CLUSTAL format seed alignment for MF_00913

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

FTSW_DICNV      ------------------------------------------------------------
FTSW_HALNC      ------------------------------------------------------------
FTSW_FRAST      ------------------------------------------------------------
FTSW_ALLVD      ------------------------------------------------------------
FTSW_GEOSK      ------------------------------------------------------------
FTSW_GEOSL      ------------------------------------------------------------
FTSW_GEOMG      ------------------------------------------------------------
FTSW_GEOS8      ------------------------------------------------------------
FTSW_GEOLS      ------------------------------------------------------------
FTSW_LARHH      --------------------------------------MKAVWQGWW-------------
FTSW_NITSI      ----------------------------------------MIYQANN-------------
FTSW_AROAE      ------------------------------------MKFASTFAGFF-------------
FTSW_NITEU      --------------------------------------MMSPSTSAP-------------
FTSW_VARPE      ---------MNSAAAGATPNTRTSRFG-------------GWFRRARS------------
FTSW_THIK1      ---------------------MLERML-------------PFLGRKR-------------
FTSW_POLNS      ---------MNLKEKLFPE----NRLG-----------LNRFWNFSR-------------
FTSW_BURTA      MREPRHVPQLRASGRRFPQRGRRHRFGKRNDAMSWSDRLVSRFNGARDAGGGAAPRTAAR
FTSW_TAYEM      ------------------------------------------------------------
FTSW_NEIG2      ------------MGCIVCSDGIVCRLKFLPFAAGANRLAGGFLKISEV------------
FTSW_LEGPH      ------------------------------------------------------------
FTSW_NITHN      ------------------------------------------------------------
FTSW_COXBU      ------------------------------------------------------------
FTSW_HALHL      ------------------------------------------------------------
FTSW_ALKEH      ------------------------------------------------------------
FTSW_THISH      ------------------------------------------------------------
FTSW_THISK      ------------------------------------------------------------
FTSW_METCA      ------------------------------------------------------------
FTSW_METMM      ------------------------------------------------------------
FTSW_PSEFS      ------------------------------------------------------------
FTSW_HAHCH      ------------------------------------------------------------
FTSW_MARHV      ------------------------------------------------------------
FTSW_SACD2      ------------------------------------------------------------
FTSW_CELJU      ------------------------------------------------------------
FTSW_ALCBS      ------------------------------------------------------------
FTSW_HALED      ------------------------------------------------------------
FTSW_MARM1      ------------------------------------------------------------
FTSW_HYDCU      ------------------------------------------------------------
FTSW_THICA      ------------------------------------------------------------
FTSW_XANOR      -----------------------------------------------MAGAARDRAFLDH
FTSW_ECO57      --------------------------------------------------MRLSLPRLKM
FTSW_ECOL6      --------------------------------------------------MRLSLPRLKM
FTSW_ECOLI      --------------------------------------------------MRLSLPRLKM
FTSW_MOREP      ------------------------------------------------------------
FTSW_BUCAI      ------------------------------------------------------------
FTSW_BUCBP      ------------------------------------------------------------
FTSW_BLOPB      ------------------------------------------------------------
FTSW_WIGBR      ------------------------------------------------------------
FTSW_RIEPU      ------------------------------------------------------------
FTSW_HAEIN      ------------------------------------------------------------
FTSW_PASMU      ------------------------------------------------------------
FTSW_HAEDU      ------------------------------------------------------------
FTSW_AERS4      ------------------------------------------------------------
FTSW_TOLAT      ------------------------------------------------------------
FTSW_ALISL      ------------------------------------------------------------
FTSW_VIBVY      ------------------------------------------------------------
FTSW_PHOPR      ------------------------------------------------------------
FTSW_ALTNA      ------------------------------------------------MMTTANAPQANR
FTSW_PSEA6      ------------------------------------------------------------
FTSW_PSET1      ------------------------------------------------------------
FTSW_SHESH      -----------------------------------------------------------M
FTSW_IDILO      --------------------------------------------------------MSTV
FTSW_ACIAD      ------------------------------------------------------------
                                                                            

FTSW_DICNV      ------MSPRNSALERFRQHQKIPEKRWQRLAFPDVGLLLCWLALIVIGMVMVTSSSLSE
FTSW_HALNC      -----MNRTVQKLLPWLTASAQDVEKVRNESIRLDPILMVAVLALLAWGLVMVTSASM-E
FTSW_FRAST      ---------MLYRLKLLLSGQNTKKERVRAKLEIDISIVFVMLGLLIFGWVMVTSASMVV
FTSW_ALLVD      ------------MTAAAPSKPLPRTPRVRQAYPLDYPLLLCALGLLAFGWVMVTSASMSI
FTSW_GEOSK      ---------------------MNLGLNVKEIERYDLVILLMAVALTCFGVVMVYSASSVM
FTSW_GEOSL      ---------------------MNLGLNVKEIERYDLVILLMAVALTCFGVVMVYSASSVM
FTSW_GEOMG      -------------------MNLNFKLNLKEIERYDLVILLMAVALTCFGVVMVYSASSVM
FTSW_GEOS8      ---------------------------MRRVEGYDMIVLMMAVILTCFGVVMVYSASSVM
FTSW_GEOLS      --------------------MLEILRKPFRLAEYDLVLLLMVVALTSFGIVMVYSASSVM
FTSW_LARHH      ------RRGRVVARSLQGPVRSPAGLGEPRFRTFDEPLAWVIVALLTIGLVMVYSASIAY
FTSW_NITSI      ------QKQRVLA-------------------DFDQALVWSVVLLLSIGLIMIYSASIAI
FTSW_AROAE      ------ATRRENGGTQTSRAVDRLMRPADSLRELDPLLIWSATGLLLIGLVMVYSSSIAT
FTSW_NITEU      ------HNQPIQP-------------------ELDVLLVSTVLLLLGLGLVMVYSASIAI
FTSW_VARPE      ---GIDSLPVHLPVRLGGAGIAQTKATPMRVLGFDQALVWVTVALLTWGLVMVYSASIAL
FTSW_THIK1      -----DKAAADLPVRVGHSAPRNS-----RMLEYDQNLVWVTLLLLAYGLVMVYSATISF
FTSW_POLNS      --GGIDNFRTGLRDAVSGVEQTRS-----RMMEYDQLLVWAILSLMLIGLVMVYSASITL
FTSW_BURTA      AASGARAAAGGLASVVNGARPTRS-----RMLDFDYSLLWVSIALLGLGVVMVYSASIAM
FTSW_TAYEM      -----------------------------------------------MGLIMVFSSSIAL
FTSW_NEIG2      ----LVKVGDGVHTLLLDRPIVRDG------RKFDAPLLWMVVLMTAFGLLMIYSASVYL
FTSW_LEGPH      -----------MNTMRPRHLNQRGKPVSRPISLYDKWLIGAVFGLLIIGLMMVASSSVMI
FTSW_NITHN      ---------------MSRFFSTR-QAVGGSTPQPDLYLLGAAVALMGLGWVMVGSASVAI
FTSW_COXBU      -------------------MQKK----STISWSYDAWIVICTLSLLALGLLMVASASMVI
FTSW_HALHL      -----------MADLAAGVAERGPRLS--LWSSLDQRLVWVVAATALLGLVMVASASISM
FTSW_ALKEH      -----------MAEVLRWLRLDLGQSGGLAWERLDWRLALTVLALAGLGLVMVGSASVSI
FTSW_THISH      ----------MSAVDIQATRDAGQQLQVRLAQRLDLGLTLSVLALLGLGLVMVASASIGI
