CLUSTAL format seed alignment for MF_00911

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

FTSQ_ECOLI      ------------------------------------------------------------
FTSQ_SHIDS      ------------------------------------------------------------
FTSQ_SALTY      ------------------------------------------------------------
FTSQ_YERPE      ------------------------------------------------------------
FTSQ_BLOFL      ------------------------------------------------------------
FTSQ_VIBCH      ------------------------------------------------------------
FTSQ_ALIF1      ------------------------------------------------------------
FTSQ_HAEIN      ------------------------------------------------------------
FTSQ_ACTPJ      ------------------------------------------------------------
FTSQ_PSEAE      ----------------------------------------MNGVLLRHQQP------GGL
FTSQ_CELJU      ---------------------------------MDSREDMVPDVLLEAPNPRRRQSADTS
FTSQ_ALLVD      ------------------------------------------------------------
FTSQ_THISK      ------------------------------------------------------------
FTSQ_BORPE      ------------------------------------------------------------
FTSQ_BURPS      ------------------------------------------------------------
FTSQ_NITMU      ------------------------------------------------------------
FTSQ_NEIG1      ------------------------------------------------------------
FTSQ_NEIMB      ------------------------------------------------------------
FTSQ_RHIME      ------------------------------------------------MLALRGRR-GKR
FTSQ_AGRFC      -----------------------------------------MDGGGRFVFAVTGKKSTAK
FTSQ_BARBA      --------------------------------------------------MDSGGRIVYA
FTSQ_RICCN      ------------------------------------------------------------
FTSQ_RICFE      ------------------------------------------------------------
FTSQ_RICPR      ------------------------------------------------------------
FTSQ_RICTY      ------------------------------------------------------------
FTSQ_RICBR      ------------------------------------------------------------
FTSQ_CAUVN      ------------------------------------------------MPAVVRGGPPKP
FTSQ_CAUVC      ------------------------------------------------MPAVVRGGPPKP
FTSQ_ZYMMO      ---------------------------------------------MAKAARRTKSAPARR
FTSQ_NOVAD      ---------------------------------------------MAQTIKRGGKGVRRA
FTSQ_RHOS4      ---------------------------------MQSLS------------FPPNRRTPRL
FTSQ_PARDP      ---------------------------------MQGLNPFHRDQGAGGRPAPVRPAPARP
FTSQ_DINSH      ----------------------------------------------------MRPLSFRR
FTSQ_JANSC      ----------------------------------------------MTTRSPARPLIARR
FTSQ_ROSLO      ------------------------------------------------MRPLMR---NRA
FTSQ_KETVY      ------------------------------------------------MRPVDKKPVDRK
FTSQ_MYCTU      ----------------MTEHN-EDPQIERVA-------------------------DDAA
FTSQ_MYCBO      ----------------MTEHN-EDPQIERVA-------------------------DDAA
FTSQ_MYCLB      ----------------MTETD-EGAPVNHSATMWAVVGVPPVCGGQPGDSGVVAGTSRAL
FTSQ_MYCS2      ----------------MTGTGPHGDPAEDPAG------PDDTAAETDGPAEPTEPVDASE
FTSQ_MYCA9      ----------------MSEPE---NTAEDKD------------------------AEAAI
FTSQ_STRCO      ------------------------------------------------------------
FTSQ_STRCU      ------------------------------------------------------------
FTSQ_STRVP      -----------------------------------------------------------M
FTSQ_STRBB      ------------------------------------------------------------
FTSQ_CHLAA      ----------------------------------------------------------ME
FTSQ_CHLAD      ----------------------------------------------------------ME
FTSQ_GEODF      ------------------------------------------------------------
FTSQ_GEOSM      ------------------------------------------------------------
FTSQ_GEOSL      ------------------------------------------------------------
FTSQ_PELCD      ------------------------------------------------------------
FTSQ_ANASK      ------------------------------------------------------------
FTSQ_MYXFH      ------------------------------------------------------------
FTSQ_SALRD      ------------------------------------------------------------
FTSQ_RHOM4      ------------------------------------------------------------
FTSQ_KORVE      MAR----NGNPQ---------FPDE-------RSTATRAKATEP----EELDDRFSDLEP
FTSQ_ACIC5      MAKTTRHNSDSQRGLTLVEEDFLDEFEDAVPPVPSAANLRAAEPGPRAQARTRRPLPPSP
FTSQ_BRADU      -----------MDGAGSLTRSFFRSLRPQADLKAAAIGAVVLLREWVQDKRRERLHAARA
FTSQ_RHORT      ---------------------------------------------MRRVSQPPPRPRHRR
FTSQ_SHEON      ------------------------------------------------------------
FTSQ_XANCP      ------------------------------------------------------------
FTSQ_COXBU      ------------------------------------------------------------
FTSQ_THIA3      ------------------------------------------------------------
FTSQ_HAHCH      ------------------------------------------------------MTPMKK
FTSQ_METMM      ------------------------------------------------------------
FTSQ_CORGL      ------------------------------------------------------------
FTSQ_ALCBS      ------------------------------------------------------------
FTSQ_ACISD      ------------------------------------------------------------
FTSQ_HIRBI      --------------------------------------------------------MSQV
                                                                            

