDIIKRPG-MINVDFADVKTVMS------EMGMAMMGTGC
FTSZ_HAEIN            KLIDAFAAANDVLRNSVMGISDMITSPG-LINVDFADVRTVMS------VQGQAMIGFGS
Q5NI93_FRATT          SLIDAFNAANDVLGNAVKGVSELITKPG-LINVDFADVRAVMT------NMGLAMMGMGE
Q63QK2_BURPS          EMDKCFQCADDVLNNAVAGIAEIINVDG-LVNVDFEDVKTVMG------EQGKAMMGTAT
Q7VUQ8_BORPE          TQEDCFKAADDILHNACAGIAEIINVEG-NVNVDFEDVKTIMG------EQGQAMMGTAA
FTSZ_NEIMB            TMREAFRAADNVLRDAVAGISEVVTCPSEIINLDFADVKTVMS------NRGIAMMGSGY
Q2S524_SALRD          SLIEAFEKADEVLYNATRGISDLITVHG-LINLDFADVQTTMK------DGGTALMGSAT
B5YFS8_THEYD          PLVKSFAIANDILRQAVQGISDLILSPG-FINRDFADVRTIIE------NSGKAVIGLGT
Q8F8E5_LEPIN          PIDLAFQVIDDILLNAVRGISDIINNPG-LINVDFADVKTIMR------DTGDAVMGVGE
FTSZ_THEMA            KIKDAFLKADETLHQGVKGISELITKRG-YINLDFADIESVMK------DAGAAILGIGV
Q6MT25_MYCMS          PIVESFKEADTILKQGVQTITDLIAVPA-TINLDFADVKSVMS------KKGNALFGIGV
FTSZ_AQUAE            TIKDAFKEVDSVLSKAVRGITSIVVTPA-VINVDFADVRTTLE------EGGLSIIGMGE
Q8A262_BACTN          TFMNAFGKADDTLSIAAKSIAEIITMRG-TVNLDFADVKTILK------DGGVAIMSTGF
Q0PAI3_CAMJE          GIKDAFRLVDDILARAVKGMVSILLDNG-DINVDFADVRTIMS------HRGLALMGVGS
FTSZ_HELPY            STTECYREVDDVLVRAVSGISTIITKPG-NINVDFADLKSALG------FKGFALMGIGE
A9WH25_CHLAA          TLSVALTYSNTILAAAISGVIDQLSLPS-LMQLDFSHVRQTLS------QAGQTMLGIGS
FTSZ_MYCPN            CTDGIYQLANVAIVKTIKNIIELINLPL-QQNIDFEDIRSFFKKPAQRLENEANLFRVTN
FTSZ_MYCGE            CTNGIYQLANTEIVSAIKNLIELITIPL-QQNIDFEDVRAFFQ--TKKTNQDQQLFTVTH
                               :  :          :         *  .:   :             .    

FTSZ1_ARCFU           ASGE-------DKAAESVRKALKSPLL-DVDVSGAKAALVNVTGGPD--MTIEEAESVIE
Q8TI85_METAC          SDGE-------NKAVESVQKALRSPLL-DVDISGATSALVNVVGGPD--MTISEAECVVQ
FTSZ1_HALVD           SDSE-------SKAQESVKSALRSPLL-DVDISGANSALVNVTGGSD--MSIEEAEGVVE
FTSZ1_HALSA           ADSD-------AKAADSVQSALRSPLL-DVDISSANSALVNVTGGPG--MSIEEAEGVVE
FTSZ1_PYRFU           SDSE-------KRALEAAEQALNSPLL-DVDISGATGALIHISGA-D--VKLEEAQQIIE
FTSZ_METTH            AESG-------DRALESVYEALNSPLL-DLDISNARGALINISGSSD--LTLQEAERIVE
FTSZ1_METJA           SDSE-------KRAKEAVSMALNSPLL-DVDIDGATGALIHVMGPED--LTLEEAREVVA
B1L6L0_KORCO          SDGE-------NRAMEAVDDALGNPLL-DADISGGKAAIINITSGPD--FSLEEMQQIVE
Q74ML8_NANEQ          SDSE-------NKALEAIERAINNPLL-DTDVSGAKRALLHIVAGPD--FKTEELNKILE
Q9HKT7_THEAC          SNQAVN-----DRIVEALEKALDSPFM-DYDISRAKGAIVNVTGGRD--LQLQEAQQAAD
FTSZ_THEAC            SKKG-G-----DRIMTALEEALKPRLI-DVDVSTAKDCVFKIIAPPD--ITVSEVGKAMD
Q8TJB2_METAC          SKSQDK-------STEVVRTALNHPLL-DVDYKGATGSLVHVTGGPD--LSLKEAEEIAS
FTSZ2_HALSA           TQDKNK-------TNEVVKDAMNHPLL-DVDYRGASGGLVHITGGPD--LTLKEAEGIAD
FTSZ2_METJA           VDSSDRG----DRVQNVVRETLSCPLL-DVDYRGAKGALIHITGGPD--LTLKEANDIGE
FTSZ2_PYRFU           SDSNNR-------AVDAVNNALTNKML-DVEFGSGEKALVHFTIGPD--VSLEEINKAME
FTSZ2_THEKO           SDSSNR-------AVDAVKNALQNKLL-DVEYGSGEKALVHFTVGPD--VSLGEINEAMN
Q74M90_NANEQ          SSSENR-------LIEAVTRAIKHPLL-DVDVKGAKGALIYITAGPD--FKIDELKSLET
B1L6V7_KORCO          SSDPKR------RGEEAVKMALRNQLI-EISPEGARGALVVVYGGKN--MRLTEVHQITE
Q819Q7_BACCR          GNGE-------NRAAEAAKKAISSPLL-ETSIDGAQGVIMNITGGAN--LSLYEVQEAAD
A0A0F7RD19_BACAN      GNGE-------NRAAEAAKKAISSPLL-ETSIDGAQGVIMNITGGAN--LSLYEVQEAAD
FTSZ_BACSU            ATGE-------NRAAEAAKKAISSPLL-EAAIDGAQGVLMNITGGTN--LSLYEVQEAAD
FTSZ_STAAM            SSGE-------NRAVEAAKKAISSPLL-ETSIVGAQGVLMNITGGES--LSLFEAQEAAD
Q2RK72_MOOTA          ATGE-------KRAVEAARMAISSPLL-ETSIEGARGVLLNITGGSN--LGLLEVNEAAE
A5I4W6_CLOBH          GTGD-------NRSQEAAKQAISSPLL-ETSIVGATGVLLNITGGND--LGLLEINEAAE
FTSZ_SYNY3            GSGK-------SRAKEAATAAISSPLL-ESSIQGAKGVVFNVTGGTD--LTLHEVNVAAE