FTSW_THISK      -----------MSTGSLPLGLPSRDSLDGLRNSVDLPLLAAAALLLGLGLIMVASASMDL
FTSW_METCA      -----------MSTQAIRGARGLVLKWGAGRFYLDTVLLSVSLGLMLFGFVMVSSASLHL
FTSW_METMM      -----------MSAAAPK-------PRPAHRFHIDQTLLSVCLCLLGIGFVMVASSSMHL
FTSW_PSEFS      --------MSIDFRNIIKPYPSPIITGRGIDLDF--PMLAGCLALLGLGLVMITSASSEV
FTSW_HAHCH      ---------------MSALTLTASKNTQTMTLDL--PLLGSALALAAIGLIMVTSASVDF
FTSW_MARHV      ---------------MQAGVSVPHYQGMAGELQPLPVLIITSVALLVTGVVMISSASMDM
FTSW_SACD2      ---------------MIVNIASPLYGSVQGFRRLDFSLYATVAILISVGIVMVASSSLDF
FTSW_CELJU      -----------------MSLSAIPNHQLPLSLRIDWTLLCLWLALMSIGLVMVASASVSF
FTSW_ALCBS      --------------------MTERMILKVDHTGIDKPLLWTAILLALAGLVMVSSASLQI
FTSW_HALED      ----------------MSRLARLREQLSTRDHFCDGWLLVATLSLMLIGWVMVTSASTEV
FTSW_MARM1      --------------MKIQLRDIFEPLSANHMAKVDLWFVMSLIAILALGIVMVASASISV
FTSW_HYDCU      -------------------MPIRDWRQQSQRWPIDYWLIGALAILITLGLTMVASSSIAI
FTSW_THICA      --------------------MANTWRLDIR--GLDGSLVLIVLALITIGLVMVLSSSVAV
FTSW_XANOR      FGGAGADRPCHVEGALMNDMSRQATRLDAIGGRYDPWLLGAAVTLASLGVVMVASSSIEL
FTSW_ECO57      PRLPGFSILVWISTALKGWVMGSREKDTDSLIMYDRTLLWLTFGLAAIGFIMVTSASMPI
FTSW_ECOL6      PRLPGFSILVWISTALKGWVMGSREKDTDSLIMYDRTLLWLTFGLAAIGFIMVTSASMPI
FTSW_ECOLI      PRLPGFSILVWISTALKGWVMGSREKDTDSLIMYDRTLLWLTFGLAAIGFIMVTSASMPI
FTSW_MOREP      ----------------------MHKTEAQTYLLYDRTLLLLTMGLVGIGLVMVISTSMPI
FTSW_BUCAI      -----MKHLQKKNSKNPKKIEEKYNTRNSYFILYDRALVWLTLGLFSVGLIMVISTSIPI
FTSW_BUCBP      -------------------MKTKLNIK-----LYDEKLLWCTLCLLLIGVTMVTSSSIPI
FTSW_BLOPB      -----MRLFKTKIINRPLKLGKKKSSN--IHVLYDRIFFWLLLGLIGIGFVIISSGSIPT
FTSW_WIGBR      -------------------MNNKKKIV--KIFFYDKILFFLLISLSIIGIIIVSSASISF
FTSW_RIEPU      -------------------MKKSH--------LYNRSLLSVTIILLIFSIIMVGSSSVSV
FTSW_HAEIN      ----------MEFLQNIKKNYDEWTRITPQGLLYDRALFWLFVILLLIGLVAVTSASIPY
FTSW_PASMU      ----------MPFLDKVKQQYEDWTRITPSNLLYDRALLLLFFVLLLIGLLAVSSASIPV
FTSW_HAEDU      -------MYGLEMLEKIKLEYDKWACLTPKNSLYDRTLVWLFLSLLMIGFIMVTSASIPV
FTSW_AERS4      ----------MSALRSVAGLLQRWLLPARPAGLYDRQLVVLALALMAVGLVIVASASIPE
FTSW_TOLAT      -----------------MAAVWRWFVPERPS-FYDRGLLALTFSLMGIGLMMVASASIKE
FTSW_ALISL      --------MVIERIKHLASPLQDWVFTPSPKVMFDRQLIWIALGLMLTGLVMVASASFPI
FTSW_VIBVY      ----------MVMVGNIKNNLFGWFRHSPPDALFDRQLVWIALCLMLTGLVMVTSASFPI
FTSW_PHOPR      ---------MLSQAKNGASIVGEWLTKPPAPCLYDRQLVWITLSLMITGLVIVTSASVPV
FTSW_ALTNA      ALKTKDTSQADTKLSALFAARHDEQ---NLQSPYDIGLIIVALALMTIGIIIVTSASMPV
FTSW_PSEA6      ----MNTSTFATPLRAMFAQRHDAAP--AVVRPYDVSLILLALSLMAIGLVIVTSASMPV
FTSW_PSET1      -------MCYGGTAMMAFADIKEALTPKPSAQLYDVPLLYCMLMLMGVGFVMVTSASMPT
FTSW_SHESH      RSEERQLNLFGTSVNWSWPNLFKERE-APGMQLYDRALLFAVLSLICFGFVMVMSASMPE
FTSW_IDILO      REEQLNLEIPASDVGSRWQKLINWFQPKASQPLYDRMLFTLAMALLAFGFVMVTSASLPT
FTSW_ACIAD      ----MMAGFAQTTITKINQFYERWMPRLPAEMTARNVLVFCVVCLLCIGSVMVASASMPY
                                                                .   : * :   

FTSW_DICNV      AHVERLST-----HHFAIRQGIFYV-GSSIFAYIAFMLGTNFYREKAKFILGLAFLGLLL
FTSW_HALNC      LGERFGNP-----FFFVIRQTIAVVIGASITVWLVLRQPIALWVEYKLWILIASLLLLLV
FTSW_FRAST      ALDDYNNP-----YFYSIRQGFFAV-IAIFLFLLALLVPTKNYEKNYNAFFFIMLIVLVA
FTSW_ALLVD      AEACCQNP-----FHYSIRHAIALG-LALMLGLMAYSVPSHWWERHGVWLFLASALVLIL
FTSW_GEOSK      ATKKFHDG-----FYFLKRQGVYAL-LGFGVMAVAMRIDYRTWREYAVPILLGCLFLLFL
FTSW_GEOSL      ATKKFHDG-----FYFLKRQGVYAL-LGFGVMAVAMRIDYRTWREYAVPILLGCLFLLFL
FTSW_GEOMG      ATKKFHDG-----FYFLKRQGIYAI-LGCAAMIVAMRIDYRQWREYAVPILLGCLLLLLL
FTSW_GEOS8      AAKKFHDG-----FFFLKRQSLYAL-IGFIGMGVAMHVDYHVWKKWAVPLFLGTFFLLLL
FTSW_GEOLS      AAKNFHDG-----AYFLKRQLIFAL-VGCVGALVTMRIDYQLWRRWAVPLLFVSLILLVL
FTSW_LARHH      AD-ADRAT--HSRFYYLIRHALSLGVALGA-GWCVFRVPTRIWQRWAPKIFLLAIVLLAL
FTSW_NITSI      AE-AQFGA--DRASYYLLRHSAYLAVGLLL-GLVTFQVPMRIWQKYVTYLFMISVLLLAL
FTSW_AROAE      AEGSRFTG--HQSHYFLLRHAMFLAVGIGA-GLAAFQLSMRQWQRFAPWLFLIGVMLLVV
FTSW_NITEU      AE-AKFGE--GSSYYFLARQASYILAGIAV-GIGCFRIPLRWWQAYSHYLLGLGILLLLV
FTSW_VARPE      PDNPRFARAGYGASFFLTRHAASVAFAFIA-ALLAFQIPMKTWERAAPWLFVVSLLLLVA
FTSW_THIK1      HDSPRYAQ--WSPYHYFIRDLFSIAAALLA-SWIVVQIPMAELQKWSMRFFFLSLIGLVL
FTSW_POLNS      ADGPKYAN--YSSNFFLIRHMISLAIAIGV-GIWAFKIPTKVWDRYSPVIFGITVLLLIA
FTSW_BURTA      PDSPKYAS--YHDYAFLLRHCVSLVVAFVA-AVIAFRVPVSTWDKYAPHLFLIALVGLVI
FTSW_TAYEM      GDGPKYVN--AGRYYFFSRQLIFILIGLFA-MAFTFLMPMKFWDSKAFWGYCICFLLLAL
FTSW_NEIG2      AS--KEGG---DQFFYLTRQAGFVVAGLIASGFLWFLCRMRTWRRLVPWIFALSGLLLVA
FTSW_LEGPH      STKYFHQP-----FHFLIRQACYLFVGL-LLALIVVRTDSSFWEKISMPMMIGCVFLLLI
FTSW_NITHN      ADSRFGQP-----TYYLWRQGLFLLLGL-VTAFGVWRIRLAFWEKLGPVMLLLGLGLLLL
FTSW_COXBU      SDRQFGYP-----FHYFIRHLIYLSLGL-TLAWVASRVPIKVWKTYSGYLFLVGFLLLIL
FTSW_HALHL      AEQATGDP-----FYFFKRQIFFALLGL-GMALALLQIPLATWERAGPGLLLGALALLVL
FTSW_ALKEH      AEGATGDP-----LHYLYRQAVFLAVAL-MAAVACLHLSLDQFYRGGPVLLVLGFFLLLV
FTSW_THISH      ADRNLGDP-----LYFLKRQAAYVVLGL-AAASLAYRIRLAYWEASAGLLLGFAYFLLIL
FTSW_THISK      GERYYGNT-----WHFFQRQVLFAAIGL-ALATVMWAIPLERWERAGPWLLILVMVLLIA
FTSW_METCA      GEKMASDS-----FYFPKHQLVHILLGL-AAGWGAARVRLDTLERHSRSLFWAGIALLVL
FTSW_METMM      GVKMADDV-----SYYPFKQLVHIILGL-MFAAAILAIPMKYWQKIGQPLFIVGLVLLLV
FTSW_PSEFS      AAVQSGNT-----LYMMIRHLVYLVIGL-GACIVTMMIPIATWQRLGWLMLIGAFGLLIM
FTSW_HAHCH      ADDANGQA-----LYYMWRHLTYLLAGV-AVGFVILRLPLEWWHKQSWLLLVVALGFLVA
FTSW_MARHV      AAATLGNS-----YHYVIRQILFAGLGC-ATALVAVNVPVSWWERSGWLLLGIGLLVLVL
FTSW_SACD2      AAERYHDT-----WFFVRKQITFLAMGL-VGGLVILAVPMSVWNKYSGLLLILAFFLLMA
FTSW_CELJU      AAVTYDDA-----WFFAKRHVVYMVMGM-VLALFVVCIPTSVWQAYAGPFLLITLFLLVV
FTSW_ALCBS      AETRLGDP-----FYYAMRHGIYLALGLGVGAFVYYAVPLALLERLRFVMLPVALVALVM
FTSW_HALED      ATSLTGNP-----WYFSVRHGVFVLCSM-VVALLVLRIPMAWWKANGPLLLLVGLALLAL
FTSW_MARM1      SESIHNTP-----YFFMGRQILYLILGV-SFGFMMLQIPTQNLQKWGILLMLLSLVLLVL
FTSW_HYDCU      SEKRFGDP-----THYLLRQMFSMGLGL-MAAYIVLKIPLSFWRKHRGQLFIVGLVLLVL
FTSW_THICA      SEVRFGHQ-----WHYFQRQVFALGVGG-LFAALVLMVPSQSWLQHRGKWFLLGLVLLAL
FTSW_XANOR      E----ASP-----FYYLTRHLLFLGGGI-ALAFWAMRTELKTIEQHNQMLLLACFVLLVV
FTSW_ECO57      GQRLTNDP-----FFFAKRDGVYLILAF-ILAIITLRLPMEFWQRYSATMLLGSIILLMI
FTSW_ECOL6      GQRLTNDP-----FFFAKRDGVYLILAF-ILAIITLRLPMEFWQRYSATMLLGSIILLMI
FTSW_ECOLI      GQRLTNDP-----FFFAKRDGVYLILAF-ILAIITLRLPMEFWQRYSATMLLGSIILLMI
FTSW_MOREP      GVRLSEDP-----FYFARRYAFYLGLAV-VLSLVTLGIPMASWQRGSSLILLITLIMLLL
FTSW_BUCAI      SQKIYHNP-----LFFIKREIFYFFLIF-LLSFIFLRTPIIFWEKNSNIILIISIVLLVL
FTSW_BUCBP      AYRIYHDM-----LFFTKKQILYLVILF-FIFKIFLDVPISFWQKNNKIILLISISTLLL
FTSW_BLOPB      GMRLANDP-----CYFIKRVIVYYSVTF-LLSVIILKIPIIVWQNYSAIMLLCSCIMLIT
FTSW_WIGBR      GIRLHNDY-----FYFAKRNLLYFFLSF-FLFFQIIRIPINQLEKYNKIALLINLFLLII
FTSW_RIEPU      GNRIRTDY-----LSFLKKNFIHSIISI-LCMIFVFNVPIYKWKKNKNKLILCSIILLLT
FTSW_HAEIN      SSRLFNDP-----FYFAKRDAIYVLLSL-LTCYISLQISSSQWEKWHAKIFLFSVILLLL
FTSW_PASMU      GTRLFKDP-----FYFAKRDAIYVFLSC-VTCYLCVQVPMEKWEQWHVRLFAFAIFLLIL
FTSW_HAEDU      STRLNNDP-----FHFAIRDSIYLACSL-LAFAFVVKIPMRNWEKYNVPLFLLSLLFLAS
FTSW_AERS4      GIAINNDP-----FMFVKRHGLFLVMAL-GISWFVLQVPMARWQHYNGPMLVLAILMLVL