FTSQ_ECOLI      --------------MSQAALNTRNSEEEV-SSRRNNGTR---------------------
FTSQ_SHIDS      --------------MSQAALNTRNSEEEV-SSRRNNGTR---------------------
FTSQ_SALTY      --------------MSQAALNTRNSDEETPSSRRNNGTR---------------------
FTSQ_YERPE      --------------MSQAALNARERAAEKNAARRSNGSQ---------------------
FTSQ_BLOFL      -------------------------MQYILKLKYYLYNI---------------------
FTSQ_VIBCH      ------------------MINKVLLEGQRITRSPQVKQH---------------------
FTSQ_ALIF1      ------------------MIKAVKMNTSFDKE--KVRKH---------------------
FTSQ_HAEIN      ----------------MNILKRKTPQNIRFGEQKPKYYF---------------------
FTSQ_ACTPJ      ------------------------------------------------------------
FTSQ_PSEAE      GRAPRKPMPRGA--------SRLVAKEPLSVRLPKADFS---------------------
FTSQ_CELJU      TERPTRPARREQGYARVTPRGERMGNHKARVAKPDFFAW---------------------
FTSQ_ALLVD      --------------------------------------M---------------------
FTSQ_THISK      -----------------------------------MTGP---------------------
FTSQ_BORPE      ---------------------------------MWNDAR---------------------
FTSQ_BURPS      ---------------------------------MWNNVR---------------------
FTSQ_NITMU      ---------------------------------MWDNHQ---------------------
FTSQ_NEIG1      ---------------------------------MWDNAE---------------------
FTSQ_NEIMB      ------------------------------------------------------------
FTSQ_RHIME      VRYPADGVAEADEAFVLPRPLRRGVRFLISLGAGRIRFPN--------------------
FTSQ_AGRFC      KREQYAATANADDRRVLPRPLRRFVRFGVSLATGRIHIPA--------------------
FTSQ_BARBA      LNVEKTGFLRILSVTVLQRLYRRVFWFLFKCVAG-IDVPR--------------------
FTSQ_RICCN      MRKKTSSNKKKQTKKTNNISLRRKLGLMYKKAILGLKIA---------------------
FTSQ_RICFE      MRKKTSSNKKKQTKKTNNISLRRKLRLIYKKAILGLKIA---------------------
FTSQ_RICPR      MRQKTISNKNKQTKNTNNISLRRKLGLMYKKAILVLKIV---------------------
FTSQ_RICTY      MRQKTSSNKKKQ-KNTNNISLRRKLGLMYKKAILGLKIV---------------------
FTSQ_RICBR      MRKKTSSNKKNTAKKNNNISLHRKLGLIYKKTILILKIV---------------------
FTSQ_CAUVN      RRPRAEAPASPSKGKPAPRKAQPAAKLHAARGVGLSPTVALSVA----------------
FTSQ_CAUVC      RRPRAEAPASPSKGKPAPRKAQPAAKLHAARGVGLSPTVALSVA----------------
FTSQ_ZYMMO      SPRRHARQTGATIRRPKRPIKSNETIALPKWLGFLSHPLLKQMA----------------
FTSQ_NOVAD      TAARSAQRKVQTARQQTGSVLDSVLRWLPFSEETLHRILMTLIL----------------
FTSQ_RHOS4      APPRRETGRRDPAPSRWAYRAQRLWLTPMFRTALRVGLPI--------------------
FTSQ_PARDP      APVAPRTPRKDPAPSRLAYRLNRMMLRPLVRRLVHVGLPA--------------------
FTSQ_DINSH      RTAQARP---DPAPSRLSYRVQRLLLTPLFHALIRVGLPA--------------------
FTSQ_JANSC      STPAPTPAPHDPAPSRLSYRVTRLWLTPIFRKALHLGIPV--------------------
FTSQ_ROSLO      SER-----GVDPAPSRWAWRMQRLLLTPAFLLFLRAGVPV--------------------
FTSQ_KETVY      IERETRYLRRDPAPSRWSYRYQRLMLTPAFRAGVRLGTPV--------------------
FTSQ_MYCTU      DEEAVTEPLATESKDEPAEHP--EFEGPRRRARRERAERRAAQARATAIEQARRAAKRRA
FTSQ_MYCBO      DEEAVTEPLATESKDEPAEHP--EFEGPRRRARRERAERRAAQARATAIEQARRAAKRRA
FTSQ_MYCLB      VDAAIIAPVTTLTRDEPAQYDRYEFEGPRRRARRERAERRAAQACAIAIEEARREAKHRI
FTSQ_MYCS2      AEMTDTTETTAQTGTTAEADASEEFEGPRRRARRERAERRAARDRAMAIEQARREAKRRA
FTSQ_MYCA9      SADAVESETTADGGENPAEGE--SAEGPRMRARRERMERREAQRRAIALEQARREAKAAA
FTSQ_STRCO      MAGPTTAER----GARQQE-----SSGPPR----VRRFR---------------------
FTSQ_STRCU      MAGPTTAER----GDRQQE-----SSGPPP----ARWSG---------------------
FTSQ_STRVP      AAGPTTAEKSGASGAKRSSKG--SSDGPSRPGTRNRKFR---------------------
FTSQ_STRBB      MAGATTAKG----GARRTP----PPGPPPPALKARRRLR---------------------
FTSQ_CHLAA      YNPPNTRERIVARRQRMRR----NSTEPVVPGWRWRLRE---------------------
FTSQ_CHLAD      YNPPNTRERIAARRQRLRQ----PSSEPAIPGWRRRFID---------------------
FTSQ_GEODF      --MRDLHKKKPRPVTQNRLKKPPKTCKPINYRGILKKTA---------------------
FTSQ_GEOSM      --MRDLHAKKQR-VPHNRVKKPPKERKPINWGPILKFAS---------------------
FTSQ_GEOSL      --MRDLHVKTRIKPAQTRNRVK-RERKPINWRPLITWGS---------------------
FTSQ_PELCD      --MINIGPPKKRRLRRKGNRFK-KTRRVIPWRRLMIGAL---------------------
FTSQ_ANASK      ------MARGPNRRRVDRVPGE-------RRRRLARAMA---------------------
FTSQ_MYXFH      ----MAFGKSKNRRRQDAAQQKEAVRGAVRSQGPRALKV---------------------
FTSQ_SALRD      -----MTRDQTATFGRHALRVA---------GSG--------------------------
FTSQ_RHOM4      -----MPPRKAHTTRRTPAKKS---------GVRRRLLR---------------------
FTSQ_KORVE      E----EDSPFLRSQKRVPVRRGPLPS--KKAANRVKIAL---------------------
FTSQ_ACIC5      EDSGLEEEPFLRVRRRVPVRSGPLPSWTKHRWGKILLAS---------------------
FTSQ_BRADU      AAKDKIKAKAVVEREPPPRVVALVERYLPRRVGISMTVLL--------------------
FTSQ_RHORT      RRRRDVLPSLPRASMVFLIAGGVGMAYLAARTPALAGLIGLAPP----------------
FTSQ_SHEON      ------------------MSWSDKRRHWRARKSQVNWYL---------------------
FTSQ_XANCP      ------------------------------------------------------------
FTSQ_COXBU      ------------------------MKRYNAKRKTHRNLK---------------------
FTSQ_THIA3      -------------------------MSSYAPREIPLDIR---------------------
FTSQ_HAHCH      QLDKSLGSRRGATATRAKERADNRNTGPAAIVRLLAFIP---------------------
FTSQ_METMM      ------------------------------------------------------------
FTSQ_CORGL      ------------------------------------------------------------
FTSQ_ALCBS      -------------MAKNAPAPRGARRKPVKKVGVPLRER---------------------
FTSQ_ACISD      -----------MAQLPASMRRKRAAITSIHDKPPTRKQK---------------------
FTSQ_HIRBI      RSKSQQGKRQAKPQEVVPATILTEQLSTYAFGTVTAGAVM--------------------
                                                                            