Q7NNW0_GLOVI          GSGK-------SRAREAAMTAISSPLL-ESSIEGANGVVLNVTGGHD--LTLHEVNEAAA
FTSZ_ENTFA            ASGE-------ERVIEATKKAISSPLL-ETSIDGAEQVLLNITGGLD--MTLFEAQDASD
Q8DNV9_STRR6          GSGE-------ERVVEAARKAIYSPLL-ETTIDGAEDVIVNVTGGLD--LTLIEAEEASQ
FTSZ_STRCO            ARGD-------DRAVAAAEMAISSPLL-EASIDGARGVLLSISGGSD--LGLFEINEAAQ
FTSZ_MYCTU            ARGE-------GRSLKAAEIAINSPLL-EASMEGAQGVLMSIAGGSD--LGLFEINEAAS
Q8G7W7_BIFLO          ARGE-------DRATQAAEIAISSPLL-EESIEGAHGALINIAGPTD--LKLQEASAATE
Q5SJC5_THET8          GRGE-------NRVEEAAKSAIHSPLL-ERSIEGAKRLLLNVVGSEE--LSLMEAAEVVE
Q9RWN5_DEIRA          GRGD-------KMAEEAAMSAIHSPLL-ERGIEGARRILVNVTGGYD--LSMTDANEIVE
D1BA07_THEAS          AQGE-------NRAAVAARNAINSPLM-EAPIKGAKGVLFNIIGGPS--VTTHEVLEVSS
D1B7F4_THEAS          ARGE-------DRAKEALRRAMESPLM-EVRLKDARGGLINVTAGPD--IGIHELNEAAE
Q89FV3_BRADU          ASGD-------KRALTAAEAAIANPLIDDSSMKGAKGLLISITGGKD--LTLFEVDEAAT
Q89XY9_BRADU          ASGE-------KRVLAAAVAAISNPLIENPSIKRASGLIISITGGRD--LMLYEVDEAAT
A9CIB1_AGRFC          ASGP-------GRAMQAAEAAIANPLLDETSMKGAQGLLISITGGRD--LTLFEVDEAAT
A9CGZ3_AGRFC          AKGP-------KRASEAAAAAIANPLLGEPSLKEARGALVAISGGND--LTLYEIDEAMT
FTSZ_CAUVC            GTGE-------DRALMAAQNAIANPLLDEVSLKGAKAVLVNVTGGMD--MTLLEVDEAAN
Q3J4L5_RHOS4          AMGE-------DRALQAAEKAIANPLLDEISLNGAKGVLINITGGYD--LTLFELDEAAN
FTSZ_RICPR            DSGE-------DRAIKAAESAISNPLLDHSSMCGARGVLINITGGPD--MTLFEVDNAAN
Q748E1_GEOSL          ASGE-------NRAVEAALRAISSPLLEEVDISGAKGVLVNIAGSSS--MTMDEFEAVNR
Q8KGD8_CHLTE          AAGE-------RRALKAASDAVTSPLMEGVKMRGAKGVLVNITG--D--VTMRDIADAMN
FTSZ_ECOLI            ASGE-------DRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFD--LRLDEFETVGN
A0A384LQ43_YERPE      ACGE-------DRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFD--LRLDEFETVGN
FTSZ_BUCAI            SSGE-------NRAEEASEIAISSPLLEDIDLSGARGVLVNITAGFD--LKLDEFETVGN
Q8E9Q1_SHEON          ARGE-------DRAEEAAEAAVASPLLEDIDLAGARGVLVNITAGMD--MSIEEFETVGN
FTSZ_COXBU            SSGE-------NRAREAAEAAIASPLLEDVDFTGARGVLVNITAGMD--LSIGEFEQVGE
FTSZ_PSEAE            ASGP-------NRAREATEAAIRNPLLEDVNLQGARGILVNITAGPD--LSLGEYSDVGN
FTSZ_HAEIN            AVGEPGA----GRAEEAARLAVRNDLLEKIDLSNAQGILVNITAGMD--LVFEEFNIIGE
Q5NI93_FRATT          ASGE-------NRAREAAEAAISSPLLEDINLDGAKGVIVNITAGMD--MSIGEFEEVGE
Q63QK2_BURPS          VAGV-------DRARLAAEQAVASPLLEGVDLSGARGVLVNITSSRS--LRLSETREVMN
Q7VUQ8_BORPE          ASGA-------DRARVAAEKAIACPLLEGVDLNGARGVLVNITASRT--LKMRETREIME
FTSZ_NEIMB            AQGI-------DRARMATDQAISSPLLDDVTLDGARGVLVNITTAPGC-LKMSELSEVMK
Q2S524_SALRD          ATGE-------NRSEKAAVQAISSPLLDGLSIAGATNVLVNITSGPS--LGIREATQATS
B5YFS8_THEYD          CTKQ-------EGATEAARRAINNPLLEETSIEGAKRILINITGGFD--LTLDEVQEIAG
Q8F8E5_LEPIN          GSGE-------GKVKEAVEYAINNSLLDSTSIAGASSLLINVSGGKD--LTISDWNEVSG
FTSZ_THEMA            GKGE-------HRAREAAKKAMESKLI-EHPVENASSIVFNITAPSN--IRMEEVHEAAM
Q6MT25_MYCMS          ASGK-------DKAVEAAKEAINSKLL-EASIEGAKDIIVNITGGRT--VSLNDAYDAVG
FTSZ_AQUAE            GRGD-------EKADIAVEKAVTSPLLEGNTIEGARRLL--VTIWTSEDIPYDIVDEVME
Q8A262_BACTN          GEGE-------NRVTKAIDDALHSPLLNNNDIFNAKKVMLNVSFCPTSELMMEEMNEIHE
Q0PAI3_CAMJE          ASGE-------NAIEEALSNAIESPLLDGMDIKGAKGVILHFKTSSN--CSLFEISAAAN
FTSZ_HELPY            ATGE-------ESAKLAVQNAIQSPLLDDASIEGAKSIIVFFEHHPD--YPMMAYSQACD
A9WH25_CHLAA          ATGS-------DAAQRAMQLALKCDLL-EGNLQKARRVFASIIGGSN--LGLIDVHQAIE
FTSZ_MYCPN            TFTFSFDAHNTIEHFSHKLKNFEYEGFFDHKVEGAQKVILKVLVNQG--LYPLDLTQIQE
FTSZ_MYCGE            PFSFSFDSKDSIEQFAKQFKNFEKVSYFDHSIVGAKKVLLKANINQK--IVKLNFKQIQD
                                           .            .   .                     