FTSW_TOLAT      GPG--GDM-----FYFTKRHLIFLFVCL-GIGVGTLYLPLERWREWSGRLLVGALGLLFA
FTSW_ALISL      STRLTGQP-----FHFMMRHMLFVFLAL-SISSIVLRIELNKWLKYSSHLLLISLLLLAA
FTSW_VIBVY      SSRLTDQP-----FHFMFRHATFLCLAL-GTSAVVLQIPLQKWQSHSHYLLGIAFALLVV
FTSW_PHOPR      ATRLTGIP-----FYFALRHAFFLVCSL-VIIAGVVQVPLSRWKQFSVPMLFLSIVLLII
FTSW_ALTNA      AERIHDNP-----FYFAIRHGIYIVGAI-IAAMVVLELPMQFWRTANPYLLLAAIGLLVA
FTSW_PSEA6      ASRLFDNP-----FHFAIRHGIYIVLAI-GAALTVMQIPMQWWRTSNAWLLLLGLVLLIA
FTSW_PSET1      ADRLFGNI-----YHFTIRHGIFLALSF-CLFWITTSVPMSWWKKANPYLLLVGLGLLLI
FTSW_SHESH      AQSLTGNP-----YHFAIRHFAYLVGCA-VIAAVVLRIEMSRWQQFSPLLLLIVGIMLVA
FTSW_IDILO      ADRLTGNP-----FHFAIRHGIYILISL-AVMLATLRVPANSWNQQSGKLLLLGLIMLLM
FTSW_ACIAD      AEYMHENP-----FHYVVRHAISIATAA-IVAYLVYKVPLNVWFKNTFSFWLITILLLLA
                                  :                                      *  

FTSW_DICNV      VYAPGIGVVVNGSRRWLNL-GV-INLQVGEFAKLAVFIFTAAYLQHHTQRLDHSW-----
FTSW_HALNC      VLLPGIGHSVNGANRWIPL-GP-VNIQVSEFARLGLIIWMAGYIATHTIKLQNRI-----
FTSW_FRAST      VLVPGVGKSVNGARRWIPL-II-INIQVAELAKLLAIIFFSGYIAENLPKMTNFK-----
FTSW_ALLVD      VLIPGIGRTVNGATRWIPL-GP-LNVQPSEFVKLFAILYVAGYLVRHADKVVNQL-----
FTSW_GEOSK      VFIPGIGGAAKGASRWIRL-PG-FNFQPSELTKIALIVYMAYSLDKKQDKVKFFS-----
FTSW_GEOSL      VFIPGIGGAAKGASRWIRL-PG-FNFQPSELTKIALIVYMAYSLDKKQDKVKFFS-----
FTSW_GEOMG      VFIPGIGGAAKGASRWIRF-PG-FNLQPSELAKIALIMYMAYSLDKKQEKVKFFS-----
FTSW_GEOS8      VFVPGIGGTAKGASRWIRL-PG-FNFQPSELAKVALIMYMAYSLEKRQDKLKQFM-----
FTSW_GEOLS      VLIPGIGGKVKGASRWIRL-PG-FNLQPSEFTKIALIMYMAYSIDKKQDRIRLLS-----
FTSW_LARHH      VLVPGIGKVVNGSRRWISL-GF-MNLQPSELMKLAVVVYAADFTSRKAVYLQGFFLESL-
FTSW_NITSI      VLVPGIGHEVNGSQRWISL-YV-VNIQPSEFVKLFMVMYAADYVSRKAADLNSFL-----
FTSW_AROAE      VLIPGVGREVNGAQRWLPL-GP-LNLQPSELMKLFVALYAADYTVRKLPDMGSFR-----
FTSW_NITEU      VLIPGISHEINGSRRWIPL-GI-TSFQPSELMKLIILIFTADYVVRKAAFKDHFF-----
FTSW_VARPE      VLIPHIGISVNGARRWLPM-GF-MRFQPSELAKVAMVLYAASYMVRKMEIKERFF-----
FTSW_THIK1      VLLPHIGKDVNGSKRWVVFPGG-LNFQPSELVKLTALIYAADFMVRKQEVKQSLL-----
FTSW_POLNS      VLIPGVGRGVNGAKRWIPL-GL-MNFQSSELMKFAAVIFAASYTVQRQEYLHSFV-----
FTSW_BURTA      VLIPHIGKGVNGARRWIPL-GI-TNMQPSEIMKLAVTIYAANYTVRKQEYMQSFA-----
FTSW_TAYEM      VLVPGIGREVNYAYRWIPI-GP-FNFQPSEFAKLTMIVFTSAYTVRKQKSIHGL------
FTSW_NEIG2      VLIA--GREINGATRWIPL-GP-LNFQPTELFKLAVILYLASLFTRREEVLRSMESLGWQ
FTSW_LEGPH      VLIPGIGKSVNGSRRWLALGP--IGVQVSELTKLAMIFYLSGYLVRQQEAVCESI-----
FTSW_NITHN      TLIPGIGVEVNGSRRWLALGP--IRLQPSELAKLFMVIYLSGYLVRRS-AEVRTI-----
FTSW_COXBU      VLAPVIGKTVNGSRRWIQLGF--ISLQVSEVVKFVTILYLASFLQRYQSEVQKEL-----
FTSW_HALHL      VLIPGVGREVNGAVRWIPLGV--FNLQVAEVVKVLLALYLAGFLVRRQQQLRTSM-----
FTSW_ALKEH      VLIPGVGREVNGATRWIPLGL--INLQVAEVARVCFIIYLAGYCVRRHAELPNTS-----
FTSW_THISH      VLVPGVGVTVNGSTRWLSLGL--FNLQVSEVAKLLFTLYLAGYLTRHGRAVREQF-----
FTSW_THISK      VLLPGVGRTVNGATRWIPIGM--FNLQVAEPVKLLVVMYLAGYIVRHYSALRLHL-----
FTSW_METCA      VLIPGVGKSVNGSVRWINLFG--LRVQVSEVFKLVAAIYVAGYISRHLDTVRTSV-----
FTSW_METMM      VLIPGVGVKVNGSTRWLSLLG--LRIQVSEVMKFISVVYMAGYITRHSDHVRHSI-----
FTSW_PSEFS      VILPGIGREVNGSMRWIGFGA--FNVQPSEIAKVFVVIYLAGYLVRRQKEVRESW-----
FTSW_HAHCH      VLIPGIGRTVNGSTRWISLGV--INIQASEIAKVCLAIYTASYLVRRLDEVRGSW-----
FTSW_MARHV      VLTP-LGRTVNGSTRWIPMGL--FNVQVSEVAKLCLIAYLAGYVVRRREELLHTW-----
FTSW_SACD2      VLIPGIGKVVNGSRRWLSLGP--FSMQASEIAKFCLIVYFASYLARRNEELRTQW-----
FTSW_CELJU      VLIPGIGKRVNGSQRWLSLGI--ISVQVSEIAKFCAVVFFASFFARRYQELHFGW-----
FTSW_ALCBS      VFIPGLGRTVNGSTRWIALPG--LTIQASEIVKLCFVLYLAGYVAQRKAALETEW-----
FTSW_HALED      VLVAG--REVNGSRRWLSVPGIPLNLQASEIAKLCLIVYLAGYLERFLPQVRRHW-----
FTSW_MARM1      VLVPGIGKTVNGSRRWINLIV--FNLQASEVAKVCMVVYVSGYLVRRAERVRENL-----
FTSW_HYDCU      VLV--FGREINGSKRWLPLVL--MNFQVSEFMKIAVVVFMAGYLDRHATAVRESF-----
FTSW_THICA      VLI--FGREIGGAKRWLPLVV--MNFQPAEWMKIATILFLAGYLQRHQDAVKQDS-----
FTSW_XANOR      VFVPGLGSTVNGAKRWINLGV--SRFQVVESVKVFYIIWLASYLVRFRDEVNATW-----
FTSW_ECO57      V--LVVGSSVKGASRWIDLGL--LRIQPAELTKLSLFCYIANYLVRKGDEVRNNL-----
FTSW_ECOL6      V--LVVGSSVKGASRWIDLGL--LRIQPAELTKLSLFCYIANYLVRKGDEVRNNL-----
FTSW_ECOLI      V--LVVGSSVKGASRWIDLGL--LRIQPAELTKLSLFCYIANYLVRKGDEVRNNL-----
FTSW_MOREP      V--LIAGQSVNGAVRWLALGP--WRIQPAELSKLALFCYLASYLVRKAEEVRTNF-----
FTSW_BUCAI      V--LLIGHSIHGSFRWINIGF--LHIQPSEICKISSFCYLASYLSRKSNEVRNNF-----
FTSW_BUCBP      V--LIIGNSIHGSLRWITISY--VSMQPSELSKLAMFCYLSNYLSQKNSEIVNNF-----
FTSW_BLOPB      A--LILNNSTNGASRWIMWGT--LCIQPAELSKLSFICYLANYLERKSKEVCTKF-----
FTSW_WIGBR      V--FIIGNSINGAIRWIKIGF--FSIQPSECSKLILFFYISDYIVKKNKELKNKL-----
FTSW_RIEPU      L--NYFGISNHGAKRWINIKI--AFIQPSELVKISFSCYLSSYLSEK-----NKK-----
FTSW_HAEIN      V--PFIGTSVNGAKRWISLGI--LNFQPAEFAKLALTCFLASYFTRRYDEVRSRH-----
FTSW_PASMU      VLIPGIGLSVNGARRWIPMVL--FNFQPAEFAKLALTCFLASYFTRKYDEVRSRK-----
FTSW_HAEDU      V--LIFGRSVNGSIRWIQLGP--INFQPAELSKLAIICYFSSFYVRKYDEMRNRS-----
FTSW_AERS4      V--LLVGRSVNGSIRWLPLGP--FNLQPAEFGKLALFVYLAGYLVRRQSEVRERF-----
FTSW_TOLAT      V--LAVGRTVNGAKRWIGFGF--FNIQPAELAKLALIVFIASYLVRRSDEVRGNI-----
FTSW_ALISL      V--LVVGKSVNGAARWLPLGI--FNLQPAEVAKLSLFVFIAGYLVRRHGEVRDSF-----
FTSW_VIBVY      V--LIAGKSVNGASRWIPLGL--FNLQPAEVAKLALFIFMSGYLVRKQDEVRATFF----
FTSW_PHOPR      V--LLIGRSVNGAARWIPLGI--FNLQPAEVAKLSLFIFLAGYLVRQYSQVRASF-----
FTSW_ALTNA      V--LLVGRTVNGSTRWLALGP--ITIQAAEPAKLFFFTYLAGYLVRRYEEVTENL-----
FTSW_PSEA6      V--LLVGRSVNGSTRWLAIGP--ITIQAAEPAKLFFFCYLAGYLVRRYEEVTENI-----
FTSW_PSET1      V--LIVGREVNGSTRWIPIGP--FNIQASELAKLFFFSYISGYLVRKRSEVQENI-----
FTSW_SHESH      V--LLVGTSVNGATRWLSVGP--IRIQVAELAKFAFTIYMAGYLVRRHQEIRENA-----
FTSW_IDILO      V--LVVGYEVNGAQRWIKVGP--ITFQAAEVAKLFFCIYMASYLSRREDEVREAT-----
FTSW_ACIAD      V--LVIGTEVNGSRRWIRLAG--FTLQPTEVAKVMMAIFTADYVVRRAKEVRTHW-----
                            : **:        .*  *  :.    : :                   

FTSW_DICNV      -----------------------------QPIIGLLAVTACFALMFYLQPDFGTMVVIVA
FTSW_HALNC      -----------------------------TGMLGPGVVIFAASLLLLLQPDFGTTAVLAA
FTSW_FRAST      -----------------------------EGILTPITLLGCIAVLLLMQPDFGSTVVISI
FTSW_ALLVD      -----------------------------SGFIRPLILIGAAALLILMQPDFGTTAVMLA
FTSW_GEOSK      -----------------------------TGFLPYMVLLSVVLLILLKQHDLGAALTMGL
FTSW_GEOSL      -----------------------------TGFLPYMVLLSVVLLILLKQHDLGAALTMGL
FTSW_GEOMG      -----------------------------TGFAPYMVLLAILLAILLKQHDLGSALTMGG
FTSW_GEOS8      -----------------------------SGFFPYMLILGVFIAVLLAQHDMGAALTMLA
FTSW_GEOLS      -----------------------------AGFLPYMVVLMILLGLLLKQPDMGAALTLAA
FTSW_LARHH      ----------------------------WKGFVPMAGAIVLVGGLLLAEPDFGAFAVVAV
FTSW_NITSI      -----------------------------KGFLPITVVLSIVGFLLLLEPDFGAFFVVTA
FTSW_AROAE      -----------------------------RGFLPMAAMILLVGFLLLGEPDFGAFVVITA
FTSW_NITEU      -----------------------------KGFLPILALLTIVSLLLLMEPDLGATVVIAA
FTSW_VARPE      -----------------------------RAVLPMGIAVVVVGMLVMAEPDMGAFMVIAV
FTSW_THIK1      -----------------------------KTFLPMMAVMMIVGVLLLAEPDMGAFLVIAS
FTSW_POLNS      -----------------------------KGMLPMGIAVALVGGLLMAEPDMGAFVVVAL
