CLUSTAL format seed alignment for MF_00916

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

QUEG_LACGL      -----------------------------MKSLKEEIQKLA-------ADLNIQKIGFTK
QUEG_ENTFA      -----------------------------MPTLKEKIIQES-------QRLGIDKIGFTH
QUEG_STAA8      ----------------------MGGIRLDTKQLKQDIIDYA-------YTIGIDSIGFTT
QUEG_LISMO      ---------------------MVVKQKADYAALKEELIAYA-------YEIGIQKIGFTT
QUEG_BACSU      ---------------------------MNVYQLKEELIEYA-------KSIGVDKIGFTT
QUEG_BACAN      ---------------------------MDFEQLKQDVIAYS-------KTIGIDKIGFAS
QUEG_BACCR      ---------------------------MDFEQLKQDVIAYS-------KTIGIDKIGFAS
QUEG_PROMT      --------------------------MRNSIDLTKKIKEKA-------FEEGFDAVGIAK
QUEG_SYNSC      ---------------------MQGHVTDQQTRLSEALKRRA-------AEEGFNPVGIAR
QUEG_SYNR3      ------------MVSSDTGECFSGATVRVPADLADALKQQA-------LEQGFALAGIAA
QUEG_GLOVI      -----------------------------MAPTAAQIKSRA-------RALGFHKVGIAR
QUEG_ATETH      -----------------------------MLSITEEIKNKG-------RDIGFHKIGIAN
QUEG_THEEB      ------------------------------MVTAAAIKEFA-------HQLGFHRVGIVD
QUEG_SYNY3      --------------------------------------------------MGIAPVSETE
QUEG_ROSLO      -----------------------------MSGLKEKLVARA-------LEEGFIACRICR
QUEG_FLAPJ      -------------------------MINNKSKYTNLIKSEA-------KRLGFLSCGISK
QUEG_CELAD      --------------------------MNTKEKHSDLIKAEA-------IRLGFLSCGISK
QUEG_LEAB4      -----------------------------MRDYSKEIKSWA-------AELGFDFCGISA
QUEG_CYCMS      --------------------------MSTIEKHTQIVKKTA-------SKLGFDYCGIAE
QUEG_FRACF      ------------------------------MKLELSLEQWQQVKDFAIRNLNLSSISKAD
QUEG_ALIF1      -------------------------MKINYQELANNIKLWA-------KELGFQKVGICD
QUEG_VIBCH      ---------------------------MDYQQLANQIKQWA-------IELGFEKVGICD
QUEG_SHEON      -------------MSMTVTTSSNVSDAAMLSRLALQIKSWG-------KALGFAQIGICD
QUEG_YERPE      -----------------------MAHPLDLNQLAQHIKQWG-------QSLGFQQVGICD
QUEG_SALTY      ------------------MLWSIMSKPLDLNQLAQNIKQWG-------LELGFQQVGITD
QUEG_ECOLI      -----------------------MSEPLDLNQLAQKIKQWG-------LELGFQQVGITD
QUEG_SHIDS      -----------------------MSEPLDLNQLAHKIKQWG-------LELGFQQVGITD
QUEG_BURPS      MDRNPELAIADARPSQDGRAAPSRLDDAQLAELASRIKAWG-------RELGFGAIGISD
QUEG_ALIDK      --------------------------MVCSSQLVPRIQGWA-------RELGFSQIGVAG
QUEG_XANCP      --------------------MSAVLARPDPTDAAARIRTLA-------REAGFQRCGITG
QUEG_PSEAE      ---------------MTPQPLADNLSPPDPARLAQSIKDWG-------RELGFQQVGISD
                                                                   ..       