FTSZ1_ARCFU           EIYSKVDP-DARIIWGAMIDPELE--NTMRTLIIVTGVKSPQILGR--------------
Q8TI85_METAC          EVYNRIDS-NARLIWGAQVDPDLE--QTVRTMIVVTGVTSAQIYGHG-------------
FTSZ1_HALVD           EIYDRIDP-DARIIWGTSVDDELE--GMMRTMIVVTGVESPQIYGRN-------------
FTSZ1_HALSA           QLYDRIDP-DARIIWGTSIDEQIQ--EEMRTMVVVTGVDSPQIYGRNEAAEGDGPAQEST
FTSZ1_PYRFU           YVTRNVDP-KAQVIWGIQLEPELE--KTIRVMVVITGVTSRYI-----------------
FTSZ_METTH            VVAEELDP-DANIIWGAQIQDELQ--NVIRTTIVVAGVRSPYIYGAHG------------
FTSZ1_METJA           TVSSRLDP-NATIIWGATIDENLE--NTVRVLLVITGVQSRIE-----------------
B1L6L0_KORCO          TIVSSLDP-NANVIWGARIDESLK--GSVQVLLVVTGVASPTVEAALQGELREPFVERAT
Q74ML8_NANEQ          YVSNKLDP-EAKLLWGLWIEEEKK--GKVEIMILVTEL----------------------
Q9HKT7_THEAC          MLRKKIAR-DATIMWGTVIDENMR--SGVRILIIVAGIKPNFK-----------------
FTSZ_THEAC            EIKKKINP-RSRIIWGLTIDKDLD--KDVKVLIFMTGVSSAY------------------
Q8TJB2_METAC          MLTYELSS-SANVIWGARIREDYE--GRVRVMAIMTGVQSAQILGPQAGAGIFE------
FTSZ2_HALSA           NITERLDA-SANVIWGARIQESYK--GKVRVMAIMTGVQSAQVLGPSTQKQADK------
FTSZ2_METJA           GITKELDP-EANVIWGARIDPEME--GCIRVMAIITGVKSPNIVGKDTK-----------
FTSZ2_PYRFU           VVYEKLSE-KSEIKWGAMVDPEMG--KTVRAMVIMTGVRSPYILGNVNALTDS-------
FTSZ2_THEKO           IVYEKLGE-KSEIKWGARIDEDMG--KMVRAMVIMTGVKSPHILGGETALQLPV------
Q74M90_NANEQ          FVKNNLDS-NAYVSWGLKIREDFG--EKVRVIAIVTGVKSPYIIGKDFIS----------
B1L6V7_KORCO          IVASKMSS-DAIIKIGADIDESLG--DGVRVILLLTGIRSPDMLGPDVPLRTEP------
Q819Q7_BACCR          IVASAS-DPEVNMIFGSVINEGLK--DDIVVTVIATGFDDSIATQ---------------
A0A0F7RD19_BACAN      IVASAS-DPEVNMIFGSVINEGLK--DDIVVTVIATGFDDSIATQ---------------
FTSZ_BACSU            IVASAS-DQDVNMIFGSVINENLK--DEIVVTVIATGFIEQ-------------------
FTSZ_STAAM            IVQDAA-DEDVNMIFGTVINPELQ--DEIVVTVIATGFDDKPTSH---------------
Q2RK72_MOOTA          IVAAAA-DPEANIIFGAVIDESLK--DEIRVTVIATGFEGK-------------------
A5I4W6_CLOBH          IVQEAA-DPDANIIFGAVIDENLK--DELRITVIATGFESD-------------------
FTSZ_SYNY3            IIYEVV-DADANIIFGAVIDDRLQ--GEMRITVIATGFNGE-------------------
Q7NNW0_GLOVI          VIYEVV-DPNANIIFGAVIDEKLQ--GELRITVIATGFNGI-------------------
FTSZ_ENTFA            IVTNAA-SGDVNIILGTSINEDLG--DEIRVTVIATGIDESKKDR---------------
Q8DNV9_STRR6          IVNQAA-GQGVNIWLGTSIDESMR--DEIRVTVVATGVRQDRVEKV--------------
FTSZ_STRCO            LVSEAA-HPEANIIFGAVIDDALG--DEVRVTVIAAGFDGGQPPS---------------
FTSZ_MYCTU            LVQDAA-HPDANIIFGTVIDDSLG--DEVRVTVIAAGFDVSGP-----------------
Q8G7W7_BIFLO          LVRKAI-HPEAQIIWGLALDDAYG--DEVRVTVIAAGFDPVAAQD---------------
Q5SJC5_THET8          RIREATGHEDVDILYGVTYDERAQ--DELRVILIAAGFA---------------------
Q9RWN5_DEIRA          KIREATGFDDPDILFGITPDEAAG--DEVRVTVIATGFG---------------------
D1BA07_THEAS          AIGEFVDE-DAQIIWGHVLEPEMD--DKIQVIVIATGFSHSQPQHGDARM----------
D1B7F4_THEAS          AFQSYLGE-DALFFWGYGEDPDLT--GTVKVVVIAAGFDGED------------------
Q89FV3_BRADU          RIREEVDQ-DANIIVGATFDEALD--GLIRVSVVATGIEQAAIARNSQATSA--------
Q89XY9_BRADU          RIRDEADP-DANIIVGASFDESLE--GIVRVSVVATGIDN--------------------
A9CIB1_AGRFC          RIREEVDP-DANIILGATFDEALE--GLIRVSVVATGIDRVAGIGEQNIAEM--------
A9CGZ3_AGRFC          LVREAVSE-ETDVVMGASFDPTLD--GAFKISVVATGLRN--------------------
FTSZ_CAUVC            AISDQVDP-EANIIFGAAFDPSLE--GVIRVSVVATGMDGASIAQIEPKPVS--------
Q3J4L5_RHOS4          VIREKVDS-DANIIVGSTLDTSME--GMIRVSVVATGIDATKPAQDMPVP----------
FTSZ_RICPR            RIREEVDNIDANIIFGSTFNPELK--GIIRVSVVATGIDA--------------------
Q748E1_GEOSL          SIHEKVHE-DANIIIGVSIDETLG--DQLKVTAIATGFGDRF------------------
Q8KGD8_CHLTE          YIEEQVGS-DAKIINGYVDEPQVS--GEIRVTVIVTGFKRVEPGEERQPASS--------
FTSZ_ECOLI            TIRAFASD-NATVVIGTSLDPDMN--DELRVTVVATGIGMDKRPE---------------
A0A384LQ43_YERPE      TIRAFASD-NATVVIGTSLDPEMN--DELRVTVVATGIGMDKRPE---------------
FTSZ_BUCAI            TIRSFSSD-HATVVIGTSLDPDMN--DTLRVTVVATGIGMEKNLD---------------
Q8E9Q1_SHEON          HVKAYASD-NATVVVGAVIDPEMS--DELRVTVVATGIGAEKRPD---------------
FTSZ_COXBU            AVKAFASE-TATVVIGTVIDPDMS--DELRVTVVVTGLGSHAGGG---------------
FTSZ_PSEAE            IIEQFASE-HATVKVGTVIDADMR--DELHVTVVATGLGARLEKP---------------
FTSZ_HAEIN            TIGSFASE-EATVVVGTSLVPEMS--DEIRVTIVATGLGEIAGNEP--------------
Q5NI93_FRATT          VIRSFISD-EAIVIAGTVIDPDMS--DSMKVTVVVTGIEKVAMKRG--------------
Q63QK2_BURPS          TIKSYAAD-DATVIFGAVYDDAMG--DALRVTVVATGLGRAAKKQQSAPMT---------
Q7VUQ8_BORPE          TIRSYASD-DATVIFGTAYDEQMG--EELRVTVVATGLGREAVRPQLVQHTS--------
FTSZ_NEIMB            IVNQSAHP-DLECKFGAAEDETMSE-DAIRITIIATGLKEKGAVD---------------
Q2S524_SALRD          VIQKEAGE-DVEVIFGTVIEEDIE--DKLRVTVIATGFDRDEEPED--------------
B5YFS8_THEYD          TVYDIAHE-DANIIFGTVIKSEIE--NEIFVTVIATGFEDKSEEITLSSTEKWMPKSSSI
Q8F8E5_LEPIN          IITSQVDP-NANIIVGLHEDESLS--NKIRVTVIATGFHKRG------------------
FTSZ_THEMA            IIRQNSS-EDADVKFGLIFDDEVPDD-EIRVIFIATRFPD--------------------
Q6MT25_MYCMS          VISQAVNNKELNIVFGMAINDDLTDDDEIIVTVIATGFENKNLQN---------------
FTSZ_AQUAE            RIHSKVHP-EAEIIFGAVLEPQEQ--DFIRVAIVATDFPEEKFQVG--------------
Q8A262_BACTN          -FMSKFRE-GVEVIWGVAVDNSLD--TKVKITVLATGFGVEDVPGM--------------
Q0PAI3_CAMJE          SIQEIVDE-NAKIIFGSTTDDSME--DRVEVTIIATGFEDKD------------------
FTSZ_HELPY            FIQDQAHQ-DVDVKFGQHTSDNIPI-DHVRVTIIATGAERN-------------------
A9WH25_CHLAA          QIHRVVAN-EIDLVIGVATSPLASHRDRVRVTLIASEVASFRQSLS--------------
FTSZ_MYCPN            IIWAKIDNHNLEVQLGVDFTDANPSVQLFFLMEKKQAVSSDFIQKPA-------------
FTSZ_MYCGE            IIWTKIDNYQLEIRLGVDFVTTIPNIQIFILSEHKNPVSLPIDNKS--------------
                       .             *            .                               

FTSZ1_ARCFU           ----------------------------------KGYPVTRK------------------
Q8TI85_METAC          ----------------------------------SDKNITYK------------------
FTSZ1_HALVD           -------------------------------GEAQAHAEERL------------------
FTSZ1_HALSA           -----------------------------PEPEPEPQAGSEI------------------
FTSZ1_PYRFU           -------------------------------TPEEETPLETP------------------
FTSZ_METTH            -------------------------------SAEKEFLEEKQ------------------