FTSW_BURTA      -----------------------------KGFLPMAFAVGLVGALLLLEPDMGAFMVVAA
FTSW_TAYEM      -----------------------------KGFLPIIIYLGIICFLLINEPDLGATMVVVA
FTSW_NEIG2      SIWRGTANLIMSATNPQARRETLEMYGRFRAIILPIMLVAFGLVLIMVQPDFGSFVVITV
FTSW_LEGPH      -----------------------------FGFIKPMAILAVVSVLLLLEPDFGATVVISG
FTSW_NITHN      -----------------------------RGFLFPVGVFAMAGLLLLLEPDFGAVVVLFA
FTSW_COXBU      -----------------------------KGFLKPMLLVGILSGLLLLEPDFGAAVVITM
FTSW_HALHL      -----------------------------AAFLVPVLVSAACAFLLLLQPDFGTALMLMA
FTSW_ALKEH      -----------------------------SAFAVPLAVFSLAAVLLLAQPDFGTALVLMA
FTSW_THISH      -----------------------------AGFLRPMLLLSGAALLLLMEPDFGAAVVLMA
FTSW_THISK      -----------------------------RGFVRPLVVLGFGTVLLLLQPDFGGAAIMLA
FTSW_METCA      -----------------------------KGMIFPLSLLAIGAVLLLKEPDFGATAVVMA
FTSW_METMM      -----------------------------FGLLRPLMLLSVASILLLLEPDFGSAVVILI
FTSW_PSEFS      -----------------------------MGFFKPFIVLLPMAGLLLMEPDFGATVVMMG
FTSW_HAHCH      -----------------------------WGFAKPLLVLMLVALLLLMEPDFGALVVTMC
FTSW_MARHV      -----------------------------PGFLKPLGVLGVASVLLVIQPDFGATVVLVT
FTSW_SACD2      -----------------------------SGFLKLTAVLLIIVLLLLLEPDFGSSVVISA
FTSW_CELJU      -----------------------------QGFLKPLLVVGVFVGLLLLEPDFGSSVVLSA
FTSW_ALCBS      -----------------------------KAFLLPLGLLGVLMLLLLLEPDFGAVVVLGI
FTSW_HALED      -----------------------------GAFLRPLMVMAVMGVLLIFEPDYGAVVVMTG
FTSW_MARM1      -----------------------------IGFALPLFLTSLFLIFLLMEPDFGASVVLIG
FTSW_HYDCU      -----------------------------EAVIRLALPFGVMAILLLLEPDFGSTFVIAV
FTSW_THICA      -----------------------------TAVIRLFLPFGIMAGLLLLQPDYGTTVLIAG
FTSW_XANOR      -----------------------------QAMLKPVFVVGLLVGLLLLQPDFGSSMLLLS
FTSW_ECO57      -----------------------------RGFLKPMGVILVLAVLLLAQPDLGTVVVLFV
FTSW_ECOL6      -----------------------------RGFLKPMGVILVLAVLLLAQPDLGTVVVLFV
FTSW_ECOLI      -----------------------------RGFLKPMGVILVLAVLLLAQPDLGTVVVLFV
FTSW_MOREP      -----------------------------WGFCKPIGVMVLLAILLLAQPDLGTVLVLFI
FTSW_BUCAI      -----------------------------WGFFKPMSVIITQSMLLLAEPDLGTVVVLFF
FTSW_BUCBP      -----------------------------GGFLKPIIIISFPLILLLVEPDLGTTIVILL
FTSW_BLOPB      -----------------------------WSICKPIVIMIILAVLLLAQPDFGSIIILFI
FTSW_WIGBR      -----------------------------WGFLKPIIIMLIFVILLLMQPDLGNSLILFL
FTSW_RIEPU      -----------------------------TSTIQLISIILIVSKLLLSQPDFGTLVILYS
FTSW_HAEIN      -----------------------------VSIFKPFIVMLVLGCFLLLQPDLGSTVVLFI
FTSW_PASMU      -----------------------------LSAFKPFALMGLMGLFLLSQPDLGSTVVLFV
FTSW_HAEDU      -----------------------------ASVIRPMVILFLFSSLLLLQPDLGSVVVLFV
FTSW_AERS4      -----------------------------IGFMKPMAVLFVVAILLLAQPDLGSVVVMFV
FTSW_TOLAT      -----------------------------AGFVKPLAVVFLLAIMLLAQPDLGSVVVLFV
FTSW_ALISL      -----------------------------RGFVKPLLVLITLAFFLLMQPDLGTTVVMFV
FTSW_VIBVY      -----------------------------GGFMKPIMVFGALALLLLGQPDLGTVVVMLV
FTSW_PHOPR      -----------------------------IGFIKPLAVLGVLAFLLLMQPDLGSFVVMFV
FTSW_ALTNA      -----------------------------KGFIKPLVVFFALAMLLLLQPDLGTVVVMFA
FTSW_PSEA6      -----------------------------KGFAKPLVVFFAFAVLLLLQPDLGTVVVMLC
FTSW_PSET1      -----------------------------KGFIKPILVFAAYAGLILMQPDLGTVVVMFV
FTSW_SHESH      -----------------------------KGFYKPIAVFAVYAFLILMQPDLGTVVVLFV
FTSW_IDILO      -----------------------------KGFIKPLALLFIAAVLLLMQPDFGTVVVLSA
FTSW_ACIAD      -----------------------------KGLVRLSGVMAITVGLIIAEPDLGATVVIVL
                                                            ..  : * *       

FTSW_DICNV      TVLGMLFLSGVSIWRLLLLGVLIAPAMVWVLISESYRLRRLTTFINPWEY--QYDEGYQL
FTSW_HALNC      TLFAMAWLARAQWQMMVGSTLVMGVLGVFVVLSEQYRIERLLSFSNPFAD--PFGHGYQL
FTSW_FRAST      CVMGMLFVSGNKVRWYGLLIGAMLIMATMLVIISPYRMHRITGFLHPWEN--ANGSGYQL
FTSW_ALLVD      TVMGMLFLGGASLLPFIVLLAIVGAGLVTLVIFSPYRLERVVSFLNPWED--PFNSGYQL
FTSW_GEOSK      VAIIMLFAAGTRPRYIIAMGMMALPILYFLVMNVDYRRRRILAYLNPWED--PTDTGFQI
FTSW_GEOSL      VAIIMLFAAGTRPRYIIAMGMMALPILYFLVMNVDYRRRRILAYLNPWED--PTDTGFQI
FTSW_GEOMG      VAILMLFAAGTRPRYILGMVVLTLPFLYFLVMNVDYRRRRILAYLNPWED--PTNTGFQI
FTSW_GEOS8      VAIVMLFAAGTKVQYILGMGLVALPGICYLVFTKAYRMRRITAFLDPWQD--PTDAGFQI
FTSW_GEOLS      VTIIMLFAAGTRLIFILGSGMVAMPFVVYLVVHSAYRLKRIKAFLNPEQD--PTGIGWQI
FTSW_LARHH      IAMATLFLGGINGRIFFGLLIIGAVAAVGLVVSSPYRMERVVGFLDPWQD--PYGKGYQL
FTSW_NITSI      LVMSILFMGGVSLKIFIALIGILAIGLYELILSSEYRMARVVAFMDPWAD--PYGKGYQL
FTSW_AROAE      IAFGVLFLGGINVRVFALLALVAVIGFMLLIWLSPYRRDRIFGFMDPWQD--AFGKGYQL
FTSW_NITEU      IVLSIMFMNGMSLKMFFGLICLVPVLLALLIIIEPYRMDRINAIFDPWND--PFDKGYQL
FTSW_VARPE      IAMGILFLGGVNARMFFVIAALVVVAFGTIVASSPWRRERIFAYLDPWSEEHALGKGYQL
FTSW_THIK1      ITLAILFLGGANGKLFSVFSVAVIGAFVLMIVLSPWRRDRIFAYLNPWSESNALGSAYQL
FTSW_POLNS      IAFGILFLGGINAKLFGGLIAVGLMSGATMIAFSPLRRGRMLAFMDPWQVDNAANKGYQL
FTSW_BURTA      IAMGVLFLGGVNGKLFGGLVATAVGTFTMLVWLSPWRRERIFAYLDPWDERYAQGKAYQL
FTSW_TAYEM      IVMSILLLGGLGFALFSLLFLSAVLLVIAAILTAPWRMQRFFAYLDPFSQEHAQNTGYQL
FTSW_NEIG2      ITVGMLFLAGLPWKYFFVLVGSVLGGMVLMITAAPYRVQRVVAFLDPWKD--PQGAGYQL
FTSW_LEGPH      TVMAMLFLAGVKLRYYFGLMLVVVTALALLAVSSPYRVARLTAFLDPWAD--QYNSGYQL
FTSW_NITHN      TLLGMLFLGGARLWHFLLLAALGGASLAALAWYSPYRMQRLTSFLDPWAD--PLNSGYQL
FTSW_COXBU      TCLALLFLAGVRLWPFCVLLVLVAGSLILLAILSPYRLQRLTSFLNPWAH--QFGSGYQL
FTSW_HALHL      LAVGLLYLAGAPLWRFAALVGVLAAAAAALVVYSPYRWQRVTAFMDPWSD--PFNTGFQL
FTSW_ALKEH      TALGLLFLAGASLWRIGVLGLLLAGAAWLLIVGSPYRWQRLTTFTDPWAD--PFNAGFQL
FTSW_THISH      IGLALLFLAGAKLWQFALLVGTVAAALAMLAITTPYRMARLTAFLDPWND--PFNSGFQL
FTSW_THISK      IGMGMLFLAGAKLWQFAALGATIAVGMAFVAVAAPYRVARLTAFLDPWQD--PFATGFQL
FTSW_METCA      TALGMLFLAGARLWVFVGLLGLVAVAGTVLIYTAEYRLRRVLSFLDPWAD--PLNSGFQL
FTSW_METMM      IAMGMMFLGGARLSPFVALVALISSAGAILASSADYRVKRMTSFLNPWEH--ARDSGYQL
FTSW_PSEFS      AAAAMLFLGGVGLFRFTLMVVLAVAAVTVLVQAQPYRMARLITFTDPWSD--QFGSGYQL
FTSW_HAHCH      AVVGMIFLSGVALSRFAALLMFCVGSVALLAVSQPYRLKRLTAYTDPWAD--QFDSGYQL
FTSW_MARHV      AAAGMIFLSGVRLSRFMPLIGVLAALGTILVVTQPYRLKRVISYLDPWKD--QFDSGYQL
FTSW_SACD2      TLGCMMFVAGVPLARFLLLAVSGVAGLALMAVASPYRWERLVAFMDPWAT--QFDSGYQL
FTSW_CELJU      TVFAMMFIAGVRIWHFLLLIMIGVAGLGAVAILSPYRMQRLITFLDPWAD--QFNTGYQL
FTSW_ALCBS      TAMGMLFLSGVPTLRFLLIGLIAVALGGLVAFAEPYRVARLMTFTDPWAD--QFGSGYQL
FTSW_HALED      CVMGMLLMAGAPWGRFLLLMGLVAALGAALAIAEPYRMARLTSFVDPWAD--QFASGYQL
FTSW_MARM1      TVIALLFIGGAPVYQFIAIVIMAVLVMAGLALSESYRVKRLMNFVDPWAD--PFNDGYQL
FTSW_HYDCU      IITGMLLIAGAPWRFFVMTVLPIATLLVMMVITSPYRMARVTNFLDPWSD--PFGNGYQL
FTSW_THICA      VLVGMLFIAGAPFRYFVITVLPIGAILAVLLINSPYRMARVMNFMDPWQD--PYGVGYQL
FTSW_XANOR      VTACMLVLGGAPIGRIILPILLLLPALVALVIFEPYRMRRVTSFMDPWVD--QLGSGYQL
FTSW_ECO57      TTLAMLFLAGAKLWQFIAIIGMGISAVVLLILAEPYRIRRVTAFWNPWED--PFGSGYQL
FTSW_ECOL6      TTLAMLFLAGAKLWQFIAIIGMGISAVVLLILAEPYRIRRVTAFWNPWED--PFGSGYQL
FTSW_ECOLI      TTLAMLFLAGAKLWQFIAIIGMGISAVVLLILAEPYRIRRVTAFWNPWED--PFGSGYQL
FTSW_MOREP      TTLAMLFLAEAKIWQFLPIIGTGILAVMLLIIAKPYRRRRVTSFLNPWDD--PFGRGYQL