FTSQ_ECOLI      -----------------LAGILFLLTVLTTVLVSGWVVLGWMEDAQRLPLSKLVLTG---
FTSQ_SHIDS      -----------------LAGILFLLTVLTTVLVSGWGVLGWMEDAQRLPLSKLVLTG---
FTSQ_SALTY      -----------------LAGILFLLTVLCTVFVSGWVVLGWMEDAQRLPLSKLVLTG---
FTSQ_YERPE      -----------------LAGVIFLLMVLGTILWGGWVVIGWMKDANRLPLSKLVVTG---
FTSQ_BLOFL      -----------------TWKLVFICVMLVLLIVGIHKNIKWVCDYYSGPLSYIIVTG---
FTSQ_VIBCH      -----------------ACGASFFLVVLLLIGGLLYSTISWMWDEQRLPLSKLVLQG---
FTSQ_ALIF1      -----------------LPGAIFLSLVVITSLWLVISTISWMTDEDRLPLSHMIIQG---
FTSQ_HAEIN      -----------------HIRAFAVLLGVFFLLGVYFNWQSILEKMDDKPISAFALVG---
FTSQ_ACTPJ      ---------------------MIVLLCVIFAFLVYSNWHSWLESLDRNPIRAYALTH---
FTSQ_PSEAE      -----------------FLKYLAWPLLLAVLGYGAYRGAEYILPYADRPIAKVSVEG---
FTSQ_CELJU      -----------------FDPRWLWVPLMVCLAVGGYWAYEPLEKLLERPFKSVVVEG---
FTSQ_ALLVD      -----------------GTRLRALLGVLILLVLGGAGWLFLRWEPTLLPIRLIQIEG---
FTSQ_THISK      -----------------GLRLLAGMGLAGALVLGLSLWLHFD-PDQHLPIGSIQITG---
FTSQ_BORPE      -----------------TINLIANTLAVLAVAAMLLAGVAWVAQRPYFTLAAIEIESMPE
FTSQ_BURPS      -----------------QLNLAASALYALLLLVLAAAGCYWLIQRPAFALREIRIDG---
FTSQ_NITMU      -----------------ALNQVADWLFTLAGLTTIYLMVQWTIHLPLLPLKEVHIRSNSG
FTSQ_NEIG1      -----------------AMERLTRWLLVMMAMLLAASGLVWFYNSNHLPVKQVSLKG---
FTSQ_NEIMB      ------------------MERLTRWLLVMMAMLLAASGLVWFYNSNHLPVKQVSLKG---
FTSQ_RHIME      ----------HTGTVAAAAFMVATGLYGMSLGGHTQSFAQVSTTAAGFAIEDVRVSG---
FTSQ_AGRFC      ----------HTGTISAVAFYAMIGLYGMSLGGHTNIVTQTTTSAAGFAVEDVKVSG---
FTSQ_BARBA      ----------HAGSLAVFSFFFLSILYSISSGGYMNHFMKVAISNSGFLVTHVDMSG---
FTSQ_RICCN      --------------LIIFVCLFVFTKYFAGIKTYLTTNIYQTTTKLGFKLENVIIEG---
FTSQ_RICFE      --------------LIIFVCLFVFTKYFAGIKTYLTTNIYQTTTKLGFKLENVIIEG---
FTSQ_RICPR      --------------LMIFVCLFVFTKYFTSIKTYLITNIYQVTTKLGFRLENVIIEG---
FTSQ_RICTY      --------------LMIFVCLFVFTKYFTSIKTYLITNIYQITTKLGFRLENVIIEG---
FTSQ_RICBR      --------------LIIFICLFAFTKYFASLKSYLKTNIYQTTTELGFKLENVIIEG---
FTSQ_CAUVN      ----------GAALGLGLVVMLATGHRAERLGASMVRGVDNTFASAGFRLKTVHIRG---
FTSQ_CAUVC      ----------GAALGLGLVVMLATGHRAERLGASMVRGVDNTFASAGFRLKTVHIRG---
FTSQ_ZYMMO      ----------KRLLLILVIVGFLAGLWAARWPQLLATKTGEYLGRQGFSVRHVEIVG---
FTSQ_NOVAD      ----------AAAAGLVWTVAVMAGI-----PALVSEQAAIIASDAGFKVSHLEVRG---
FTSQ_RHOS4      -----------VGVLLVVALIFASADRRAAMAGAFTGLVDSFQQRPEFMVTLLSVDG---
FTSQ_PARDP      -----------FLAALVAGIWLSDDTRRANLTGGIDAIVDRIQHRDEFMVKMMTIEG---
FTSQ_DINSH      -----------FVLAFGVGWLLQNQELRDELVAQTIALRTQIEQRPEFMVNAMSVSG---
FTSQ_JANSC      -----------FALFAAVTWYLGDETRVAELFEAVQEIRREVENRPEFRVNVLGIDG---
FTSQ_ROSLO      -----------LVLFGAATWWLSDTDRRAAIWETVAEARASFETRPEFMVQLMAVDG---
FTSQ_KETVY      -----------IIIALAVAVVFGRADSRDWIMGHYNAAIAAVTQRPEFMVGSFAITG---
FTSQ_MYCTU      RGQIVSEQNPAKPAARGVVRGLKALLATVVLAVVGIGLGLALYFTPAMSAREIVIIG---
FTSQ_MYCBO      RGQIVSEQNPAKPAARGVVRGLKALLATVVLAVVGIGLGLALYFTPAMSAREIVIIG---
FTSQ_MYCLB      HRQMSSEANSPKPVARGVVRGLKTLFATVMFSIAGFGLGLALYVTPAMSVRNIVVTG---
FTSQ_MYCS2      ---VAGALDPTKSVPRNTIRGLKVLMWAALVSVLAVALGLLLYFTPIMSARNVEVSG---
FTSQ_MYCA9      KGKYVEQ---GKGAGRGKVQGLQTLLLVVLLALIAVGLGSILYFTPLMSVRQTVVTG---
FTSQ_STRCO      -----------------PPRLRTIIILAVALVLVAGGTVWVLYGSNWTRLERVSVSG---
FTSQ_STRCU      -----------------TRRLRALVVLAALLVLLAGGCAWLLYGSSWLRLERVSVSG---
FTSQ_STRVP      -----------------MPGTRALLITLGVLLLVAGG-LWALYGSTWFRVERVKTSG---
FTSQ_STRBB      -----------------LPRRRTLLVTGVATALLGSGVTWLLYGSSWLRVEQVAVSG---
FTSQ_CHLAA      -------------------GLRSGRIVSGIVFVISCFALFYVLFSSRFRVQTVEVVG---
FTSQ_CHLAD      -------------------GLQSGRIVSGAVFVVSCLALFYVLFSSQFRVQTVEVVG---
FTSQ_GEODF      -----------------KVVGGAALISAVGCAGYGIYRIIAGTTF--FKLERIEVSE---
FTSQ_GEOSM      -----------------RGFGGAALCAGLGFGGWQLYNLVSRTTL--LRLEAIEVSP---
FTSQ_GEOSL      -----------------RLVCGLAGLATVGGICYGGYRYLSQWEFAPLPLKEIEVSK---
FTSQ_PELCD      -----------------WGTMALASLGMVVAVACFAGQMLFASDY--FKVERIQVEN---
FTSQ_ANASK      -----------------LALPSILALAALGGAATLGWRVGWKSDLL--RVREIRFEG---
FTSQ_MYXFH      -----------------LGLTLGTGLLVWGGAALREWTL--TSPRF--ELEAVSFSG---
FTSQ_SALRD      -----------------LLVAGVVALGLLG--WQWRANV---------TVDRVAVTG---
FTSQ_RHOM4      -----------------LLVTGVPVLALCGVAWLWLESV---------RLTRIEIVG---
FTSQ_KORVE      -----------------IVLGVLVVIGGVWMALSAYGEHSWRFRLE--SSDSIEVGG---
FTSQ_ACIC5      -----------------LFLLALGLILFVVLAVRHFLDHDPRFEIS--SAASIQTMG---
FTSQ_BRADU      -------------LIGSCGFGIVKGGHLQDFVTAISDARNAMANSAGFRITSVVING---
FTSQ_RHORT      ------------PALGAPGSSVPPAGARDAGEGWGLGETARVLTRQGLVLRQVTVTG---
FTSQ_SHEON      -----------------WSGIGFLSLVIGSFVFGGYLLHKFLNDASTLPIEAVAIKG---
FTSQ_XANCP      --------------MNATLRILAWLIAVALVALPVVAVLNGWVGAERWPLARLRVSG---
FTSQ_COXBU      -----------------SIKKLIPTVLALLAFVSLLAGIITLHNPKTLPFRQIKITV---
FTSQ_THIA3      -----------------LMQGTSRALFWLVALGCLFVAGHWLMQRNWWDIRAVRLQG---
FTSQ_HAHCH      ------------------WNRVLLHVSIFCFWLLVLSALIAGVKWLDRPVATVQVVG---
FTSQ_METMM      -------------------MKFILFALLVSAGSWYGWKQLHSQDAVSKPIRYVKIEG---
FTSQ_CORGL      ------------------MNKKVIAIVVGVVVVLVAILGVVAWFVPILKVGNIEVTG---
FTSQ_ALCBS      -----------------VATAVPWMLVGSVAMVSLLAVIYLPAALDGYPIRKVGVDG---
FTSQ_ACISD      -----------------LANAGGWVLLVIAFVVLAVGIYGLYKVITDATVAKLEVVG---
FTSQ_HIRBI      -----------------VAVAAWMGGSLASIDERIQGGLDATAKSAGFTVTKISIEG---
                                                                            