FTSZ1_METJA           --------------------------------FTDTGLKRKK------------------
B1L6L0_KORCO          KPKV------------------------EKAAKALPRVTERKT-----------------
Q74ML8_NANEQ          -----------------------------KNVPDYLKISEKR------------------
Q9HKT7_THEAC          -------------------------------LDQDLEEVR--------------------
FTSZ_THEAC            -------------------------------LVKDVESARKAG-----------------
Q8TJB2_METAC          -------------------------------SRAEAEPIQEKRFGRLSPGRRG-------
FTSZ2_HALSA           -------------------------------SRRELQDVDSKQRAADDAGAGGF------
FTSZ2_METJA           -------------------------------PKRIIPKVSKEQ-----------------
FTSZ2_PYRFU           -------------------------------SSWVVPKDRRLIGDPRIEKMFPD------
FTSZ2_THEKO           -------------------------------KESLLPAEPKAGFNSFEDKIYKV------
Q74M90_NANEQ          ------------------------------------------------------------
B1L6V7_KORCO          -------------------------------LTVSIDGKYDPV-----------------
Q819Q7_BACCR          ----------PPKPIIRPNANHTQQQQQPVAQPSKQREVKREM-----------------
A0A0F7RD19_BACAN      ----------PPKPIIRPNVNHTQQQQQPVAQPPKQREVKREM-----------------
FTSZ_BACSU            -----------EKDVTKPQRPSLNQSIKTHNQSVPKREPKREE-----------------
FTSZ_STAAM            ----------GRKSGSTGFGTSVNTSSNATSKDESFTSNSSNA-----------------
Q2RK72_MOOTA          ------------------------TAEPAADQAAATREAELDV-----------------
A5I4W6_CLOBH          --------------------RLEKDNIEKEENNIPKEASKSED-----------------
FTSZ_SYNY3            ------------------KEKPQAKTSSKPVLSGPP-AGVETV-----------------
Q7NNW0_GLOVI          ------------------APAVKAGKARLSESSAEGLTGKAPS-----------------
FTSZ_ENTFA            --------------KPHRQTRQAVQPMQQTTQSVEMDQPKSQE------------EASAF
Q8DNV9_STRR6          ---------VAPQARSATNYRETVKPAHSHGFDRHFDMAETVELPKQNPRRLEPTQASAF
FTSZ_STRCO            ---------KRDNVLGSSSAKREEPTPARPSESRPSFGSLGSVK----------------
FTSZ_MYCTU            ---------GRKPVMGETGGAHRIESAKAGKLTSTLFEPVDAV-----------------
Q8G7W7_BIFLO          ---------DDTQSTVTPVVPTAADPATPVAQPAPAPAPAAQPA----------------
Q5SJC5_THET8          -----------ESTVVPRPARPVDFPTGHVDLTNYD------------------------
Q9RWN5_DEIRA          -----------DNTYAAPLGGVVSSGRGGYDQGGYGSG----------------------
D1BA07_THEAS          -----------GLGALKGNFPPKTSPVERPKQKPELEEAEVRPV----------------
D1B7F4_THEAS          ----------------RCDAPPKGAPRPR-----GAEAEPLRPP----------------
Q89FV3_BRADU          -----PVANAAPQVQQAPAAPAAAAESRLADLTARLRADNQRLA----------------
Q89XY9_BRADU          ---------------LDPAQQALPVETALTQLAGRLRNDGRRIA----------------
A9CIB1_AGRFC          -----RAAAAKPLIRPSAAVAPAPAAVQPAHAVSQAPKTVDQIA----------------
A9CGZ3_AGRFC          ------------------------------------------------------------
FTSZ_CAUVC            -----RNISAAPLIAETSRPAPQPEPARPTARYEAARPAERPVA----------------
Q3J4L5_RHOS4          -----RRSMAAPLPASFSQPEPTPAPQPAPRREMPAPRAAQPAA----------------
FTSZ_RICPR            ---------------DKVPKYKLAIDKNTNTLPEETYNESIIQH----------------
Q748E1_GEOSL          -------DMEKARQELKNVTPFGKAEVNR----------DIPTF----------------
Q8KGD8_CHLTE          -----SGQQEKTLPKAHHVQGFGRLVQSSGYPEQVVEDMRIPAY----------------
FTSZ_ECOLI            --------ITLVTNKQVQ----------QPVMD-RYQQHGMAPL----------------
A0A384LQ43_YERPE      --------ITLVTNKKTQ----------PVMDH-RYQQHGMSPL----------------
FTSZ_BUCAI            --------VNQIKNKSSR----------EVLMDYRYQYLNISPK----------------
Q8E9Q1_SHEON          --------IQLVSKPAPRPEPVVVEPKVEAYVEEATHVSYAAPK----------------
FTSZ_COXBU            --------AGVPLKPVKNTKNDG---------TLDYHQLDRPTY----------------
FTSZ_PSEAE            --------VKVVDNTVQGSAAQAAAPAQREQQSVNYRDLDRPTV----------------
FTSZ_HAEIN            --------IQVVRQGLSTQNIEG-----EGRVNIVPELHRRESV----------------
Q5NI93_FRATT          --------FGVEKTSSLQ------------QSASSFSNKTSAPF----------------
Q63QK2_BURPS          -------LLRTGTDNQPISAAPQGYAASHHVSTGDYGAFDTPAV----------------
Q7VUQ8_BORPE          -----E-ALRTGTDNMPVGNMLAG-------QQGDYRGLDMPSV----------------
FTSZ_NEIMB            --------FVPAREVEAVAP-----------SKQEQSHNVEGMI----------------
Q2S524_SALRD          -------EGDDGRRTVPLEDQNEDDDPADYKGETNLRQLDTPAY----------------
B5YFS8_THEYD          SLKETKRIISKDIQSLSSLSLDSVSNFSSKQSDLDMTASETSLKKE--------------
Q8F8E5_LEPIN          ----------KLLQNQDSIQRGAQENYGFQRKAVGMENSALEKK----------------
FTSZ_THEMA            -------------EDKILFPEGDIPAIYRYGLEGLL------------------------
Q6MT25_MYCMS          ------------QESNIIKTPRVEPVVQQAQPSKPIQQEQEEEQ----------------
FTSZ_AQUAE            -----------EKEVKFKVIKKEEK----EEPKEEPKP----------------------
Q8A262_BACTN          -----------DTLHEARSQEEEERQLQLEEEKEKNKERIRKAYGESA-------GIGKK
Q0PAI3_CAMJE          ---------------TVAKKSTEEAQASKKNPYLSLKKVSGG------------------
FTSZ_HELPY            ----------------SGGASLESIATPSQPVVKQTRKVGNGEY----------------
A9WH25_CHLAA          ----------------------------SGQANPKASVTHTIS-----------------
FTSZ_MYCPN            -----------------------------FISVKEVNQKPAK------------------
FTSZ_MYCGE            ---------------------------------TENNQN---------------------
                                                                                  

FTSZ1_ARCFU           -------------YGIDFVR----------------------------------------
Q8TI85_METAC          -------------YGIDFVE----------------------------------------
FTSZ1_HALVD           -------------EDIDYVE----------------------------------------
FTSZ1_HALSA           -------------EDIDYVE----------------------------------------
FTSZ1_PYRFU           -------------EESPSIEISIPEL----------------------------------
FTSZ_METTH            -------------REKDSVDESVLEEFIDGVF----------------------------
FTSZ1_METJA           -------------LELTGIPKI--------------------------------------
B1L6L0_KORCO          ------IPIAREVRERSDLGIDEL------------------------------------
Q74ML8_NANEQ          -------------KKKDELGIDVI------------------------------------
Q9HKT7_THEAC          ------------------------------------------------------------
FTSZ_THEAC            ------EHVHRIICGRDRHGELDQPMIRENIFFNLIITT---------------------
Q8TJB2_METAC          ------ETAGPLRKKHEESIIDFIN-----------------------------------