QUEG_LACGL      ADDFEYLR----ASLIEQKEAGHTSGFE--HKNLDERLQPKLSLEDAKTIISIGIAY---
QUEG_ENTFA      AEPFIELE----DSLHEQRERGYNSGFE--HQNVEERIYPEKTFEHPKSIISIALAY---
QUEG_STAA8      ADPFDELK----QKLEAYHANGYASGFE--ESDIALRTEPKLSLPTARSIIAIAVGY---
QUEG_LISMO      ADPFLFLK----ERLLEAEALDLFTGFE--HPVIEERVYPELIFKEPQSIIAIALAY---
QUEG_BACSU      ADTFDSLK----DRLILQESLGYLSGFE--EPDIEKRVTPKLLLPKAKSIVAIALAY---
QUEG_BACAN      ASPFEELK----QRLIQQQQLNYQSGFE--EPDIEKRTNPQLLLSGAKSIIAIALAY---
QUEG_BACCR      ASPFEELK----QRLIQQQQLNYQSGFE--EPDIEKRTNPQLLLPGAKSIIAIALAY---
QUEG_PROMT      VPGSSRIKLRT-ASLERWLQAGHQATMEWMKSP--RRKDIENMLQGVKSILAVGLNYY--
QUEG_SYNSC      IPGSPRLQLRT-KALQRWLDHGHQADMAWMAAP--RRRDPRLLLDGANSVLAVGLNYY--
QUEG_SYNR3      VPSGERIAMRT-AALQRWLAAGHQADMAWMQDP--RRQAIELLLPGVQSVLAVALNYY--
QUEG_GLOVI      ADALDGEAA---ERLGGWLAAGYAGEMRWMHDP--RRRDIQQVLPGVRSVICVALSYN--
QUEG_ATETH      PHIAYQDNAV--SNLQGWLSSGYQADMTWMDNP--KRFDITQCMPDIQSVITVALNYY--
QUEG_THEEB      LRTYTDDHPSGVAALQRWLAQGFQGEMAWMANP--RRQKIQAVLPGAKSVISVALNYY--
QUEG_SYNY3      NDEAA-------QRLQSWIALGYNADMAWMANP--KRQNIRELLPSARSVIAVGLNYY--
QUEG_ROSLO      PDAVPDVA----ARLKAFVDAGYHGQMTWMADRMHWRGDPTQLWPQARSVIMLAESYG--
QUEG_FLAPJ      AGFLEAEA----PRLENWLNKQMNGQMSYMENHFDKRLNPTLLVDDAKSVISLLLNYY--
QUEG_CELAD      ANFLEEEA----PRLEKWLKNNMNGEMQYMENHFDKRLDPRLLVDDAKSVISLTLNYY--
QUEG_LEAB4      ADFLEEEA----PRLERWLNRNYHGKMAYMANHFDKRLDPRKLVDGAKSVVSLLLNYY--
QUEG_CYCMS      ATFLEEEA----PKLENWLNKNYHGKMAYMANHFDKRLDPRKLVEGAKSVVSLMFNYY--
QUEG_FRACF      CDLSEYI-----PYYNKWLENNYHADLEYMVKHGSKRFIPNELVPGTNSVIVATLNYLNR
QUEG_ALIF1      VDLSQHE-----AALEQWLEAGYHGSMDWMARHGVMRARPDELHPGTIRVISARMDYL--
QUEG_VIBCH      VDLSEHE-----PALQAWLDAGYHGEMDWMARHGMMRARPAELLPGTLRVISARINYL--
QUEG_SHEON      TDLTAEE-----AKLQTWLDKGFHGEMAYMETHGMMRARPHELHSGTVRVISARMDYL--
QUEG_YERPE      TDLTAEE-----PRLQAWLDKQYHGEMAWMARHGMLRARPHELLPGTLRVISVRMNYL--
QUEG_SALTY      TDLRASE-----PALQAWLDKQYHGEMAWMARHGMMRARPHELLPGTLRVISVRMNYL--
QUEG_ECOLI      TDLSESE-----PKLQAWLDKQYHGEMDWMARHGMLRARPHELLPGTLRVISVRMNYL--
QUEG_SHIDS      TDLSESE-----PKLQAWLDKQYHGEMDWMARHGMLRARPHELLPGTLRVISVRMNYL--
QUEG_BURPS      TDLSEAE-----AGLAAWLEAGCHGEMDYMAKHGMKRARPAELVAGTRRVISARLAYL--
QUEG_ALIDK      VDLSAAE-----PGLMQWLAEGFHGEMHYMAAHGLRRARPAELVPGTVSVITARMDYL--
QUEG_XANCP      IELGEDE-----AHLRSWLAEGLYGTMHWMAQHGDKRSRPQELVPGTLRVLSVGMDYG--
QUEG_PSEAE      VELGEHE-----AHLQRWLEAGYHGEMDYMAAHGSKRSRPAELVPGTLRVISLRMDYL--
                                          :         *            ::     *   

QUEG_LACGL      PNKAEEK----------------PE-KTEYRRGSFSRGSWGEDYHHVLRRKLKELAEGIE
QUEG_ENTFA      PTKAQEK------------------MPRDEKRGQFARASWGIDYHHILQDRLQKLIAFIE
QUEG_STAA8      PNKLKGA----------------PKSVRGDRRGLFARASWGQDYHTIMRKRLDMLAAFIE
QUEG_LISMO      PSKLKEA----------------PVSKKGARRGVFARASWGIDYHTVLREKLALLETFLI
QUEG_BACSU      PSRMKDA----------------PRSTRTERRGIFCRASWGKDYHDVLREKLDLLEDFLK