FTSQ_ECOLI      --ERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLPWIKQVSV-RKQWPDELKI
FTSQ_SHIDS      --ERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLPWIKQVSV-RKQWPDELKI
FTSQ_SALTY      --ERHYTRNDDIRQAILALGAPGTFMTQDVNIIQSQIE-RLPWIKQASV-RKQWPDELKI
FTSQ_YERPE      --ERHYTTNDDIRQAILALGAPGTFMTQDVNIIQQQIE-RLPWIQQASV-RKQWPDELKI
FTSQ_BLOFL      --NRFFTTNDDINYIILKSGVLGTFITQDVNIIQKQIK-QMPWIQKVSV-RKQWPNTLKI
FTSQ_VIBCH      --DLHYVSALDVQRVLARLDHIGTFMSQDINVLQESVQ-SIPWVSHASI-RKQWPDTIKV
FTSQ_ALIF1      --QLKHITADDIREAIDSMDSIGTFMTQDVNKLQDALL-SLPWIAQVSV-RKQWPETIKV
FTSQ_HAEIN      --QNTFTTADDIKESLLKMGELKGFWGQDVAPIQEQIE-ALPWVKGAIV-RKMWPNRLSI
FTSQ_ACTPJ      --KTRFTTNADIRETLSQKPALKGYFGQDIQDVKAKLL-AISWVRDVVV-RKVYPDRLSI
FTSQ_PSEAE      --DLSYISQRAVQQRISPY-LAASFFTIDLAGMRGQLE-QMPWIAHAEV-RRVWPDQVVI
FTSQ_CELJU      --EFHFITKARATELISDE-IDNNFLQLDLMRLKRTLT-DDPWVDSVSL-QRRWPDTLVV
FTSQ_ALLVD      --EVHHHSSQQLQERLTER-LHGGILTADLVDLKQTAE-ELPWVGQATL-RRVWPDTLRV
FTSQ_THISK      --EPRHADTDAILERVRAH-APG-FVGTDLEVLREELQ-AMPWVDAVQL-RRRWPDTLEV
FTSQ_BORPE      T-EMHYVSTGAVRAAIAGR-FGGNFFTVDLDEAREAFE-SVPWVRHATV-RRIWPNTLRV
FTSQ_BURPS      --DTEHINAPTVRAGVVGR-LKGNFFTVDLDLARVAFE-QMPWVRHASV-RRVWPNALAV
FTSQ_NITMU      SGELRHVTREQVSDVVHRE-VGGNFLTIDLEAARHTFE-KLAWVRVASV-RRIWPNGLDV
FTSQ_NEIG1      --NLVYSDKKALGSLAKEY-IHGNILRTDINGAQEAYR-RYPWIASVMV-RRRFPDTVEV
FTSQ_NEIMB      --NLVYSDKKTLGSLAKEY-IHGNILRTDINGAQEAYR-RYPWIASVMV-RRRFPDTVEV
FTSQ_RHIME      ----NAQTSEIDILQQLGLDGTTSLVALDIEEARRLIGE-LPWVETVTV-RKVYPGTIEV
FTSQ_AGRFC      ----NLQTSEIEVFQLLGLDGSTSLIALDIDAARRKLVQ-LPWVEDVDI-RKVYPKTVEV
FTSQ_BARBA      ----NKRMMEQDILKVLGLDEYPSMISFDIDKARFILEQ-QPWVRLADV-QKIYPDRLRI
FTSQ_RICCN      ----QQNVDEPTILKVLNANKGSPIFALKLDEIRNNLKK-NKWIKEVYV-SRRLPNTVYI
FTSQ_RICFE      ----QQNVDEPTILKVLNANKGSPIFALKLDEIRNNLKK-NKWIKEVYV-SRRLPNTVYI
FTSQ_RICPR      ----QQNVDELTILKVLNANKSSPIFSLKLDEISNNLKK-SKWIKEVYV-SRRLPNTVYI
FTSQ_RICTY      ----QQNVDELTILKVLNANKRSSIFALKLDEISNNLKK-SKWIKEVYV-SRRLPNTVYI
FTSQ_RICBR      ----QQNVDEPTILKVLNAKKGSSIFALNLDEIRNNLKN-NRWIKEVYV-SRRLPSTIYI
FTSQ_CAUVN      ----ASATAQADILKASGLYLDQPTLGMDLADVRDRVQG-VGWVKDAKV-VRMLPDTVLI
FTSQ_CAUVC      ----ASATAQADILKASGLYLDQPTLGMDLADVRDRVQG-VGWVKDAKV-VRMLPDTVLI
FTSQ_ZYMMO      ----LHHMDRQAIYDIASTQQNLAMPLVDLNAIRDRLLR-FGWIEDARV-SRRWPDTLVV
FTSQ_NOVAD      ----VNRMNEAKIYERILGQNDRAMTTLDLAALRDELNQ-LPWVKDARV-SRKLPDTLVI
FTSQ_RHOS4      ----ASPELSDRIRATLALKLPLSSFDIDLTAARARIES-IDAVAQAEV-RVRSGGLLEV
FTSQ_PARDP      ----ASPVVDKGLRAMLPVELPASSFEIDLEKLRERVLK-LDAVETVDL-RIKPGGVLSA
FTSQ_DINSH      ----ASTELIEDIHEVVPIDFPVSSFALDLEAMDRIIGE-LDAVAEVDL-SIQAAGILAI
FTSQ_JANSC      ----ASDDVTEQVRAALALDLPISSFDLDLDELRGRLEA-LPPVRTADL-RIQSGGYLAV
FTSQ_ROSLO      ----ATDALAAEIRKEVPLDFPLSSFDLNLSDMRDRIVA-LDPVKSATV-RIRPGGVLHI
FTSQ_KETVY      ----ASPDLALAIEGLVDIPFPISTFNLDLQDLRTNIAA-LSPVRNVNV-QAG-GGVLQI
FTSQ_MYCTU      ----IGAVSREEVLDAARVRPATPLLQIDTQQVADRVAT-IRRVASARV-QRQYPSALRI
FTSQ_MYCBO      ----IGAVSREEVLDAARVRPATPLLQIDTQQVADRVAT-IRRVASARV-QRQYPSALRI
FTSQ_MYCLB      ----IETVTREEVLDAAGVQLGTPLLQINTNQVADQVAA-IRRVASARA-QRQYPSALRI
FTSQ_MYCS2      ----LAEIPQEEVLTAAAVAPGTPLLQVDTDAVAERVAT-IRRVATARV-QREYPSTLKI
FTSQ_MYCA9      ----TGVVTQEDVLGALSIPKGTRLLQIDTAAAADRVAS-IRRVASARV-QCEYPSTLRV
FTSQ_STRCO      ----TDVLTPAQVREAADVPVGDPLVSVDTEAVEARLRRKLPRIDEVDV-ERSWPHGIGL
FTSQ_STRCU      ----TRMLTPADVREAASVPVGAPLVSVDTEAVEARLRRKLPRIDTVDV-VRSWPHGIGL
FTSQ_STRVP      ----TSVLTPREVEAAAAVPLGAPLVTVDTDAIEARIRKELPRVDSVDV-VRSWPHGIGL
FTSQ_STRBB      ----TAALTPGEVREAAAIPLNEPLAAVDTDSVERRLRARLSRIADVDV-SRSWPDTIAV
FTSQ_CHLAA      ----AEFLSPERIVAAVPLRGLPIWLVDEEQAVAPLLTS--PFVEEARL-TLSLPDRARI
FTSQ_CHLAD      ----VEFLSPERIVNAVPLRGWPIWLIDEEQAVAPLLRS--PFVEHARL-SLILPDRARI
FTSQ_GEODF      ----LKTLKRQEIIDLAGVREGDGMFGLRLRSIGEQIGK-NPWVSRVEV-RRYLPNTLSM
FTSQ_GEOSM      ----LKRVSREEIITLAGVRPGDSMLKVDLKTVVARLSK-NPWLEEVQV-RRYFPHTLSI
FTSQ_GEOSL      ----LQRLKRDDVIAQAGVRPGDSMLGLRLRDIGSQLAK-NPWIDKVQV-RRYFPHTLAI
FTSQ_PELCD      ----NRRIGREEILALSDICPGTNIFELDLERVSTRIEK-NPWIASARV-RRMFPDQLVI
FTSQ_ANASK      ----LSRATPQELLDLSPVQPGDHLLFLDTDAMAAALRR-HPWIASAQV-RRTFPPALEV
FTSQ_MYXFH      ----LQRASRVELLRLAALTKGQNLWTLDVDALERAMDQ-HPWLRTVEV-TRRFPNRVSV
FTSQ_SALRD      ----AQHAPPDTLRRLARVGRGTAMRAVAPMLVADRVAR-HPWVKEATAETQWMQGALTI
FTSQ_RHOM4      ----ARQADPGELRRLAAVDSGAALFDLDPALIADRVAR-HPWVQAASV-TRWPTGTLRI
FTSQ_KORVE      ----NEHMSRGEITRVFGGDISRNIFAVPLDERKKQVEE-LPWVESATV-MRILPDRIRV
FTSQ_ACIC5      ----NSELSRADLLSVFGSDIGRNIFFVPLGERAAQLES-IPWVKHATV-MRILPDQLRV
FTSQ_BRADU      ----RKQLTQDEILAIGGVSGRSSLLFLDADAVRDKLKA-NPWIADATV-LKLYPGQLMI
FTSQ_RHORT      ----RDLTAGRDILGAIGVPQGGPLLAIDPETVRTRLEA-LPWVASARV-ERRLPDQVHV
FTSQ_SHEON      ---ERTYTTDKDIQIALQDLMQRSFFSADITLVQQALEA-LPWVYRASV-RREWPAKLRV
FTSQ_XANCP      ---DFKRVPAEELRAVVLPYARSGFFAVKLQDAQDAIAR-LPWVESAQV-RKRWPDVLEV
FTSQ_COXBU      ---SSDHIKMAELKDIVVHHIQGGFFSFNASALQTALMS-LPWVHDVSV-RRIWPNELEI
FTSQ_THIA3      ---DLQRISPVTVRAEALPQLRGNFLTINLAQAQRVFES-LPWVRTAVV-QRLWPMQLAV
FTSQ_HAHCH      ---ELNYVSRGEVKELLSPLLHASFFTSDLEGVRKSLEA-HPWVKRASI-SRLWPDAVQV
FTSQ_METMM      ---AFQYTNKETLKRILTPEMKRGFYHVDMDAIHQLISQ-LPLVAAVDV-NRVWPDAVHI
FTSQ_CORGL      ----ATRTDPDQVLEVSGIVEGENLFRVDATAAGQNIVE-LPWVKSVTV-NRALPSTITV
FTSQ_ALCBS      --VTDVRRQQQIETALAALVREENYFSVPLEEIYQQSQG-LSWVEEVSV-RRQWPDTVVL
FTSQ_ACISD      ---STSSVETQQVMQHVAPIIKANYFTSDLEQIRDKTLE-ISWVDRVVV-SRAWPNGIRV
FTSQ_HIRBI      ----LDPRTKADVLNAVAIPVDSNMFRADPFVIKERIEASVENVSEVRV-LRQWPNDIWI
                                                           :  .             