FTSW_BUCAI      TTISVLFLSGAKIGQFFIIITVSILTIILLILLEPYRIKRVLSFWNPWED--PFGNGYQL
FTSW_BUCBP      TTLSLLFISGTKIQKFIPTILIIVVTTTVLIIKSPYRFERIMSFWNPWND--PFGKGYQL
FTSW_BLOPB      TTLSILFLFGAKLCQLILVFVFNIFLIIPLIVIKPYRIQRILTFWDPWKD--PFGNGYQL
FTSW_WIGBR      TTLLLFFLAGINLWKCCFMFLFGLLTIFILIIFKPYRIRRILSFLDPWED--PFNSGYQL
FTSW_RIEPU      SLLFMLFLIGKNFLFLSASSAIFTTIVLSLIYFRSYRAKRLISFLNPWSN--YLGDGYQL
FTSW_HAEIN      IMSGMLFIVGAKILQFVGLIALGGILFVWLVLTASYRLKRFIGFLEPFKE--PYGTGFQL
FTSW_PASMU      ITFGLLFIVGANFWQFVGLMAFGGLLFVWLVLSSAYRLKRFTGFLDPFKD--PYGTGFQL
FTSW_HAEDU      LTFTMLFIMGAKVMQFLLLIVTASVSFILLVLTSEYRLKRVTSFLDPFAD--AYGDGFQL
FTSW_AERS4      TSLGMLFLAGARLGQFIGLILVGVSAVVTLVIAEPYRMRRVTSFLDPWAD--PFGSGYQL
FTSW_TOLAT      CTFGLLFIGGAKLVQFIAIIVAGLSALAGLIIYEPYRLRRVTSFLDPWAD--PFGSGYQL
FTSW_ALISL      TTIAMLFIAGAKLWQFIALVMGGISLVIVLILAEPYRMRRVTSFLDPWQD--PFGSGYQL
FTSW_VIBVY      TLFGMLFIAGAKLSQFLALMVAGITAVVGLILIEPYRVRRVTSFLDPWED--PFGSGYQL
FTSW_PHOPR      TTVGMLFIAGAKLWQFLVMISGALLGIGLLIVFEPYRLRRVTSFLDPWED--PFGSGYQL
FTSW_ALTNA      TTIGLLFLAGARLWQFFALVFAGVLAVVALIVFEEYRMKRVTSFLDPWAD--PFGAGYQL
FTSW_PSEA6      TTIGLLFLAGAKLWQFFGLAFTGGAAVTFLIMFEEYRMKRITSFLDPWAD--PFGSGYQL
FTSW_PSET1      TTVGLLFLAGAKLWQFFVLILTGVALVIGLIVLEPYRMARVIGFLEPWDD--PFGKGYQL
FTSW_SHESH      GTVGLLFLAGARLLDFFALILTGVMAFVALVLLEPYRMRRVTSFMDPWQD--PFGSGYQL
FTSW_IDILO      TTVAMLFLAGARLWQFFAVFITCVLALILLIIVEPYRMQRLLTFLEPEKD--PFGAGYQL
FTSW_ACIAD      MMVGIFFLAGAPPTQFAIMLGAVVMGIGFLILFEPYRLARAMSFTNPWAD--PLGTGYQL
                                                    *  *     .*         .:*:

FTSW_DICNV      VNSLISFGRGGLFGVGLGESVQKHQYLPEAHTDFIFSIIAEETGLVGALIVMAILMILVW
FTSW_HALNC      ANALIAIGTGGVWGRGLGESIQKLSYLPEAHTDFIFAVLAEELGLIGVIALIGLYGLIVW
FTSW_FRAST      VQALIGFGRGGWFGDGLGNGVQKQFFLPEAHTDFITSVIAEEIGVIGLMILLMVYLFIVF
FTSW_ALLVD      SQALIAFGRGEWFGVGLGNGIQKQYFLPEAHTDFLPSVIGEELGLAGMLVLIAAFVFLSW
FTSW_GEOSK      IQSWLAFGNGGVLGQGLGEGKQKMFYLPEAHTDFILSVTGEELGLIGVTVIAAMFLMLVL
FTSW_GEOSL      IQSWLAFGNGGVLGQGLGEGKQKMFYLPEAHTDFILSVTGEELGLIGVTVIAAMFLMLVL
FTSW_GEOMG      IQSWLAFGNGGIIGQGLGEGKQKMFFLPEAHTDFILSVVGEELGLIGVIVIAAMFLMLVL
FTSW_GEOS8      IQSWLALGTGGFFGQGLGEGKQKLFYLPEAHTDFILSVLGEEMGFIGVVVIASMFLLLVQ
FTSW_GEOLS      IQSKYAFGAGGFFGQGLGEGKQKLFYLPEAHTDFILSVIGEELGFIGVIVIIGMFFILVQ
FTSW_LARHH      SHSLIAFGRGEWFGVGLGQSVEKLFYLPEAHTDFLMAVIGEEFGFAGIATVVGLFAWLVW
FTSW_NITSI      SHALIAFGRGEWFGVGLGGSVEKLFYLPEAHTDFLLSVLAEELGFVGVAAVILLFIWLIM
FTSW_AROAE      SHALIAFGRGEWFGVGLGASVEKLFYLPEAHTDFLLAVIAEELGFAGVLTVIALFAILIH
FTSW_NITEU      THALIAFGLGEWWGVGLGSSVEKLNYLPEAHTDFMFAVLAEELGFAGVVTVISLFFFLLV
FTSW_VARPE      SHSLIAIGRGEIFGVGLGGSVEKLHWLPEAHTDFLLAVIGEEFGLVGVLLIIGLFLWLTR
FTSW_THIK1      SHALIAMGRGEWFGVGLGGSIEKLHYLPEAHTDFLLAIIGEELGLVGVGVVIFAFYWIVR
FTSW_POLNS      THSLMAFGRGEWFGTGLGGSVEKLHYLPEAHTDFIMAVIGEELGFVGVVVMIFLFYWIVR
FTSW_BURTA      THSLIAFGRGEWFGVGLGGSVEKLNYLPEAHTDFILAVIGEELGFVGVLVVILLFYWIVR
FTSW_TAYEM      THSLIAVGRGGFFGEGLGLSIEKLHYLPEAHTDFIMAVVGEELGFVGIFFVILLFVLLVR
FTSW_NEIG2      THSLMAIGRGEWFGMGLGASLSKRGFLPEAHTDFIFAIIAEEFGFFGMCVLIFCYGWLVV
FTSW_LEGPH      TQSLIAFGRGGWFGTGLGESIQKLLYLPEAHTDFLFAVIAEELGLFGILVVITLYSILVI
FTSW_NITHN      TQALIAFGRGEWLGVGLGNSIQKLFYLPEAHTDFLYAVLAEELGLMGSLAVIALFVVFIY
FTSW_COXBU      TQSLIAFGRGGLFGVGLGNSVQKLFYLPEAHTDFLFAVLAEELGLIGEILLMGLFVLLIG
FTSW_HALHL      TQSLIAIGRGDWLGVGLGGSVQKLFYLPEAHTDFVFSVLAEELGWLGVLAVVLLFSYIVW
FTSW_ALKEH      TQSLIAIGRGEWFGVGLGASVQKLFYLPEAHTDFLFAVLAEELGLLGVVVVVALFTYLAW
FTSW_THISH      TQSLIAIGSGSWFGVGLGASVQKLFYLPEAHNDFLFAVLAEELGLVGITVVVLLYGWFLW
FTSW_THISK      TQSLIAIGSGGWFGTGLGNSVQKLFYLPEAHNDFLFAVFAEEFGFIGVLALIALFAVVVW
FTSW_METCA      TQALIAFGRGEWQGVGLGSSVQKLFYLPEAHTDFLFSVIGEELGLWGATTVILLFAIVVW
FTSW_METMM      TQALISFGRGEVSGVGLGNGLQKLFYLPEAHTDFLFSVLGEELGLVGVTLVIALFTTLVV
FTSW_PSEFS      TQALIAFGRGEWLGVGLGNSVQKQFYLPEAHTDFVFSVLAEELGVVGSLCTVALFVFVCV
FTSW_HAHCH      TQALIAFGRGEWSGVGLGNSVQKLFYLPEAHTDFVFAIIAEELGLLGSLLIIVLFGVLLW
FTSW_MARHV      TQSLIAFGRGEWVGVGLGNSVQKLFFLPEAHTDFIYAIIAEEFGLLGALVVLGLFAALVV
FTSW_SACD2      VQSLIAFGRGGWFGVGLGNSLQKLFFLPEAHTDFIFAIFTEEFGFIGAIALIGVFGFFLY
FTSW_CELJU      TQSLIGFGRGEWVGLGLGNSLQKLFFLPEAHTDFIFAIIAEEFGLLGAVVIVGLFVALIV
FTSW_ALCBS      TQSLIAFGRGHWFGVGLGNSVQKLFYLPEAHTDFVYAVMSEELGLLGNVALIGGFILLGW
FTSW_HALED      TQALIAFGRGEWFGTGLGNSVQKLFYLPEAHTDFVFAVLAEELGMIGAVAVIGLFALLVW
FTSW_MARM1      SQALIAYGRGEWFGLGLGNSVQKLSYLPEAHTDFVFSIWVEEMGLLGGVVLLSLFALMLS
FTSW_HYDCU      TQALIASGRGEWFGVGIGESVQKLLYLPDAHTDFLFSIYAEEYGLIGVAFLALLYLTLLY
FTSW_THICA      SQALMAIGSGGITGSGLGASVQKLLYLPDAHTDFMFAVFAEETGWLGVVILLSLYGLLLW
FTSW_XANOR      SNALMAIGRGQWTGVGLGASVQKLNYLPESHTDFIFSVIAEELGFVGVCGVIGLYALLVG
FTSW_ECO57      TQSLMAFGRGELWGQGLGNSVQKLEYLPEAHTDFIFAIIGEELGYVGVVLALLMVFFVAF
FTSW_ECOL6      TQSLMAFGRGELWGQGLGNSVQKLEYLPEAHTDFIFAIIGEELGYVGVVLALLMVFFVAF
FTSW_ECOLI      TQSLMAFGRGELWGQGLGNSVQKLEYLPEAHTDFIFAIIGEELGYVGVVLALLMVFFVAF
FTSW_MOREP      TNSLIAFGRGELWGQGLGNSIQKFEYLTEAHTDFICSILGEELGYFGVLLALLMVFLVAF
FTSW_BUCAI      TQSLIALGRGNFLGQGLGNSIQKLDYLPDAHSDFIFSIIGEELGYIGSFLILLIIFTISF
FTSW_BUCBP      TQSLMALGRGNIFGMGLGHSIQKLEYLPEAHTDFIFAIIGEELGYIGACTILFMIFFISF
FTSW_BLOPB      TQSLIAFGRGKCFGEGLGNSVLKLEYLPEAHTDFIFSILAEELGYFGAILVLFMLFIIVL
FTSW_WIGBR      TQSLMALGRGKIIGTGLGNSIQKLEYLPEAYTDFIFSILGEELGYIGSIIILIMLFFVIF
FTSW_RIEPU      VHSMLSFGRGKMFGQGIGNSIQKINFLPEPHTDFIISIIGEELGYLGIAMIVISLFFIFF
FTSW_HAEIN      TNSLIAFGRGEITGEGLGNSIQKLDYLPEAHTDFIMAIIGEEFGFIGILIVILLLGLLIF
FTSW_PASMU      SNSLMAFGRGEWVGEGLGNSIQKLEYLPEAHTDFVMAVVGEEFGFLGILVIVILLGLLIF
FTSW_HAEDU      SNAQMAFGQGQLWGQGLGNSVQKLEYLPEAHTDFVMAVVAEEFGFIGIIFMVVLLLCLSF
FTSW_AERS4      TQSLMAFGRGSWFGEGLGNSIQKMEYLPEAHTDFVFAILGEELGYAGVLGALFLIFALSF
FTSW_TOLAT      TQSLMAFGRGGFFGQGLGNSVQKLSYLPEAHTDFVFAILGEELGYFGVLVVLFLQLLLAM
FTSW_ALISL      TQSLMAFGRGSWFGEGLGNSIQKLEYLPEAHTDFVFAVIAEELGFVGVCLVLCLIFALVF
FTSW_VIBVY      TQSLMAFGRGEWFGQGLGNSIQKLEYLPEAHTDFVFAVMAEELGFIGVVLILALIFSLVI
FTSW_PHOPR      TQSLMAFGRGELMGQGLGNSIQKLEYLPEAHTDFVFAVLGEELGLIGVTVVLLLIFALVF
FTSW_ALTNA      TQSLMAYGRGNWFGQGLGNSLQKLEFLPEAHTDFVMAILAEELGFVGVLAVLGLILWMVV
FTSW_PSEA6      TQSLMAYGRGDVFGQGLGNSLQKLEYLPEAHTDFIMAILAEELGFAGVLTVLALMLCIVL
FTSW_PSET1      VQSLMAYSQGDWFGQGLGNSVQKLQYLPEAHTDFIFAVIAEELGFVGVSSILIVLGTLVF
FTSW_SHESH      TQSLMAYGRGDWFGQGLGNSIQKLEYLPEAHTDFIFAVIGEELGFIGIVVVLSVLLFVAL
FTSW_IDILO      MQSLIAFGQGHFSGAGLGNSIQKLQYLPEAHTDFIMAVVAEELGFLGVLAVIATVLMLVW
FTSW_ACIAD      SNALMAFGRGEWFGTGLGHSVQKLSYLPEAHTDFMLAVLGEEFGFVGISIVIGLSFIMLA
                 ::  . . *   * *:* .  *  :*.:.:.**: ::  ** *  *          .  

FTSW_DICNV      RAFAIGYLADRMRKRFSSLLAYGIGLWLGLQSLINIGVTTGALPTKGLTLPLISYGGSSI
FTSW_HALNC      RGFVIANMAWKENQIAGAALAWGISVWIGMQALINMGVNMGVLPTKGLTLPLMSYGGSAM
FTSW_FRAST      RAMNIAKMAFELKRYYQAFLSYGISFWIGFQVFVNIGVNTGLLPTKGLTLPLISYGGSSL
FTSW_ALLVD      RAMSIGVRAEALKRPFESYVAQGIGLWIGLQSFVNLGVNVGILPTKGLTLPFMSYGSNSL
FTSW_GEOSK      RGVRVALMAQE---PFGRFLAFGIATLLGIQSFVNMAVVTGLLPTKGLALPFISYGGSSL
FTSW_GEOSL      RGVRVALMAQE---PFGRFLAFGIATLLGIQSFVNMAVVTGLLPTKGLALPFISYGGSSL