FTSZ2_HALSA           ---GGAHSDGGQDEVEQENGLDVIR-----------------------------------
FTSZ2_METJA           ----------SQRKERKIGGIDFIV-----------------------------------
FTSZ2_PYRFU           ---FNGSRAGRKRPSVGDAILKELG-FKEL------------------------------
FTSZ2_THEKO           ---ISRKSDEKPGSDMRGYINKLLADFDDLS-----------------------------
Q74M90_NANEQ          -------------RKKDEYGIDKIL-----------------------------------
B1L6V7_KORCO          ------------EALEEVLGSPYVL-----------------------------------
Q819Q7_BACCR          -------------KREEPVVHERHSD----------------------------------
A0A0F7RD19_BACAN      -------------KREEPVVHERHSD----------------------------------
FTSZ_BACSU            -------------PQQQNTVSRHTSQ----------------------------------
FTSZ_STAAM            -------------QATDSVSERTHTT----------------------------------
Q2RK72_MOOTA          -------------KPFN-------------------------------------------
A5I4W6_CLOBH          -------------REEQSSTYEQHID----------------------------------
FTSZ_SYNY3            -------------PSTTTPEDPLGEI----------------------------------
Q7NNW0_GLOVI          -------------NNGPNPASPNRGT----------------------------------
FTSZ_ENTFA            GDWDIRREQNTRPKVDESSLEQVDKKEFDTFHREE-------------------------
Q8DNV9_STRR6          GDWDLRRE--SIVRTTDSVVSPVERFEAPISQ----------------------------
FTSZ_STRCO            -----PKEEPEPAPVPEPVADLPVSPPPVPPSRTY-------------------------
FTSZ_MYCTU            -----------SVPLHTNGATLSIG-----------------------------------
Q8G7W7_BIFLO          -----ATAQPAFTPAIGDSASLPFDDPTSAHPNIA-------------------------
Q5SJC5_THET8          ----------IPAFIRYGDG----------------------------------------
Q9RWN5_DEIRA          ----------LVRPVRGGQGGLGGG-----------------------------------
D1BA07_THEAS          -----SHSHGSSSPSVEEDLFRGSGAP---------------------------------
D1B7F4_THEAS          -----MTPDRGDSP----GLFDRS------------------------------------
Q89FV3_BRADU          -----ERAQKLDAQAP-VSGFAPAAAAPVAPRPNVERAALAAIAAAVADVPQAPAPMQTY
Q89XY9_BRADU          -----DRIER-------SAPLPQAASPPLRPQP---------------------------
A9CIB1_AGRFC          -----QTIRSAEAEMERELGFAAHQQPSQDFRPQSKLFASSPAEAPAALRPAQPVQQAAP
A9CGZ3_AGRFC          ------------------------------------------------------------
FTSZ_CAUVC            -----FAPEPAPE--PEIVMSAPQPEPEAELYYDEPTVAEEPRVSAAPARSVNRIVDPLV
Q3J4L5_RHOS4          -----AQPAPQPEPQPAPEPAAHHFDPAASQHYEQDHYVDEDDMPPPAYRPQPQAQPRAT
FTSZ_RICPR            -----TQIETIPSFNSYSTENIEINESSIKQDYTGNE-----------------------
Q748E1_GEOSL          -----VRNQQTRESSLSRQKAFFID---------------DEDQ----------------
Q8KGD8_CHLTE          -----IRKSRSIQEPFDIGRACSTTRSRPSGGSAPMPGQSDEDEQIRK------------
FTSZ_ECOLI            -----TQEQKPVAKVVNDNAPQTAKEP---------------------------------
A0A384LQ43_YERPE      -----PQEVKPAAKVVNDTTAQTNKEP---------------------------------
FTSZ_BUCAI            -----KTDKKIIKKEIKNTKEKINKEP---------------------------------
Q8E9Q1_SHEON          -----GNVLPAAPAPAPAPAPSTKHEL---------------------------------
FTSZ_COXBU            -----MRNQE-PSKRTVDLEEQRDRDF---------------------------------
FTSZ_PSEAE            -----MRNQS-HGSAATAAKLNPQDDL---------------------------------
FTSZ_HAEIN            -----EVSRTASEEYQRPLDKPITDRL---------------------------------
Q5NI93_FRATT          -----LRKETEVVTGASNAPKTDSDDV---------------------------------
Q63QK2_BURPS          -----WRNSR--ETAASHVQALQEKGV---------------------------------
Q7VUQ8_BORPE          -----MRNPR--SQASAQVRALESSGM---------------------------------
FTSZ_NEIMB            -----RTNRGIRTMNLTAADFDNQSVL---------------------------------
Q2S524_SALRD          -----ERRNAPLRSEPSEDEPTDETDGESEDDTPNIRRLEADDLNERTDRDERSRSEEET
B5YFS8_THEYD          TDEHLVSSVSAQENTKHSETKLEPTDEKQKTEPVEHENSVIFLKEPSKDIP---------
Q8F8E5_LEPIN          ---DFFQDENTEQNRNSGSLRLRSSNS-----------------SSSK------------
FTSZ_THEMA            ------------------------------------------------------------
Q6MT25_MYCMS          -----HEEVDEFDDEMSLTTTDDTEEDFN-------------------------------
FTSZ_AQUAE            ---------LSDTTYLEEEEIPAVIR----------------------------------
Q8A262_BACTN          SLRSRRHIYIFNTEDLDNDDIIAMIEESP-------------------------------
Q0PAI3_CAMJE          ---------------YDEEIM---------------------------------------
FTSZ_HELPY            ---------------LKIPTE---------------------------------------
A9WH25_CHLAA          ------------SNDLPPFLKLHRRGCL--------------------------------
FTSZ_MYCPN            --------PFQVLNDLKELGLKYVKQQTGFNY----------------------------
FTSZ_MYCGE            --------KLKLLDELKELGMKYVKHQNQIY-----------------------------
                                                                                  

FTSZ1_ARCFU           ------------------------------------------------------------
Q8TI85_METAC          ------------------------------------------------------------
FTSZ1_HALVD           ------------------------------------------------------------
FTSZ1_HALSA           ------------------------------------------------------------
FTSZ1_PYRFU           ------------------------------------------------------------
FTSZ_METTH            ------------------------------------------------------------
FTSZ1_METJA           ------------------------------------------------------------
B1L6L0_KORCO          ------------------------------------------------------------
Q74ML8_NANEQ          ------------------------------------------------------------
Q9HKT7_THEAC          ------------------------------------------------------------
FTSZ_THEAC            ------------------------------------------------------------
Q8TJB2_METAC          ------------------------------------------------------------
FTSZ2_HALSA           ------------------------------------------------------------
FTSZ2_METJA           ------------------------------------------------------------
FTSZ2_PYRFU           ------------------------------------------------------------
FTSZ2_THEKO           ------------------------------------------------------------
Q74M90_NANEQ          ------------------------------------------------------------
B1L6V7_KORCO          ------------------------------------------------------------