FTSQ_ECOLI      HLVEYVPIARWNDQH-----MVDAEGNTFSVPP---------ERTSKQVLPMLYGPEGSA
FTSQ_SHIDS      HLVEYVPIARWNDQH-----MVDAEGNTFSVPP---------DRTSKQVLPMLYGPEGSA
FTSQ_SALTY      HLVEYVPIARWNDQH-----MVDAEGNTFSVPS---------DRIGKQVLPMLYGPEGSA
FTSQ_YERPE      HLVEYVPFARWNDLH-----MIDEQGRSFSVPS---------ERMGKQVLPLLYGPEGSE
FTSQ_BLOFL      NLIEYIPIAYWNNEF-----IS-TTGVVFSVSECLYNEYSSFVRKMYQEIPILYGPTGKD
FTSQ_VIBCH      YLTEYQVEALWNANA-----LLDKNGTVFYGDI----------ARVNGEYVKLYGPDGTA
FTSQ_ALIF1      FVVEHQPEATWNNRV-----IVNPEGVVFNAPM----------SDLREPKPALFGPETSS
FTSQ_HAEIN      WVSEYQPVAFWNQNQ-----FVTLDGIVFQLPS---------VRLTAKNLPYLGGPDYQS
FTSQ_ACTPJ      TLIEHNPVAVWNDVN-----FLSEQGIVFSLPP---------DRIDKTGFPMLYGPDTEG
FTSQ_PSEAE      RLDEQLPIARWGDEA-----LLNNQGQAFTPKE----------LANYEHLPRLHGPQRAQ
FTSQ_CELJU      KIAEQKPIARWGD-G-----FLNQRGQIVRVKE----------IDRLSGLPWLQGNESDA
FTSQ_ALLVD      QVREYRPIARWSLDG-----LVTADGIVFRPQG----------GSIPSNLPLLEGDDKRA
FTSQ_THISK      HVTEPVPVAQWGDDH-----LVDRHGRLFGPVD----------LAEWDFLPALAGEDGRQ
FTSQ_BORPE      RVEEQQPLALWNENQ-----MINTWGEAFTANT--------GELADDMVLPHFTGPEGTE
FTSQ_BURPS      TLEEYKPLGTWGNDQ-----LVSVDGELFTANQ--------GEL--DAELPSFDGPEGSA
FTSQ_NITMU      VVEEHVPLAHWGDSA-----LVNRQGEIFNATS--------DEP-----MPIFEGPRESV
FTSQ_NEIG1      VLTERKPVARWGDHA-----LVDGEGNVFEARL--------DRP----GMPVFRGAEGTS
FTSQ_NEIMB      VLTERKPVARWGDHA-----LVDGEGNVFEARL--------DRP----GMPVFRGAEGTS
FTSQ_RHIME      VLKEREAFGIWQHGS--DLSLIERSGSVIAPLRDN----------KFASLPLFVGRDAET
FTSQ_AGRFC      RLKERQAFGIWQHGT--ELSLIEKSGSVIAPLRDN----------KFAALPLFVGRDAET
FTSQ_BARBA      SLVEREPYAIWQHNG--EMNIIDDTGYVIAPFQAG----------LVQNLSFVVGQGAQK
FTSQ_RICCN      KLFEREPIAIWQINN--QLFLVDEEGYEISKNIQ-----------PFPHLLHVVGEGANI
FTSQ_RICFE      KLFEREPIAIWQINN--QLFLVDEEGYEISKNIQ-----------PFPHLLHVVGEGANI
FTSQ_RICPR      KLFEREPIAIWQINN--QLFLIDEEGYKISKDIQ-----------PFSHLLHVVGEGANI
FTSQ_RICTY      KLFEREPIAIWQINN--QLFLVDEEGYKISKDIQ-----------PFSHLLHVVGEGANI
FTSQ_RICBR      KLFEREPIAIWQINN--QLFLIDEEGYEISKNIE-----------PFPHLLHVVGEGANI
FTSQ_CAUVN      AVEERPALAVWQNHG--RMKVIDSEGQVITEADPA----------RFPQLPLVVGQGADQ
FTSQ_CAUVC      AVEERPALAVWQNHG--RMKVIDSEGQVITEADPA----------RFPQLPLVVGQGADQ
FTSQ_ZYMMO      DIVERNPAAVWQYHG--HLRLVDNNGIIISDVDPH----------ASPDLPLVIGAGANL
FTSQ_NOVAD      DIVERTPHAVLRKPD--RMVLIDDTGVELESVRAD----------RAKGMLVLSGMGVGQ
FTSQ_RHOS4      RVTEREPAIIWRRAA--NLVLLDGTGRRVDDLAFR---------SERGDLAVIAGEGAER
FTSQ_PARDP      VVTERVPVVLWRHAR--GIELLDKTGHRVASVTSR---------EVRGDLPIIAGEGADR
FTSQ_DINSH      EIVERTPAVVWQTRQ--TLEILDAEGHRVGPIESR---------AAHAALPLVAGPGGNR
FTSQ_JANSC      RIDERIPAAVWLTHE--GLSIVDGDGIFVAGFGTR---------ELAAPLPLLGGEGANL
FTSQ_ROSLO      DVEPRIPVVIWRNPQ--GLTAVDVNGIHVGPIAQR---------MDRPDLPLIAGTGATE
FTSQ_KETVY      VIEERQPVAVWRHVD--GLRLMDGEGIATGMILNR---------ADRPELPLIAGDGAQA
FTSQ_MYCTU      TIVERVPVVVKDFSD--GPHLFDRDGVDFAT------------DPPPPALPYFDVDNPGP
FTSQ_MYCBO      TIVERVPVVVKDFSD--GPHLFDRDGVDFAT------------DPPPPALPYFDVDNPGP
FTSQ_MYCLB      TIVERVPVVVKDFPD--GPHLFDCDGVDFAT------------APPPPALPYIDVGHPGP
FTSQ_MYCS2      SIVERVPVVVKDYPD--GPHLFDRDGVDFAT------------GPAPLALPYLDADNPGP
FTSQ_MYCA9      TIVERVPVAAWTGAD--GTHLIDRDGVDFAN------------EPPPPGIPALDVVAPAP
FTSQ_STRCO      KVTERTPVLIVQKGR--NFVEVDDEGVRFATV-----------SKAPKDVPTLELEPARS
FTSQ_STRCU      KVTERTPVLLVRKAG--TFVEVDDDGVRFATV-----------SQAPKGVPVLELTASRS
FTSQ_STRVP      KVTERKPVLLIEKGG--KFIEVDATGMRFATV-----------DTAPRNVPRLVLDSASS
FTSQ_STRBB      RVTERRPEAIVEKAG--KFLEVDEEGVLFATV-----------PQAPKGVPLLQVEADRS
FTSQ_CHLAA      VIVERQPAIYWRTGG--VDYLVDRQGYVIEAA-----------ATPPAEDELVIVDSSNL
FTSQ_CHLAD      VIVERQPVIYWRSGG--VDYLVDRQGFVIEPA-----------TVAPPADALVIVDSSNL
FTSQ_GEODF      QIAERQPVAVINMGY---LYYLDANGDVFKPLT----------EGDQLDYPVITGISEED
FTSQ_GEOSM      TVSERAPQAVANVGC---LYYLDDKGVLFKSLV----------EGDRLDYPLITGFTEEE
FTSQ_GEOSL      EVVERVPVAVVNMGF---LYYMDAGGTVFKPLT----------QGDSLDYPVITGVAEED
FTSQ_PELCD      RVDERIPKAIVRLDF---MYYLDASGHVFKRLE----------KGDRLDFPVISGVDRQA
FTSQ_ANASK      QLAERRPAALVDLGG---LYLVDDRGEVFKRAV----------PGDGLDLPVITGIEREA
FTSQ_MYXFH      EVTEHTPVAMAVLGE---LYVLDEEGEPFKRVT----------PGDGLDLPLVTGLDREG
FTSQ_SALRD      SVTERTPAALAVDAQGRPAYYLDRSGHAMPLP-----------DSAGYDVPLVRGLEAEA
FTSQ_RHOM4      AVEERVPVVLQMDAGGRPLRYLDAEGYGMPPG-----------RGPVPDVPLLYGVRGPA
FTSQ_KORVE      QVTERKPVAFAQIGS--RVQLIDAHGVLMEMP--FS-------TTNKYSFPVISGMHEN-
FTSQ_ACIC5      SIVERTPVAFLRIGS--RISLIDAEGVVLDMTPELM-------AKHHFDFPVITGIDPA-
FTSQ_BRADU      ELTERKAFALWQEAG--RLSVIADDGAVLEPYVSR----------RFLSLPLVVGKGADT
FTSQ_RHORT      AITEREPMALWQHNG--AFAVIDREGRAIAADP-----------GRWRTLPLVVGAGAPG
FTSQ_SHEON      YLQEQQPAAHWNGTA-----WLNVHGEVFEAPS----------HPELEHLPHLSGPDDMG
FTSQ_XANCP      HVVEHKPFARWGTDR-----MLSEQGRLFRTPP----------LLKDFKLPQLGGPDAKT
FTSQ_COXBU      QVEEQRPIARWNQNE-----LITQEGEIFSPPI----------ETIPQNIPQLSGPNDSE
FTSQ_THIA3      TLQAQQPVAIWREPGS-AAQLVNTQGQAFTANLGE---------VQGLGLPQLSGPAGTS
FTSQ_HAHCH      DLEEEEPFVRWRNQG-----YINEAGRLFVKET----------GVVVNGLPALIGPPHSE
FTSQ_METMM      KITEQKPIVRWGDKA-----VLNKQGEVLIPDD----------IDEFKNLPLITGPEGQE
FTSQ_CORGL      ELTEREPAVFIKRAD--GDHVIDTEGKEIIIGT------------PPVGTVEVSGADEGN
FTSQ_ALCBS      TVEERRPVAVWNESV-----LVSDSGQPFKALK----------QYDLDDLPHLNGPEQRL
FTSQ_ACISD      RVMPRHAIARWGTGR-----LLSDGGDVFSEAE----------PTIHPELPLLHGPVSQS
FTSQ_HIRBI      LAENRRPLALWQTDG--EWKVVDQVGKPMDGED----------PAEYVELPRVVGPAGGY
                                         *                          .       