FTSW_GEOMG      RGVRVALMAQD---PFGRFLAFGIVTLLGIQAFVNMGVVTGLLPTKGLALPFISYGGSSL
FTSW_GEOS8      RSIRVAIAAED---SFGRFLAFGIAILLGLEAFVNMAVVTGLLPTKGIALPFLSYGGSSL
FTSW_GEOLS      RAMRIAMAAQD---TFGRFLALGIAVLFAIEAVVNMAVVTGLFPTKGLALPFLSYGGSSL
FTSW_LARHH      RAFHIGRESRKLERHFQALAAQAIGIWIGWQCFINIGVNLGLLPTKGLTLPLLSYGGSAI
FTSW_NITSI      RTFVIGRLAAKLGNTFSALVAQGIGIWIGVQALINMGVNMGVLPTKGLTLPLLSFGGSSI
FTSW_AROAE      RALVLGREAVKLERYFSGLVAMGIGLWLGVQSFINMGVNMGLLPTKGLTLPLMSFGGSGI
FTSW_NITEU      RIFKVGRTAARLGDQFGSLVAQGIGVWLGLQAFINMGVNMGLLPTKGLTLPFMSYGGSSI
FTSW_VARPE      RVMHIGRQAIALDRVFSGLVAQGVGVWLGFQTFINMGVNLGALPTKGLTLPLMSFGGSAI
FTSW_THIK1      RAFDIGRQALVLDRMYSALVAQGIGVWIGGQAFINIGVNLGLLPTKGLTLPLMSYGGSAL
FTSW_POLNS      RAFLIGRTALQLDRSFAGLAAKGVAIWIGWQAFINMGVNLGLLPTKGLTLPLVSYGGSGI
FTSW_BURTA      RSFEIGRQALALDRTFAGLMAKGVGIWFGAQAFINMGVNLGLLPTKGLTLPLVSYGGSGI
FTSW_TAYEM      KGLNVGRQAIAMDRLFNGLVAQGVVVWFGVQAIVNLGVCFGVFPTKGLTLPFISYGGSSI
FTSW_NEIG2      RAFSIGKQSRDLGLTFNAYIASGIGIWIGIQSFFNIGVNIGALPTKGLTLPLMSYGGSSV
FTSW_LEGPH      RGLNIGYTAYTQERHFASYTAYGLTIWLALQASINMGVNAGLLPTKGLTLPLLSYGGASM
FTSW_NITHN      RVLLIGRAAERAGRTFGAHLAYGLGIWIGLQAFINLGVNMGVLPTKGLTLPLMSAGGSSS
FTSW_COXBU      RIILIGRRAENSNQLYSAYLAYGIALWLGLQVIINIGVTAGVLPTKGLTLPFISYGGSSL
FTSW_HALHL      RAMAVGWQCHRHRLPFAGYLAWAVGLALGLQAFINMGVATGLLPTKGLTLPLFSYGGSSA
FTSW_ALKEH      RGMQIGLASLRADRPFGAYLAWGLTISIGLQAFINMAVTMGLLPTKGLTLPLMSYGGSSL
FTSW_THISH      RSFGIGRAAEQAGQLFGAYLAYGVGVWVSLQAFINMGVNMGLLPTKGLTLPLMSYGGSSM
FTSW_THISK      RCVKIGLWAERAGHAFGSHLAFGVAIWLALQSALNLAVNMGLLPTKGMTLPFLSYGGSSL
FTSW_METCA      RALAIGRLAERSGNLFAAFLAYGIGIWLGLQSFINMGVNMGMLPTKGLTLPLMSYGGGSM
FTSW_METMM      RGFSIGEQAEAAGERFSALVAYGLVIWFGFQAFVNMGVNMGILPTKGLTLPLMSYGGGSM
FTSW_PSEFS      RGMYIGMWAEKAKQYFAAYVAYGLSFLWIGQFLINIGVNVGLLPTKGLTLPFLSYGGSSL
FTSW_HAHCH      RGMYVSRVAERAGQLFNAYAGYGVTLLLGGQALINLGVNTGLLPTKGLTLPLISYGGSSL
FTSW_MARHV      SGLVIARRAEKAGMAFGACFSYGITLLIGLQAGINMAVSTGLLPTKGLTLPLVSYGGSSL
FTSW_SACD2      RLVILFRRASEQEQFFSSYVVFGIGVMLAMQAFINMGVASGFLPTKGLTLPFISYGGSSL
FTSW_CELJU      RILQIARNNLSAGRMFPALAAFGVGILFSFQVFINVGVSSGLLPTKGLTLPFISYGGSSL
FTSW_ALCBS      RVFRIGHRLEARGLLYHAYLVYGCAFVFCSQAFINLGVNMGLLPTKGLTLPFISYGGSSL
FTSW_HALED      RAMAVGRRAELAKRPFAAYLCYGIALVIGAQAFINIAVSTGMLPTKGLTLPLLSYGGSSL
FTSW_MARM1      RIFKIGHRALMGARPFAGYMCFGFAILILAQVIINVGVNTGFLPTKGLTLPLISYGGSSL
FTSW_HYDCU      RCFRIGRKAFNQTHYFGGLIAYGVGIWIVLQAMINMGVNLGLFPTKGLTLPFMSYGGSSV
FTSW_THICA      RMFAVAQAAWLPQAPFKALVVYGVAIMFAGQLLINVGVNLGVFPTKGLTLPFVSYGGSSL
FTSW_XANOR      RAFWLGMRCVEMKRHFSGYIAFGIGLWIAMQSFVSIGVNLGILPTKGLTLPLISSGGSSV
FTSW_ECO57      RAMSIGRKALEIDHRFSGFLACSIGIWFSFQALVNVGAAAGMLPTKGLTLPLISYGGSSL
FTSW_ECOL6      RAMSIGRKALEIDHRFSGFLACSIGIWFSFQALVNVGAAAGMLPTKGLTLPLISYGGSSL
FTSW_ECOLI      RAMSIGRKALEIDHRFSGFLACSIGIWFSFQALVNVGAAAGMLPTKGLTLPLISYGGSSL
FTSW_MOREP      RAMSIGRKALAINQIFSGFLACSIGIWFSFQTMVNVGAAAGMLPTKGLTLPFISYGGSSM
FTSW_BUCAI      RAMYIGQKALEKKQIFSGFLACSIGIWLSFQTSINVGSVTGILPTKGLTLPFISYGGSSL
FTSW_BUCBP      RAFKIGKIALKNKIFFSGYFAFSIGLWLIFQTLINVGTTIGLLPTKGLTLPLISYGGSSL
FTSW_BLOPB      RAMIIGHRALNINHRFSGILACSISMWFGLQIFINVGTVSGILPTKGLTLPFISYGGSSF
FTSW_WIGBR      RIFLIGKNSFIQKKFFSGYFSFSVGIWISLQTIMNVGGVIGILPIKGLTLPFISYGGSSL
FTSW_RIEPU      QGMNIGRNALKDFQYFSGFLAYSISLLIIIQSIINIGSSIGILPIKGTTLPIISYGGSSK
FTSW_HAEIN      RAMKIGRESLMLEQRFRGFFALGIGFWIFFQGFVNLGMALGMLPTKGLTFPLVSYGGSSI
FTSW_PASMU      RAMKIGRESLLLEQRFKGFFAFGISFWIFFQGFVNLGMSLGLLPTKGLTFPLISYGGSSL
FTSW_HAEDU      RAIKISRDALKLEARFRGFFAFGVAIWVFLQGSVNLGVASGALPTKGLTFPLVSYGGSSL
FTSW_AERS4      KALKLGHQALVAERLYEGYLAIGIGIWFSFQTFVNVGAASGMMPTKGLTLPLVSYGGSSL
FTSW_TOLAT      KALQIGRTALLRSKFFEGYMACGIGIWFSFQTVVNVGAAAGMLPTKGLTLPLVSYGGSSL
FTSW_ALISL      KALLIGRKCLAHDQRFGGFLAFGIGIWFAFQTLVNVGAAAGIVPTKGLTLPLISYGGSSL
FTSW_VIBVY      KAVFIGKKAFEHQLQFGGYLAFGIGIWFAFQTLVNVGAAAGMVPTKGLTLPLISYGGSSL
FTSW_PHOPR      KALFIGRKCLQSGQLFGGFLACGFSFWFAFQTLVNVGAAIGMVPTKGLTLPLISYGGSSL
FTSW_ALTNA      RALQIGNKALLKSRPFEGYLAYSVGIWFSFQTAVNIGASAGILPTKGLTLPLVSYGGSSL
FTSW_PSEA6      KAMKMGSKALQNERPFDAYLAYSIGIWFSFQTAVNVGASAGILPTKGLTFPLLSYGGSSL
FTSW_PSET1      RALLIGQNALKNGKEYEGYLALAIGIWFAFQTMVNVGASAGILPTKGLTLPFISYGGSSL
FTSW_SHESH      RAIKLGNLCIEIDKPFEGYLAYAIGIWFCFQTVVNVGASIGMLPTKGLTLPFISYGGSSL
FTSW_IDILO      RALIIGRRCLMQEQRYGGYLAYGIGIWFSIQAFVNIGVASGALPTKGLTLPLVSYGGNSL
FTSW_ACIAD      CCIKIGHRALKHNFLRAGYLAYGISIIFLLQIIVNAGMNMGLMPTKGLTLPFISYGGTSL
                  . :                 .       :  .. .   * .* ** ::*:.* *. . 

FTSW_DICNV      LMTSIALAILARIDAESRFIA---------------------------------------
FTSW_HALNC      IVALISLGFLMRVHHEAAMVA---------------------------------------
FTSW_FRAST      LIMCFTLGILVRVDFENKLLA---------------------------------------
FTSW_ALLVD      MVGCMAVAILLRIDVMLRRVE---------------------------------------
FTSW_GEOSK      IVTLFAVGILLNISTRLKGAP---------------------------------------
FTSW_GEOSL      IVTLFAVGILLNISTRLKGAP---------------------------------------
FTSW_GEOMG      IVTLFAVGILLNVSTRMKGTP---------------------------------------
FTSW_GEOS8      IISLCSVGVLLNVSTRMRGAA---------------------------------------
FTSW_GEOLS      LISLFAVGILLNISAGLKLAP---------------------------------------
FTSW_LARHH      LANCMALAILLRIDWENRLLM---------------------------------------
FTSW_NITSI      TANCIALAVILRIDWENRQRL---------------------------------------
FTSW_AROAE      VANCLALAILLRVDWEVRQLK---------------------------------------
FTSW_NITEU      VINSIAIAILLRIDWENRLKR---------------------------------------
FTSW_VARPE      LMNMIALAIVLRIDYENRVLM---------------------------------------
FTSW_THIK1      LLNCMAIAVLLRVDFENRILM---------------------------------------
FTSW_POLNS      LMNAVAMAMLLRIDFENRILM---------------------------------------
FTSW_BURTA      LLNCISLAVLLRVDYENRVLM---------------------------------------
FTSW_TAYEM      VISLMAFGLLLRVDYENRCLM---------------------------------------
FTSW_NEIG2      FFMLISMMLLLRIDYENRRKM---------------------------------------
FTSW_LEGPH      VINCIVIALLLRIDHENRWQS---------------------------------------
FTSW_NITHN      IVTCVAVALILRVDLETRFPK---------------------------------------
FTSW_COXBU      LMNCLAIGVILRIAYETEN-----------------------------------------
FTSW_HALHL      LATGAMVGLLLRCGYELAQAR---------------------------------------
FTSW_ALKEH      IMTGIALALLLRVDYEARLAA---------------------------------------
FTSW_THISH      LMTCAAVGLLLRVHRETVESG---------------------------------------
FTSW_THISK      IVTLMAIGLVMRVYREAQIPA---------------------------------------
FTSW_METCA      MVVCAAIGLLFRIRSEAVASF---------------------------------------
FTSW_METMM      IVMCGAMAVLFRIHYEVTELH---------------------------------------
FTSW_PSEFS      VICCACLGLLLRIEWESRTHL---------------------------------------
FTSW_HAHCH      IISCLCVAILLRIGSEAVS-----------------------------------------
FTSW_MARHV      MVTCIGIAVIARVELERQD-----------------------------------------
FTSW_SACD2      LITCGLMALVFRVNLELNREN---------------------------------------
FTSW_CELJU      LICCVLMAFIMRIQWESSIAV---------------------------------------