QUEG_BACAN      PSKLKNA----------------PLSKRGERRGIFCRASWGQDYHLVLRDRLQKLEAYLI
QUEG_BACCR      PSKLKNA----------------PLSKRGERRGIFCRASWGQDYHLVLRDRLQKLEAYLI
QUEG_PROMT      VDTERE-----------------------SKDISIARYGWGKDYHKIIEEKLKKVAKFLE
QUEG_SYNSC      VDAQPS-----------------------PGSLKVARYGWGRDYHRVVDQRLRRIGRWLS
QUEG_SYNR3      VDQQQT-----------------------PASPKIARYGWGRDYHRVMDQRLRRLGRWLE
QUEG_GLOVI      TAQGEPA----------------------PGQARISRYALGRDYHKVLGKPLKELARWIE
QUEG_ATETH      TPHQHSS---------------------NSRYGKVSRYAWGKDYHKVLSQKLKLFCKWLN
QUEG_THEEB      QPDPQP-----------------------PPKVKIARYAWGRDYHRVLGKRLQVLGQWLQ
QUEG_SYNY3      TPHQRSG---------------------DPAHGKISRYAWGRDYHRVLTKKLKALNLWLE
QUEG_ROSLO      PEHDPMA-----------------VLQ-QPERGAISVYAQGRDYHDVVKKRLKRLARWLM
QUEG_FLAPJ      PSEIQNT-----------------------NSYKISKYAYGQDYHFVIKEKLTALLHFIQ
QUEG_CELAD      PEEQQAD-----------------------GTYKISKYAYGHDYHHVIKGKLKQLQEFIS
QUEG_LEAB4      PEEPLDA-----------------------SPYKISKYAYGKDYHYVIKDKLKLLFERIQ
QUEG_CYCMS      PQQNLDE---------------------SRNALKIAKYAYGEDYHFVIKDKLKEFLKCLK
QUEG_FRACF      PVNVKTE---------------VKRLRTTSNIADISIYAHGRDYHKVMKKKLQQLGEFID
QUEG_ALIF1      PPKAGFA----------------SNLK-DPNQAYISRYALGRDYHKLIRNQLKKLGQKIE
QUEG_VIBCH      PPQAQFA----------------SNLS-DPNQAYISRYALGRDYHKLVRNQLKKLGEKIE
QUEG_SHEON      PPEAGFA----------------TNLA-SPNMGYISRYAGGRDYHKLIRARLKKLGDQIN
QUEG_YERPE      PAKAAFA----------------STLN-NPELGYVSRYALGRDYHKLLRQRLKKLGDQIQ
QUEG_SALTY      PANAAFA----------------STLK-DPTLGYVSRYALGRDYHKLLRSRLKKLGEQIQ
QUEG_ECOLI      PANAAFA----------------STLK-NPKLGYVSRYALGRDYHKLLRNRLKKLGEMIQ
QUEG_SHIDS      PANAAFA----------------STLK-NPKLGYVSRYALGRDYHKLLRNRLKKLGEMIQ
QUEG_BURPS      PAGTLDGAPDAQGARRDWRAREAARIA-DPQAAVVSVYARGRDYHKVLRNRLQTLAERIE
QUEG_ALIDK      PRTTPEG----------WQAVEFERLR-RPQEAIVSVYARGRDYHKVLRARLQKLSDRIA
QUEG_XANCP      RKDDTEA----------------WDTLHDGRRAYVARYALGRDYHKLMRNRLQKLAERIQ
QUEG_PSEAE      PGDTRMA-----------------QVLATPEKAYVSRYALGRDYHKLIRKRLQQLAERIQ
                                                  ..  . * *** ::   *  .   : 

QUEG_LACGL      KIAG--------------------------------DFNYTAMVDTGALVDVAVAARAGL
QUEG_ENTFA      EQAA--------------------------TEAEKEHWRFRPQVDTGEYVDTAVAQRAGL
QUEG_STAA8      SKVP--------------------------------DVEIKSMVDTGVLSDRAVAERAGL
QUEG_LISMO      ERLP--------------------------------DVRMKSMVDTGELSDVAVAERAGI
QUEG_BACSU      SKHE--------------------------------DIRTKSMVDTGELSDRAVAERAGI
QUEG_BACAN      EKLP--------------------------------DIEVKSMVDTGELSDRAVSERAGI
QUEG_BACCR      EKLP--------------------------------DIEVKSMVDTGELSDRAVSERAGI
QUEG_PROMT      TERP--------------------------------NAKWKICVDTSAFLDKAWAEEAGI
QUEG_SYNSC      EQRP--------------------------------DCGWRACVDATPLLDKAWAEEAGL
QUEG_SYNR3      EQQP--------------------------------SCRWRACVDSAPLMDKAWAEEAGL