FTSQ_ECOLI      ---NEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLN---NDIKLNLGRG-------
FTSQ_SHIDS      ---NEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLN---NDIKLNLGRG-------
FTSQ_SALTY      ---SEVLQGYREMGQVLAKDKFTLKEAAMTARRSWQLTLN---NGIKLNLGRG-------
FTSQ_YERPE      ---RDVLEGYRAINKVLAANKYQLKMVAMSARHSWQLALD---NDVRLELGRS-------
FTSQ_BLOFL      ---QEVLNNYLRFSAILKSSNFQIKSVKTDTCYTWQLVLD---NNVCLKLGCV-------
FTSQ_VIBCH      ---PQVLKAWRDYNPKFAQLGLNISSLVLNDRRAWQIILD---NGIRLELGKE-------
FTSQ_ALIF1      ---KDVLDFWHQLQKQFEPIHVTVHSVALTERLSWQVVLD---NGIRLELGRD-------
FTSQ_HAEIN      ---LKVIETWNQIYINLKSNNIMAKGINIDDRGAWQVQLD---NDIVLKLGRG-------
FTSQ_ACTPJ      ---KVVLEAWSKIKADLKARNLDLSSVSVDNRGSWTITLS---NNVELRLGRG-------
FTSQ_PSEAE      ---QQVMQQYQLLSQLLRPLGFSIARLEMSDRGGWALTTA---QGVEIQIGRD-------
FTSQ_CELJU      ---VEILQQYQDLSQLLRSRGLDVIALKCDNKKSWRLTLK---NDVEIAIGRD-------
FTSQ_ALLVD      ---PEITARYQAWQAALERVGRGIQRLSVDPRGDWRLKLA---SGAELRLGTT-------
FTSQ_THISK      ---VVLMHRYLEVSARLADAGFEVVGVHEGKRHDWTIHLA---DGAEVLMGRD-------
FTSQ_BORPE      ---SLVVQRYAELARWFAPLDMHVRELVLNPRYAWAVTLS---NGMKLDLGRDPGADAPD
FTSQ_BURPS      ---KEVVARYRDFAKWFAPIHATPEEVTLSPRYAWTVKLS---NGMQVELGRERNSD---
FTSQ_NITMU      ---REMVHQHAVFTKLLQPLKQDVEQVELSPRRAWRVRLG---NGTILELGRE-------
FTSQ_NEIG1      ---AEMLRRYDEFSTVLAKQGLGIKEMTYTARSAWNVVLD---NGITVRLGRE-------
FTSQ_NEIMB      ---AEMLRRYDEFSTVLAKQGLGIKEMTYTARSAWIVVLD---NGITVRLGRE-------
FTSQ_RHIME      -----AAAAFYDEFSRWPEFRSRVKAFVRVAGRRWDLRLN---NGVVVKLPEKD------
FTSQ_AGRFC      -----GAAGFVAQLADWPEIRNRVRAYVRIAGRRWDLHLD---NGIVVKLPEEN------
FTSQ_BARBA      -----TAKLFIQALSVYPQLQNHVRAYVRVGDRRWDLFLA---NGMRIMLPENG------
FTSQ_RICCN      -----YAGTLVLELQKYPALMNKTSAAVRLGDRRWDLNLK---GNISIKLPEKE------
FTSQ_RICFE      -----YAGKLVLELQKYPALMNKTSAAIRLGDRRWDLNLK---GNISIKLPEKE------
FTSQ_RICPR      -----YASKLVLELQKYPALLNKTLVAIRVGDRRWDLNLK---GNISIKLPEKE------
FTSQ_RICTY      -----YASQLVLELKKYPALLNKTLVAIRVGDRRWDLNLK---GNISIKLPEKE------
FTSQ_RICBR      -----YASKLVNELQKYPALINKTSSAIRCGDRRWDLNLK---GGINIKLPAKN------
FTSQ_CAUVN      -----AAGLILPAVASRPRLRDRLEAMVRVDERRWDLRLK---DGSLIQLPAID------
FTSQ_CAUVC      -----AAGLILPAVASRPRLRDRLEAMVRVDERRWDLRLK---DGSLIQLPAID------
FTSQ_ZYMMO      -----HLEDLGHLLEAAPSLKPMIDAASWIGNRRWDLHFA---SGETLSLPEGN--E---
FTSQ_NOVAD      -----RVEDLTRLLDAAPALKPQVSEAEWVGNRRWNLTFK---TGQVLALPEGDE-T---
FTSQ_RHOS4      -----AVPEALEILAAARPILERIRGLVRMGERRWDIVLD---RGQRIQLPVEE------
FTSQ_PARDP      -----AAPEALALIDAAGPILPRLRGLERMGERRWDVVLD---HGQRIKLPEDK------
FTSQ_DINSH      -----AVAEALRLLEVAEELAPRIIGLQRMGERRWDVVLT---EGQRILLPERE------
FTSQ_JANSC      -----AVPEALALMEASSILDDRVHGLVRMGERRWDVVLT---NGSRILLPEIG------
FTSQ_ROSLO      -----HVKEALNLYRAAGPLGTRLRGIVRVGERRWDIVLD---RDQRIMLPKEG------
FTSQ_KETVY      -----AIPEAMELFRIASPLGARVLALVRMGERRWDLVLD---REQIVQLPAVD------
FTSQ_MYCTU      -----------SDPTTKAALQVLTALHPEVASQVGRIAAP---SVASITLTLADG-----
FTSQ_MYCBO      -----------SDPTTKAALQVLTALHPEVASQVGRIAAP---SVASITLTLADG-----
FTSQ_MYCLB      -----------IDPATKAALVVLLALRPEVVSQVARIAAP---SVSSITLILTDG-----
FTSQ_MYCS2      -----------NDPATRAALDVMMALPPDVAAQVGRIAAP---SVASITLTLIDG-----
FTSQ_MYCA9      -----------QDPTTKAALQVLTSLAPDLARQVAKIAAP---SVSSITLTLDDG-----
FTSQ_STRCO      GSAAASLRRFDDDRLVREAVRVAGRLPDKVARDTRVVKVR---SYDDISLELSGG-----
FTSQ_STRCU      GSGAASFRRFGTDRLVREAVRVGGDLPAAVARQTRTVKVG---SYDDISLELGDG-----
FTSQ_STRVP      ----PSLRRFDADRLLQEAVGVRGELPAEIARDTRVVRIT---SYDSVTLELTRG-----
FTSQ_STRBB      ----PSSRHFGATRLRREAVAVIAQLPEKVRADTLSVRVR---SYDSIALGLTRG-----
FTSQ_CHLAA      ---PVEPGMRLDTDALTLARELAFVLPNQIGLHPAQIGWD---FGLGVFVRTAQD-----
FTSQ_CHLAD      ---PVEPQMQLDPDALALARELAWRLPNELGLRPAQIGWD---FGLGVFIRTEQD-----
FTSQ_GEODF      -IARDPAGSKGALKEVLELIAHLKSRADFKLDEVSEIHYD---KGYGVTLFTAAA-----
FTSQ_GEOSM      -LAQDPKGCQEALKNALALIDTLKNGGVFSLEDISEIHYS---KGYGFTLFTMQG-----
FTSQ_GEOSL      -LARDPVGTREALKGAVALMDQLRRGKEFTLADVSEIHLD---KGFGLTLFTAAG-----
FTSQ_PELCD      -LLEGNEATLSQIDKALRLLDRLDGRKIFAIDDVSELSLD---DTTGITLYTCIG-----
FTSQ_ANASK      -WAEGRGELAPLLGGALALLGRWSARGLDARSTISEIHVD---PEYGTTLWSDE------
FTSQ_MYXFH      -YVADPAAARERLRSALAVASAYARLSPDQAEQLSEVRLE---AQSLALVTAS-------
FTSQ_SALRD      -PWTQPDTA-QTPSSLRRVLRALPEAGVADLVAEIEMQPD---DAIQLTTTPIGPHD---
FTSQ_RHOM4      -HPMRPLED-EPVRALLTTLAALEDPARA-LISEIVRAPD---GEFWLYTTPAAGQR---
FTSQ_KORVE      ---EPLSTRSARMKIYQELVKELDASGEHNSKSLSEVDVS---DPDDVKVTVEDADG---
FTSQ_ACIC5      ---IPLAMRAQRMQLYLHFLSALNSDSQHVIDQVSEIDLA---DPEDVRATFNYGGH---
FTSQ_BRADU      -----QARDFLALLARYPQVNSITKAAIFVGERRWNLRLK---DGLDIRLPEQD------
FTSQ_RHORT      -----HAAELLNLLTSQPGIAERVKAATLIGERRWTLRLDSIENGLVVRLPEEDP-----
FTSQ_SHEON      ---TEVLTAYAQVNSLLKINGFTLASLNLTPRHAWHATLG---NGIVLDLGRED------
FTSQ_XANCP      ---QEVVALYNESRALFAPTGLDVERLEMDARGSWSLGLS---NGVQIVIGRDD------
FTSQ_COXBU      ---ENVLNRFQQFSQLLIPFHAAVTALSLTKRGAWSLILN---GHTQIFLGREN------
FTSQ_THIA3      ---AQVLQMSQKLQPLMQEFHQTVATLAQGSGGNWSVQTR---SGLSIDLGSAP------