Q819Q7_BACCR          ------------------------------------------------------------
A0A0F7RD19_BACAN      ------------------------------------------------------------
FTSZ_BACSU            ------------------------------------------------------------
FTSZ_STAAM            ------------------------------------------------------------
Q2RK72_MOOTA          ------------------------------------------------------------
A5I4W6_CLOBH          ------------------------------------------------------------
FTSZ_SYNY3            ------------------------------------------------------------
Q7NNW0_GLOVI          ------------------------------------------------------------
FTSZ_ENTFA            ------------------------------------------------------------
Q8DNV9_STRR6          ------------------------------------------------------------
FTSZ_STRCO            ------------------------------------------------------------
FTSZ_MYCTU            ------------------------------------------------------------
Q8G7W7_BIFLO          ------------------------------------------------------------
Q5SJC5_THET8          ------------------------------------------------------------
Q9RWN5_DEIRA          ------------------------------------------------------------
D1BA07_THEAS          ------------------------------------------------------------
D1B7F4_THEAS          ------------------------------------------------------------
Q89FV3_BRADU          GDVTVRPIAQKPTLFPEPEQAPVAMQEPMTPETFIPPQAERAPMRAPRMPRLEELPMPAQ
Q89XY9_BRADU          ------------------------------------------------------------
A9CIB1_AGRFC          APVAQAPVYHAPEQVAVPAPRMQQPQAPVYQEPAPVARQPEP----VRMPKVEDFPPVVK
A9CGZ3_AGRFC          ------------------------------------------------------------
FTSZ_CAUVC            DDVAEEPLFPENNYYEE-------------------------------------------
Q3J4L5_RHOS4          NVHEQDAAAFVAPRPRAPGQPSPEALARLQAAVNKNPAQNRP------------------
FTSZ_RICPR            ------------------------------------------------------------
Q748E1_GEOSL          ------------------------------------------------------------
Q8KGD8_CHLTE          ------------------------------------------------------------
FTSZ_ECOLI            ------------------------------------------------------------
A0A384LQ43_YERPE      ------------------------------------------------------------
FTSZ_BUCAI            ------------------------------------------------------------
Q8E9Q1_SHEON          ------------------------------------------------------------
FTSZ_COXBU            ------------------------------------------------------------
FTSZ_PSEAE            ------------------------------------------------------------
FTSZ_HAEIN            ------------------------------------------------------------
Q5NI93_FRATT          ------------------------------------------------------------
Q63QK2_BURPS          ------------------------------------------------------------
Q7VUQ8_BORPE          ------------------------------------------------------------
FTSZ_NEIMB            ------------------------------------------------------------
Q2S524_SALRD          ------------------------------------------------------------
B5YFS8_THEYD          ------------------------------------------------------------
Q8F8E5_LEPIN          ------------------------------------------------------------
FTSZ_THEMA            ------------------------------------------------------------
Q6MT25_MYCMS          ------------------------------------------------------------
FTSZ_AQUAE            ------------------------------------------------------------
Q8A262_BACTN          ------------------------------------------------------------
Q0PAI3_CAMJE          ------------------------------------------------------------
FTSZ_HELPY            ------------------------------------------------------------
A9WH25_CHLAA          ------------------------------------------------------------
FTSZ_MYCPN            ------------------------------------------------------------
FTSZ_MYCGE            ------------------------------------------------------------
                                                                                  

FTSZ1_ARCFU           ------------------------------------------------------------
Q8TI85_METAC          ------------------------------------------------------------
FTSZ1_HALVD           ------------------------------------------------------------
FTSZ1_HALSA           ------------------------------------------------------------
FTSZ1_PYRFU           ------------------------------------------------------------
FTSZ_METTH            ------------------------------------------------------------
FTSZ1_METJA           ------------------------------------------------------------
B1L6L0_KORCO          ------------------------------------------------------------
Q74ML8_NANEQ          ------------------------------------------------------------
Q9HKT7_THEAC          ------------------------------------------------------------
FTSZ_THEAC            ------------------------------------------------------------
Q8TJB2_METAC          ------------------------------------------------------------
FTSZ2_HALSA           ------------------------------------------------------------
FTSZ2_METJA           ------------------------------------------------------------
FTSZ2_PYRFU           ------------------------------------------------------------
FTSZ2_THEKO           ------------------------------------------------------------
Q74M90_NANEQ          ------------------------------------------------------------
B1L6V7_KORCO          ------------------------------------------------------------
Q819Q7_BACCR          ------------------------------------------------------------
A0A0F7RD19_BACAN      ------------------------------------------------------------
FTSZ_BACSU            ------------------------------------------------------------
FTSZ_STAAM            ------------------------------------------------------------
Q2RK72_MOOTA          ------------------------------------------------------------
A5I4W6_CLOBH          ------------------------------------------------------------