FTSW_ALCBS      LISAVMVGLILRAGAEADHLK---------------------------------------
FTSW_HALED      VISAVMVGMLLRVDIETRQAR---------------------------------------
FTSW_MARM1      IITLGSLFVVARVDIENKLAS---------------------------------------
FTSW_HYDCU      LMLFIGVAMVLRVDLETRQA----------------------------------------
FTSW_THICA      MMALLAIGLVLRIDYETRL-----------------------------------------
FTSW_XANOR      LMTCLAMGVLLRVSYEADRAERLRSKLSPQGAAISPGEPAEPVVDAVPPAYAPARKPQRD
FTSW_ECO57      LIMSTAIMMLLRIDYETRLEKA--------------------------------------
FTSW_ECOL6      LIMSTAIMMLLRIDYETRLEKA--------------------------------------
FTSW_ECOLI      LIMSTAIMMLLRIDYETRLEKA--------------------------------------
FTSW_MOREP      LIMLTAIVLLIRIDFETRLAKL--------------------------------------
FTSW_BUCAI      IINSIAIFFLLRIDFETRLKTS--------------------------------------
FTSW_BUCBP      IIVSIAIIILIRIDFELRMKNI--------------------------------------
FTSW_BLOPB      LITVMASMQLLRIDFETRLSKN--------------------------------------
FTSW_WIGBR      ITIFSAIAIVIRSDFELRINKY--------------------------------------
FTSW_RIEPU      LITCIKIAILLRIDFETKMNKI--------------------------------------
FTSW_HAEIN      IIMSATIGILLRIDHENRLFRIG-------------------------------------
FTSW_PASMU      IIMSMTIGLLLRIDHENRLMRIG-------------------------------------
FTSW_HAEDU      VIMSVAIAILLRIDYENRLTRVG-------------------------------------
FTSW_AERS4      IIMMVAVSMLVRIDFELRQASAQ-------------------------------------
FTSW_TOLAT      IAITMAVAILLRIDFERRLDTSH-------------------------------------
FTSW_ALISL      IIMSVAVSLLIRIDHECRVYLAN-------------------------------------
FTSW_VIBVY      IIMSIAVSILLRIDHECRLISMG-------------------------------------
FTSW_PHOPR      FIMATAVGILLRIDHEQRLFAKY-------------------------------------
FTSW_ALTNA      IVMSVAVALLLRIDFELRVDGVQ-------------------------------------
FTSW_PSEA6      IIMAAAVGLLVRIDFEMRVEGIQ-------------------------------------
FTSW_PSET1      LMMTIAAGILLRVDFETKMATKQ-------------------------------------
FTSW_SHESH      WVMTAAAMILIRIDHERRLSSIQ-------------------------------------
FTSW_IDILO      IISALAVGLLLRIDHERRMLGRK-------------------------------------
FTSW_ACIAD      MMCAAMISLILRIDASTQEINPD-------------------------------------
                         : .                                                

FTSW_DICNV      -----------------------RLEGKI-------------------------------
FTSW_HALNC      -----------------------ELREAQMTKRQQDASIRTKEVLS--------------
FTSW_FRAST      -----------------------DTINPKYIYKKVRK-----------------------
FTSW_ALLVD      -----------------------SEAKFKRGTPWSRA-----------------------
FTSW_GEOSK      ------------------------------------------------------------
FTSW_GEOSL      ------------------------------------------------------------
FTSW_GEOMG      ------------------------------------------------------------
FTSW_GEOS8      ------------------------------------------------------------
FTSW_GEOLS      -----------------------LTGKDAK------------------------------
FTSW_LARHH      -----------------------RGYKV--------------------------------
FTSW_NITSI      -----------------------RGLNV--------------------------------
FTSW_AROAE      -----------------------RGCGA--------------------------------
FTSW_NITEU      -----------------------RGLNA--------------------------------
FTSW_VARPE      -----------------------RGGRV--------------------------------
FTSW_THIK1      -----------------------RGGHV--------------------------------
FTSW_POLNS      -----------------------RGGKL--------------------------------
FTSW_BURTA      -----------------------RGGKV--------------------------------
FTSW_TAYEM      -----------------------RGQKPLGIGASYA------------------------
FTSW_NEIG2      -----------------------RGYRVE-------------------------------
FTSW_LEGPH      ----------------------LGLRPLTA------------------------------
FTSW_NITHN      ----------------------VARRSVK-------------------------------
FTSW_COXBU      ------------------------------------------------------------
FTSW_HALHL      ----------------------AEGR---RPEEAAS------------------------
FTSW_ALKEH      ----------------------QQPRPRKRPSGRVRP-----------------------
FTSW_THISH      -----------------------PLRVGRVTGGRGA------------------------
FTSW_THISK      ----------------------PRQSTPPRRKRGQA------------------------
FTSW_METCA      ----------------------LGNGRKGLWPGV--------------------------
FTSW_METMM      ----------------------KSNIKGKSR-----------------------------
FTSW_PSEFS      ----------------------GSEEMEFSESDFAEEPTHGR------------------
FTSW_HAHCH      -----------------------GEQTEDESPKVKNRGGAQR------------------
FTSW_MARHV      -----------------------RARVASETKGNRTKGGAVYD-----------------
FTSW_SACD2      ----------------------QEGKP---------------------------------
FTSW_CELJU      ----------------------PEPVAEPKTPRRRLVEASA-------------------
FTSW_ALCBS      ----------------------ARGRAAR-------------------------------
FTSW_HALED      ----------------------RREQPAAPRTGEARS-----------------------
FTSW_MARM1      ----------------------KGGESEERKRKSDESIDDGEALA---------------
FTSW_HYDCU      ----------------------VLEHSVDESGQGKR------------------------
FTSW_THICA      ----------------------IKGHSTEELSANPSFGS---------------------
FTSW_XANOR      TAAAPAPAAAPVAAHVAPASAILRGTSRMQPRVEPTFGRIA-------------------
FTSW_ECO57      -----------------------QAFVRGSR-----------------------------
FTSW_ECOL6      -----------------------QAFVRGSR-----------------------------
FTSW_ECOLI      -----------------------QAFVRGSR-----------------------------
FTSW_MOREP      -----------------------QAFVR--------------------------------
FTSW_BUCAI      -----------------------QAFPRGPK-----------------------------
FTSW_BUCBP      -----------------------QAFYKTDI-----------------------------
FTSW_BLOPB      -----------------------QAFLKCTKI----------------------------
FTSW_WIGBR      -----------------------QAYLKQ-------------------------------
FTSW_RIEPU      -----------------------QAFRR--------------------------------
FTSW_HAEIN      -----------------------QARLRDD------------------------------
FTSW_PASMU      -----------------------QARLRDD------------------------------
FTSW_HAEDU      -----------------------HAQIKEP------------------------------
FTSW_AERS4      -----------------------ARVREVS------------------------------
FTSW_TOLAT      -----------------------VIQREAA------------------------------
FTSW_ALISL      -----------------------EPPRSE------------NEEQK--------------
FTSW_VIBVY      -----------------------NKTDLQ------------TDEKE--------------
FTSW_PHOPR      -----------------------GPAESEELDDSGLNDSNNNDEQE--------------
FTSW_ALTNA      -----------------------ALGR-GDNKRTSKAKAKPSAKSAAKPAVRTKHTNAEP
FTSW_PSEA6      -----------------------AIDRSGKAKASTSSSRKNKPKTASSAGKKKVSTVLDD
FTSW_PSET1      -----------------------ATSG--GAKR---------------------------
FTSW_SHESH      -----------------------AVQG--KKVNDNREY----------------------