FTSQ_HAHCH      ---RLVFDNFQKWKAELAKVGLDVNGVIMESRGAWLISFT---DGWELNLGKQD------
FTSQ_METMM      ---KKLLEIMKGVYIVLKDKSMQLAEFHVNDRRAWRIKLA---SGLEMQLGRKA------
FTSQ_CORGL      ---------SEVLPAVIAVINAIKAQDAQMTESIQVVEAP---DQFDILLKMNDG-----
FTSQ_ALCBS      ---EEVMGFYHSMGKTLADVDLSIRSMEVNARLTARLTLN---NDMELVVDREH------
FTSQ_ACISD      ---KMMMRRYNEINQLFHPANLRLKELYLTERMTWFMQFD---SGLRIIVDQDQ------
FTSQ_HIRBI      -----AAPELLAQLKLHPQISEHLEVAMRVGGRRWDLRLD---SGLEIALPEDAQ-----
                                                                            

FTSQ_ECOLI      --------DTMKRLARFVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESTQ
FTSQ_SHIDS      --------DTMKRLARFVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESTQ
FTSQ_SALTY      --------DTMKRLARFVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESNQ
FTSQ_YERPE      --------DRMGRLQRFIELYPMLQQQPD---KRVSYIDLRYDTGASVGWAPVFIDNQGG
FTSQ_BLOFL      --------NLIERLHYFIKVYPFLVKEMDEKNKYIDYVDLRYNSGCSVRWIHNMIDPVFH
FTSQ_VIBCH      --------SLEERISRFFLLYKQLGNKAE----QVSYIDLRYDTGAAVGWFPEQELTQEK
FTSQ_ALIF1      --------SREERVERFIALYKQLESKKD----SIDYIDLRYDTGAAVGWKSDDVENKEE
FTSQ_HAEIN      --------DWKSKLERFVTIYPQIDVPEN---KKIDYIDLRYTAGAAVGMVDR-------
FTSQ_ACTPJ      --------EWTPKIDRFVTIFPEIDVPEG---KKLAYVDLRYEHGAAVGFSPLPK-----
FTSQ_PSEAE      --------HVVDKIRRFVSIYDKALKDQI---SNIARIDLRYPNGLAVAWREPVTPATVA
FTSQ_CELJU      --------KVMEKMRRFVTVYDTHLNSVW---IDIAAIDVRYSNGLAVRWVEGSESAKKY
FTSQ_ALLVD      --------MVEERLARYLASASQLEAAGRP-----LTVDLRYSNGFSVKWAPNTDTGVRA
FTSQ_THISK      --------VNLNRLGQLVRAAPALRAREDAP---IARVDLRYPHGLAVAWAEEADND---
FTSQ_BORPE      PHGLPGALPFAARIQRFVQAWPVVSSRLE--GRTVTQADLRYPTGFALALAPLPPEHASH
FTSQ_BURPS      --------TLPDRIQRLVAAWPSVTQRW---GGDIEYADLRYPNGFAIRAAGMRFLTDTD
FTSQ_NITMU      --------HLEKRLERYVQTHDLVVARL---NQRLSYVDLRYVSGFAARGTR--------
FTSQ_NEIG1      --------NEMKRLRLFTEAWQHLLRKN---KNRLSYVDMRYKDGFSVRHAPDGLPEKES
FTSQ_NEIMB      --------NEMKRLRLFTEAWQHLLRKN---KNRLSYVDMRYKDGFSVRYASDGLPEKES
FTSQ_RHIME      ---VARAMSVLAGMQDTHQLLERDIAAVDLRLEDRTTVQLTPEAVKRREVALKAREKMLK
FTSQ_AGRFC      ---LPQALQLLARLDLEEKVLSRDVAAVDLRLTDRTTIQLTEGAAERRQTAVDARTKALK
FTSQ_BARBA      ---AIERLASFIEQGVAEDLFSRDISDIDLRLSDRITVSLSDEALTRRRAVVLEEERLLK
FTSQ_RICCN      ---FEEALKYVDALNKANKLFNQNYKVLDLRDKNKYYIEKY-------------------
FTSQ_RICFE      ---FEEALKYVDALNKANKLFNQNYKALDLRDKNKYYIEKY-------------------
FTSQ_RICPR      ---FETALKYIDALNKTNKLFNQNYKALDLRDRNKYYIQKY-------------------
FTSQ_RICTY      ---FEAALKYIDALNKNNRLFNQNYKALDLRDRNKYYIQKY-------------------
FTSQ_RICBR      ---FEEALKYIDALNKANKLFNQNYKQLDLRDKNKYYIEKY-------------------
FTSQ_CAUVN      ---EESALIQLDQLDQRQRILDMGFARIDLRDPEMVAVRPRDAVLPGQPAADGA------
FTSQ_CAUVC      ---EESALIQLDQLDQRQRILDMGFARIDLRDPEMVAVRPRDAVLPGQPAADGA------
FTSQ_ZYMMO      ---AEAALVRFSHINREHHLLERGYVKFDMRVPGAPITARISPEPVKKATKPAKAADPLV
FTSQ_NOVAD      ---AASALLSFARMDGVNRLLGGKVAAFDMRAPDRIYMRVPGHADEVAAEKRAEEQARAE
FTSQ_RHOS4      ---PVAAVERMIALDEAEDLLDRDVISVDLRIKDRPVLRLAPYALNAVRRARGIDTSGSD
FTSQ_PARDP      ---ALQALERAIALNGALHMLDRDISVVDLRQEARPVVRLGLEAQNAIRQARGQPELGPD
FTSQ_DINSH      ---AELALARVIELDQAEDLFARDISVVDMRLPDRPTVRLNPDALDALWTIRGLTNDRIE
FTSQ_JANSC      ---AAAALDRVLALDDMGEILSRDVTAVDVRNPGRLTVRLTDAAMEELQRLQTLAAERPD
FTSQ_ROSLO      ---PVEALDRVIALDTAQDILSRDVNRVDLRLGARPTVKMSDYATNVWWEI--RQVSRQ-
FTSQ_KETVY      ---AVAALQRVIAQEEAQQLLSRDVAVVDMRNDARQTIRMTQRARDALRSMPGRSAGRG-
FTSQ_MYCTU      ----RVVIWGTTD---RCEEKAEKLAALLTQP--GRTYDVSSPDLPTVK-----------
FTSQ_MYCBO      ----RVVIWGTTD---RCEEKAEKLAALLTQP--GRTYDVSSPDLPTVK-----------
FTSQ_MYCLB      ----RAVIWGSTD---RAEEKAEKLAALLTQP--GRTYDVSSPDLPTVK-----------
FTSQ_MYCS2      ----RVVVWGTDD---RTQEKALKLAALLTQP--GTTYDVSSPDLPTVK-----------
FTSQ_MYCA9      ----RTIVWGTTE---RTAEKAEKLGALLTQP--GRTYDVSSPDLPTVK-----------
FTSQ_STRCO      ----RTVSWGSGE---QGVRKARALTALMKATPDARHFDVSVATAPASSGS---------
FTSQ_STRCU      ----RSVAWGSGE---DGRAKARALTALMKAVPGARHFDVSVPTAPASSGS---------
FTSQ_STRVP      ----RTVFWGSGE---HGAVKARVLTALLKATPKAGHFDVSAPTAPASSGS---------
FTSQ_STRBB      ----RTVVWGSSE---RGAAKAKTLTALMKAVPDAERYDVSAPTAPAVTHS---------
FTSQ_CHLAA      ----QMIVFGRSE---RLERKLTILAYLLADGTPFTYLDLRPVNPFYQYRPDGSS-----
FTSQ_CHLAD      ----QMVVFGRSE---RLTRKLMILAYLLNDGTPFTYLDLRPMNPFYQNRTDGRS-----
FTSQ_GEODF      ---GVPVKLGSGDYSRKLDRLARIYKELQTQISVLEYIDLDYSDK---IIVKKV------
FTSQ_GEOSM      ---GVPVKLGNGGFGEKLTRLAGIYKELQPQMQALDYIDLDYADK---IIVKKV------
FTSQ_GEOSL      ---GVPVRLGNGGYEAKLARFVRIYGELREHMAAVEYIDCDYLDK---IIVKKG------
FTSQ_PELCD      ---GVPVRMGHDDYNSKLNRLEKIFPQLKTRLGLIDYIDTNVTRR---IIVKLDAGELRG
FTSQ_ANASK      ---GTEIRLGQGDLEEKLTRLHRVLSALDAEGERAEVLHLDNRRRPDWVAVRVAGRRGEP
FTSQ_MYXFH      ---GQEVRLGEGDSEVKLQRLARVRRELGARGLAAEIIHLDNRARPGWVAVKISSPASER
FTSQ_SALRD      ---ALPVHLGSGNVSRKLRTLRAFARQVLASSPDEPIERIDLRFDGQVVTRTRPLDG---
FTSQ_RHOM4      ---SVPVRLGREDFERRLRRLVAFWQQAVLTQPHKTFSLIDLRFANQIVVREEAHPSTQK
FTSQ_KORVE      ---AVLVHLGSQNFADRFHLYVTHLKEWRSQYQHLDSVDLRYDRQVILNPDSHPSA----