FTSZ_SYNY3            ------------------------------------------------------------
Q7NNW0_GLOVI          ------------------------------------------------------------
FTSZ_ENTFA            ------------------------------------------------------------
Q8DNV9_STRR6          ------------------------------------------------------------
FTSZ_STRCO            ------------------------------------------------------------
FTSZ_MYCTU            ------------------------------------------------------------
Q8G7W7_BIFLO          ------------------------------------------------------------
Q5SJC5_THET8          ------------------------------------------------------------
Q9RWN5_DEIRA          ------------------------------------------------------------
D1BA07_THEAS          ------------------------------------------------------------
D1B7F4_THEAS          ------------------------------------------------------------
Q89FV3_BRADU          AEIRQARGEVEEETPQKTRLSLLQRLANVGLGRRDEESEPPVAARTAGPAIPPLPERRPQ
Q89XY9_BRADU          -------------------------------------------HHPVGPPARPGLDYAPQ
A9CIB1_AGRFC          AEMDHRDRATPVAQEERGPMGLLKRITNSLGRR---------EEEEVPSDMMDAPSMAPQ
A9CGZ3_AGRFC          ------------------------------------------------------------
FTSZ_CAUVC            ------------------------------------------RRPQKQGGFFSMFGGGRQ
Q3J4L5_RHOS4          -------------------------------------GMAAGQQRPAAPVQRPAAAASAE
FTSZ_RICPR            ------------------------------------------QELRLHVNAVNKPENNSQ
Q748E1_GEOSL          ------------------------------------------------------------
Q8KGD8_CHLTE          ------------------------------------------------------------
FTSZ_ECOLI            ------------------------------------------------------------
A0A384LQ43_YERPE      ------------------------------------------------------------
FTSZ_BUCAI            ------------------------------------------------------------
Q8E9Q1_SHEON          ------------------------------------------------------------
FTSZ_COXBU            ------------------------------------------------------------
FTSZ_PSEAE            ------------------------------------------------------------
FTSZ_HAEIN            ------------------------------------------------------------
Q5NI93_FRATT          ------------------------------------------------------------
Q63QK2_BURPS          ------------------------------------------------------------
Q7VUQ8_BORPE          ------------------------------------------------------------
FTSZ_NEIMB            ------------------------------------------------------------
Q2S524_SALRD          ------------------------------------------------------------
B5YFS8_THEYD          ------------------------------------------------------------
Q8F8E5_LEPIN          ------------------------------------------------------------
FTSZ_THEMA            ------------------------------------------------------------
Q6MT25_MYCMS          ------------------------------------------------------------
FTSZ_AQUAE            ------------------------------------------------------------
Q8A262_BACTN          ------------------------------------------------------------
Q0PAI3_CAMJE          ------------------------------------------------------------
FTSZ_HELPY            ------------------------------------------------------------
A9WH25_CHLAA          ------------------------------------------------------------
FTSZ_MYCPN            ------------------------------------------------------------
FTSZ_MYCGE            ------------------------------------------------------------
                                                                                  

FTSZ1_ARCFU           ------------------------------------------------------------
Q8TI85_METAC          ------------------------------------------------------------
FTSZ1_HALVD           ------------------------------------------------------------
FTSZ1_HALSA           ------------------------------------------------------------
FTSZ1_PYRFU           ------------------------------------------------------------
FTSZ_METTH            ------------------------------------------------------------
FTSZ1_METJA           ------------------------------------------------------------
B1L6L0_KORCO          ------------------------------------------------------------
Q74ML8_NANEQ          ------------------------------------------------------------
Q9HKT7_THEAC          ------------------------------------------------------------
FTSZ_THEAC            ------------------------------------------------------------
Q8TJB2_METAC          ------------------------------------------------------------
FTSZ2_HALSA           ------------------------------------------------------------
FTSZ2_METJA           ------------------------------------------------------------
FTSZ2_PYRFU           ------------------------------------------------------------
FTSZ2_THEKO           ------------------------------------------------------------
Q74M90_NANEQ          ------------------------------------------------------------
B1L6V7_KORCO          ------------------------------------------------------------
Q819Q7_BACCR          --------------------------------------------SD--DIDIPAFLRNRR
A0A0F7RD19_BACAN      --------------------------------------------SDSDDIDIPAFLRNRR
FTSZ_BACSU            --------------------------------------------PADDTLDIPTFLRNRN
FTSZ_STAAM            --------------------------------------------KED---DIPSFIRNRE
Q2RK72_MOOTA          ----------------------------------------------IDDLDIPAFLRRR-
A5I4W6_CLOBH          --------------------------------------------END--LEIPAFLRRQR
FTSZ_SYNY3            --------------------------------------------PMAPELDIPDFLQKRR
Q7NNW0_GLOVI          --------------------------------------------AGEDVLDIPEFLRRRR
FTSZ_ENTFA            ------------------------------------------PNHNDDELSTPPFFRRKR
Q8DNV9_STRR6          ---------------------------------------------DEDELDTPPFFKNR-
FTSZ_STRCO            ------------------------------------------SDSAAEELDVPDFLK---
FTSZ_MYCTU            --------------------------------------------GDDDDVDVPPFMRR--