FTSW_IDILO      -----------------------VAPRGGAE-----------------------------
FTSW_ACIAD      -----------------------REESNF-------------------------------
                                                                            

FTSW_DICNV      ------------------------------------------------------------
FTSW_HALNC      ------------------------------------------------------------
FTSW_FRAST      ------------------------------------------------------------
FTSW_ALLVD      ------------------------------------------------------------
FTSW_GEOSK      ------------------------------------------------------------
FTSW_GEOSL      ------------------------------------------------------------
FTSW_GEOMG      ------------------------------------------------------------
FTSW_GEOS8      ------------------------------------------------------------
FTSW_GEOLS      ------------------------------------------------------------
FTSW_LARHH      ------------------------------------------------------------
FTSW_NITSI      ------------------------------------------------------------
FTSW_AROAE      ------------------------------------------------------------
FTSW_NITEU      ------------------------------------------------------------
FTSW_VARPE      ------------------------------------------------------------
FTSW_THIK1      ------------------------------------------------------------
FTSW_POLNS      ------------------------------------------------------------
FTSW_BURTA      ------------------------------------------------------------
FTSW_TAYEM      ------------------------------------------------------------
FTSW_NEIG2      ------------------------------------------------------------
FTSW_LEGPH      ------------------------------------------------------------
FTSW_NITHN      ------------------------------------------------------------
FTSW_COXBU      ------------------------------------------------------------
FTSW_HALHL      ------------------------------------------------------------
FTSW_ALKEH      ------------------------------------------------------------
FTSW_THISH      ------------------------------------------------------------
FTSW_THISK      ------------------------------------------------------------
FTSW_METCA      ------------------------------------------------------------
FTSW_METMM      ------------------------------------------------------------
FTSW_PSEFS      ------------------------------------------------------------
FTSW_HAHCH      ------------------------------------------------------------
FTSW_MARHV      ------------------------------------------------------------
FTSW_SACD2      ------------------------------------------------------------
FTSW_CELJU      ------------------------------------------------------------
FTSW_ALCBS      ------------------------------------------------------------
FTSW_HALED      ------------------------------------------------------------
FTSW_MARM1      ------------------------------------------------------------
FTSW_HYDCU      ------------------------------------------------------------
FTSW_THICA      ------------------------------------------------------------
FTSW_XANOR      ------------------------------------------------------------
FTSW_ECO57      ------------------------------------------------------------
FTSW_ECOL6      ------------------------------------------------------------
FTSW_ECOLI      ------------------------------------------------------------
FTSW_MOREP      ------------------------------------------------------------
FTSW_BUCAI      ------------------------------------------------------------
FTSW_BUCBP      ------------------------------------------------------------
FTSW_BLOPB      ------------------------------------------------------------
FTSW_WIGBR      ------------------------------------------------------------
FTSW_RIEPU      ------------------------------------------------------------
FTSW_HAEIN      ------------------------------------------------------------
FTSW_PASMU      ------------------------------------------------------------
FTSW_HAEDU      ------------------------------------------------------------
FTSW_AERS4      ------------------------------------------------------------
FTSW_TOLAT      ------------------------------------------------------------
FTSW_ALISL      ------------------------------------------------------------
FTSW_VIBVY      ------------------------------------------------------------
FTSW_PHOPR      ------------------------------------------------------------
FTSW_ALTNA      FADAEADYNQAPDLKASDVNAPDMHESSEDAPVAKTKDAGSKKASNTVSPEDEGKAGIKA
FTSW_PSEA6      VAYAVVDDVQDEEQDIDSIMDDFAQDESAQTVSHQTKRASKSTSKTPRGKDEEQEDGYV-
FTSW_PSET1      ------------------------------------------------------------
FTSW_SHESH      ------------------------------------------------------------
FTSW_IDILO      ------------------------------------------------------------
FTSW_ACIAD      ------------------------------------------------------------
                                                                            

FTSW_DICNV      ------------
FTSW_HALNC      ------------
FTSW_FRAST      ------------
FTSW_ALLVD      ------------
FTSW_GEOSK      ------------
FTSW_GEOSL      ------------
FTSW_GEOMG      ------------
FTSW_GEOS8      ------------
FTSW_GEOLS      ------------
FTSW_LARHH      ------------
FTSW_NITSI      ------------
FTSW_AROAE      ------------
FTSW_NITEU      ------------
FTSW_VARPE      ------------
FTSW_THIK1      ------------
FTSW_POLNS      ------------
FTSW_BURTA      ------------
FTSW_TAYEM      ------------
FTSW_NEIG2      ------------
FTSW_LEGPH      ------------
FTSW_NITHN      ------------
FTSW_COXBU      ------------
FTSW_HALHL      ------------
FTSW_ALKEH      ------------
FTSW_THISH      ------------
FTSW_THISK      ------------
FTSW_METCA      ------------
FTSW_METMM      ------------
FTSW_PSEFS      ------------
FTSW_HAHCH      ------------
FTSW_MARHV      ------------
FTSW_SACD2      ------------
FTSW_CELJU      ------------
FTSW_ALCBS      ------------
FTSW_HALED      ------------
FTSW_MARM1      ------------
FTSW_HYDCU      ------------
FTSW_THICA      ------------
FTSW_XANOR      ------------
FTSW_ECO57      ------------
FTSW_ECOL6      ------------
FTSW_ECOLI      ------------
FTSW_MOREP      ------------
FTSW_BUCAI      ------------
FTSW_BUCBP      ------------
FTSW_BLOPB      ------------
FTSW_WIGBR      ------------
FTSW_RIEPU      ------------
FTSW_HAEIN      ------------
FTSW_PASMU      ------------
FTSW_HAEDU      ------------
FTSW_AERS4      ------------
FTSW_TOLAT      ------------
FTSW_ALISL      ------------
FTSW_VIBVY      ------------
FTSW_PHOPR      ------------
FTSW_ALTNA      ILARVSKEASSE
FTSW_PSEA6      ------------
FTSW_PSET1      ------------
FTSW_SHESH      ------------
FTSW_IDILO      ------------
FTSW_ACIAD      ------------