FTSQ_ACIC5      ---ELLLHFGYTNFAARYRNYASHIQTWEQLYPRLASIDLRYDDQVVLRMATPPAPPAKL
FTSQ_BRADU      ---VGNALAMLSRLDKEDKLFSRDIVAVDMRLPDRLVVQLSEDAAKAREEQFKDKKKKKA
FTSQ_RHORT      ----SAALDQLVQIDARDHLLSKNLSVIDMRLPGRLVVRLAEDGPVDPEAEIAGGKPARG
FTSQ_SHEON      ---------KMARIQRFITVYPLLAKQDK----PIARVDLRYDTGLAVGWGDAQTREPII
FTSQ_XANCP      ---ARARLQRFARVLPQLTDPQRPIARADLRYTNGFTVERRMENGESGMDKKPKPVPPAA
FTSQ_COXBU      ---------IDQRFEQFVHLYPKIIGANI---NRVEHVDLRYSNGLAIQWKN--------
FTSQ_THIA3      --------DSAATQTRLKQFMTLMPQLEARYGRSIDSVDLRYPNGFAVHLQGVDLPGMNK
FTSQ_HAHCH      ---------VEGRLHRFTVLFEKKLHQER---EKIASVDARYTRGVAVKWKADVTPEQG-
FTSQ_METMM      ------------PLENMQRFLKTMDLLGEEQVAMMASVDTRYPNGYAVTWKPDTPEIDWK
FTSQ_CORGL      ---------REIYWGSSENNHDKAVAMSTVLKREGQRWNISSPSMVTVR-----------
FTSQ_ALCBS      ---------YTTKLRRFVRLYRGVLNTDS---RQVARVDLRYADGMAVTWREQQS-----
FTSQ_ACISD      ------------TMNKLQRLSHLAQSDLKPVWSKISAIDLRYRNGLSIQWKNATPPKIVN
FTSQ_HIRBI      ---VDEALLAVYNLDEATGVLAEDSEVTRIDARDLERFAVGLGEARAAYDQSSQIDDKSG
                                                                            

FTSQ_ECOLI      QQ--NQAQAEQQ---------------------------
FTSQ_SHIDS      QQ--NQAQAEQQ---------------------------
FTSQ_SALTY      QQ--NQAQAEQQ---------------------------
FTSQ_YERPE      EPPINGQQNSNP---------------------------
FTSQ_BLOFL      AINNVSKGSHDYD--------------------------
FTSQ_VIBCH      NDD------------------------------------
FTSQ_ALIF1      N--------------------------------------
FTSQ_HAEIN      ---------------------------------------
FTSQ_ACTPJ      ---------------------------------------
FTSQ_PSEAE      TASAVQ---------------------------------
FTSQ_CELJU      LRAAAATTNATRNAPTHP---------------------
FTSQ_ALLVD      HPDRVAARAGNRR--------------------------
FTSQ_THISK      --------GGNAR--------------------------
FTSQ_BORPE      SKSKPAKKR------------------------------
FTSQ_BURPS      KGKK-----------------------------------
FTSQ_NITMU      ---------------------------------------
FTSQ_NEIG1      EE-------------------------------------
FTSQ_NEIMB      EE-------------------------------------
FTSQ_RHIME      AQEKRI---------------------------------
FTSQ_AGRFC      KAEKNT---------------------------------
FTSQ_BARBA      MLKAGSV--------------------------------
FTSQ_RICCN      ---------------------------------------
FTSQ_RICFE      ---------------------------------------
FTSQ_RICPR      ---------------------------------------
FTSQ_RICTY      ---------------------------------------
FTSQ_RICBR      ---------------------------------------
FTSQ_CAUVN      ---------------------------------------
FTSQ_CAUVC      ---------------------------------------
FTSQ_ZYMMO      SDRI-----------------------------------
FTSQ_NOVAD      AKRAASAKSDEG---------------------------
FTSQ_RHOS4      ---L-----------------------------------
FTSQ_PARDP      GTPLAPEATAGNAAKAKKKSG------------------
FTSQ_DINSH      ---------------------------------------
FTSQ_JANSC      GDTRG----------------------------------
FTSQ_ROSLO      ---------------------------------------
FTSQ_KETVY      ---------------------------------------
FTSQ_MYCTU      ---------------------------------------
FTSQ_MYCBO      ---------------------------------------
FTSQ_MYCLB      ---------------------------------------
FTSQ_MYCS2      ---------------------------------------
FTSQ_MYCA9      ---------------------------------------
FTSQ_STRCO      ---------------------------------------
FTSQ_STRCU      ---------------------------------------
FTSQ_STRVP      ---------------------------------------
FTSQ_STRBB      ---------------------------------------
FTSQ_CHLAA      ---------------------------------------
FTSQ_CHLAD      ---------------------------------------
FTSQ_GEODF      ---------------------------------------
FTSQ_GEOSM      ---------------------------------------
FTSQ_GEOSL      ---------------------------------------
FTSQ_PELCD      KG-------------------------------------
FTSQ_ANASK      DGRSSYAAGGGGGPQGRSSSLR-----------------
FTSQ_MYXFH      SGASMR---------------------------------
FTSQ_SALRD      ---------------------------------------
FTSQ_RHOM4      SAMGHE---------------------------------
FTSQ_KORVE      -AKPTAPAVAPAVEKPAVAKPAV----AKPTAHTSGRRH
FTSQ_ACIC5      DAKPASPAAHSHGRKAAHHKVRRVIRHAHPTHHATRRAR
FTSQ_BRADU      GDAA-----------------------------------
FTSQ_RHORT      APAGGQKPPPIVRKSEGRDA-------------------
FTSQ_SHEON      NDEKPR---------------------------------
FTSQ_XANCP      PHALVLNSLRLRTPLLTIPHSPFAIPGFKT---------
FTSQ_COXBU      ---------------------------------------
FTSQ_THIA3      TSNKTPQPAGRKD--------------------------
FTSQ_HAHCH      ---------------------------------------
FTSQ_METMM      AIAENYKNVMKERRI------------------------
FTSQ_CORGL      ---------------------------------------
FTSQ_ALCBS      ---------------------------------------
FTSQ_ACISD      GQFVVTIDDTSIAGGTKAKP-------------------
FTSQ_HIRBI      GA-------------------------------------