Q8G7W7_BIFLO          ------------------------------------------VNDPAGDLDIPDFLR---
Q5SJC5_THET8          -------------------------------------------DYPPRRGN---------
Q9RWN5_DEIRA          ------------------------------------------SSYDPKDYDIPAFLRNVG
D1BA07_THEAS          ----------------------------------------------TDDLDVPAAYRRR-
D1B7F4_THEAS          ----------------------------------------------PSSLDVPTILRRRG
Q89FV3_BRADU          KSVAQQIAATEPVSEYARRPAPQGLDVHGRSAPVAPAPQ------GDDHLDIPAFLRRQA
Q89XY9_BRADU          -------AALQPLDPYGRAPA--------RNLPDEAA------------LDIPAFLRRAA
A9CIB1_AGRFC          R------RAPLSPEASLYAPRRGQLDDHGRATPSSSSHH------DDDQLEIPAFLRRQS
A9CGZ3_AGRFC          ------------------------------------------------------------
FTSZ_CAUVC            R-------YEQQASAPQAQARSAQSARPQLQPIETPQAD------DAEDLEIPSFLRRLA
Q3J4L5_RHOS4          KPRFGIGSLINRMAGHGEQQPEPRPQQSRQQPPVTSYEDEPEMSADQERIEIPAFLRRQA
FTSZ_RICPR            KS-----SFLGKIWESLRTSNNQTLERKNVIVNTVDQDNK-----ESDIHDIPAFLRKKR
Q748E1_GEOSL          -------------------------------------------------YDIPTFLRKSV
Q8KGD8_CHLTE          -----------------------------------------------GATDTPAYLRRKN
FTSZ_ECOLI            -----------------------------------------------DYLDIPAFLRKQA
A0A384LQ43_YERPE      -----------------------------------------------DYLDIPAFLRKQA
FTSZ_BUCAI            -----------------------------------------------EYLDIPSFLRKRA
Q8E9Q1_SHEON          -----------------------------------------------DYLDIPAFLRKQA
FTSZ_COXBU            -----------------------------------------------EYLDIPAFLRRLE
FTSZ_PSEAE            -----------------------------------------------DYLDIPAFLRRQA
FTSZ_HAEIN            -----------------------------------------------EAFKKNNFFNPAQ
Q5NI93_FRATT          -----------------------------------------------NKSDIPSFLRRR-
Q63QK2_BURPS          -----------------------------------------------DTYDIPAFLRKQA
Q7VUQ8_BORPE          -----------------------------------------------DHFDIPAFLRKQA
FTSZ_NEIMB            -----------------------------------------------DDFEIPAILRRQH
Q2S524_SALRD          ----------------------------------------------DDDTDTPAFLRKMM
B5YFS8_THEYD          -------------------------------------------PEIEDEIDIPAYLRKKH
Q8F8E5_LEPIN          ----------------------------------------------VEDYDIPAYLRRNS
FTSZ_THEMA            ------------------------------------------------------------
Q6MT25_MYCMS          ------------------------------------------------DDDFPTFLK---
FTSZ_AQUAE            -------------------------------------------------RKNKRLL----
Q8A262_BACTN          ----------------------------------------------TYTRDKTKLLKIKT
Q0PAI3_CAMJE          -----------------------------------------------AQIETPTFLRRQM
FTSZ_HELPY            -----------------------------------------------EELSIPTTMRIQQ
A9WH25_CHLAA          ------------------------------------------------------------
FTSZ_MYCPN            ------------------------------------------------------------
FTSZ_MYCGE            ------------------------------------------------------------
                                                                                  

FTSZ1_ARCFU           ----------------------
Q8TI85_METAC          ----------------------
FTSZ1_HALVD           ----------------------
FTSZ1_HALSA           ----------------------
FTSZ1_PYRFU           ----------------------
FTSZ_METTH            ----------------------
FTSZ1_METJA           ----------------------
B1L6L0_KORCO          ----------------------
Q74ML8_NANEQ          ----------------------
Q9HKT7_THEAC          ----------------------
FTSZ_THEAC            ----------------------
Q8TJB2_METAC          ----------------------
FTSZ2_HALSA           ----------------------
FTSZ2_METJA           ----------------------
FTSZ2_PYRFU           ----------------------
FTSZ2_THEKO           ----------------------
Q74M90_NANEQ          ----------------------
B1L6V7_KORCO          ----------------------
Q819Q7_BACCR          RR--------------------
A0A0F7RD19_BACAN      RR--------------------
FTSZ_BACSU            KRG-------------------
FTSZ_STAAM            ERRSRRTRR-------------
Q2RK72_MOOTA          ----------------------
A5I4W6_CLOBH          K---------------------
FTSZ_SYNY3            FPRR------------------
Q7NNW0_GLOVI          PLV-------------------
FTSZ_ENTFA            ----------------------
Q8DNV9_STRR6          ----------------------
FTSZ_STRCO            ----------------------
FTSZ_MYCTU            ----------------------
Q8G7W7_BIFLO          ----------------------
Q5SJC5_THET8          ----------------------
Q9RWN5_DEIRA          GQ--------------------
D1BA07_THEAS          RRPS------------------
D1B7F4_THEAS          MGPG------------------
Q89FV3_BRADU          T---------------------
Q89XY9_BRADU          N---------------------
A9CIB1_AGRFC          N---------------------
A9CGZ3_AGRFC          ----------------------
FTSZ_CAUVC            N---------------------
Q3J4L5_RHOS4          N---------------------
FTSZ_RICPR            D---------------------
Q748E1_GEOSL          D---------------------
Q8KGD8_CHLTE          NPPLQ-----------------
FTSZ_ECOLI            D---------------------
A0A384LQ43_YERPE      D---------------------
FTSZ_BUCAI            D---------------------
Q8E9Q1_SHEON          D---------------------
FTSZ_COXBU            ED--------------------
FTSZ_PSEAE            D---------------------
FTSZ_HAEIN            REEN------------------
Q5NI93_FRATT          ----------------------
Q63QK2_BURPS          D---------------------
Q7VUQ8_BORPE          D---------------------
FTSZ_NEIMB            NSDK------------------
Q2S524_SALRD          D---------------------
B5YFS8_THEYD          KILNEKNI--------------
Q8F8E5_LEPIN          SGP-------------------
FTSZ_THEMA            ----------------------
Q6MT25_MYCMS          ----------------------
FTSZ_AQUAE            ----------------------
Q8A262_BACTN          KAALEEEVAMEEATDNDGVITF
Q0PAI3_CAMJE          D---------------------
FTSZ_HELPY            D---------------------
A9WH25_CHLAA          ----------------------
FTSZ_MYCPN            ----------------------
FTSZ_MYCGE            ----------------------