QUEG_GLOVI      ASDP--------------------------------GCRAVAYVDTGPVQEKAWAEAAGL
QUEG_ATETH      NR----------------------------------GIKTTCYVDTGPIQEKVWAERSGV
QUEG_THEEB      SQVP--------------------------------EMDYRWYVDTGPVQDKVWAEQAGI
QUEG_SYNY3      QQVP--------------------------------DLQSRYYVDTGPIQEKAWAERAGL
QUEG_ROSLO      AEAA------------------------------DADPQVKVFVDTAPVPEKALGQAAGL
QUEG_FLAPJ      TEIG--------------------------------EVSGRAFVDSAPVLDKAWAAKSGL
QUEG_CELAD      EEIG--------------------------------EVGGRAFVDSAPVLDKAWAAKSGL
QUEG_LEAB4      KEIG--------------------------------EVGGRIFVDSAPVMDKIWAKKAGL
QUEG_CYCMS      EEIG--------------------------------EVHGRVFVDSAPVMERQWAVKAGL
QUEG_FRACF      ELTG--------------------------------GHQFRVFTDSAPVLERPLAEKAGL
QUEG_ALIF1      EEVE--------------------------------QLGYRPFVDSAPILERPLAEKAGL
QUEG_VIBCH      QEVG--------------------------------KLGYRPFVDSAPILERPLAQKAGL
QUEG_SHEON      SELV---------------------------ALGFDAADFRPFVDSAPVLERPLAEKAGI
QUEG_YERPE      HYCLEQNNLDRHDLELHDLEQHDSERQGQPEQHTASEINFRPFVDSAPIMERSLAAKAGI
QUEG_SALTY      QYCG--------------------------------SLNFRPFVDSAPILERPLAEKAGL
QUEG_ECOLI      QHCV--------------------------------SLNFRPFVDSAPILERPLAEKAGL
QUEG_SHIDS      QHCV--------------------------------SLNFRPFVDSAPILERPLAEKAGL
QUEG_BURPS      AEIG--------------------------------AFGHRVFTDSAPVLEVELAQKAGV
QUEG_ALIDK      EAVG--------------------------------PFGHRVFTDSAPVLEAELARRSGQ
QUEG_XANCP      AEVG--------------------------------PFGYRVFVDSAPVLERALARNAGL
QUEG_PSEAE      AEVG--------------------------------PFGFRAFVDSAPVLEKAIAEQAGL
                                                           .*:    :   .  :* 

QUEG_LACGL      GFVGKNGLLVSKEYGSWMFLGELVTNLDIE--EDQP-VDY--------GCGSCTRCVDFC
QUEG_ENTFA      GFIGKNGLLITEEFGSFVYLGEVTTNIQFE--PDEP-VPN--------GCGDCTRCITGC
QUEG_STAA8      GFVGRNGFVINPKLGTWTYLGEMLVSIPFE--PDDP-LLD--------SCGDCTICVDRC
QUEG_LISMO      GWRGKNTLLITPEYGSWVYLGEMITNIPFE--PDTP-ASD--------LCGSCNQCVKAC
QUEG_BACSU      GFSAKNCMITTPEYGSYVYLAEMITNIPFE--PDVP-IED--------MCGSCTKCLDAC
QUEG_BACAN      GWSGKNCSIITPEFGSYVYLGEMITNVPFP--PDQP-IED--------QCGSCTKCIDIC
QUEG_BACCR      GWSGKNCSIITPEFGSYVYLGEMITNVPFP--PDKP-IED--------QCGGCTKCIDIC
QUEG_PROMT      GWIGKHSNVINSEIGSWMFLGHLLSTEVLE--ADKP-SKP--------ICGECEKCIEAC
QUEG_SYNSC      GWIGKHSNLIHPERGSWMVIGHLLTTEPLN--ADPP-ARS--------LCGRCSACIDAC
QUEG_SYNR3      GWIGKNGNLISPSHGSWLLLGHLLTTASLP--ADQP-ARS--------LCGHCQRCLPAC
QUEG_GLOVI      GWIGKNACLITLEYGSWVFLGEILTTLDLE--ANDP-HPN--------YCGTCTRCLSAC
QUEG_ATETH      GWIAKNGNVITKEFGSWVFLGVVLTNLSLT--SDTP-HAK--------YCGTCRKCLDIC
QUEG_THEEB      GWIGKHSNVISRQYGSWILLGELITTLELT--GDRP-HTN--------HCGTCTRCLAAC
QUEG_SYNY3      GWVGKNGNLISRDYGSWLFLGEIVTNITLQ--GDRP-HSQ--------HCGTCTRCLEAC
QUEG_ROSLO      GWQGKHTNLLSREWGNWAFLGAVFTTLDIA--PDAA-EVD--------HCGSCRACLDVC
QUEG_FLAPJ      GWIGKNSNLLTKQVGSFYFIAELIIDLDLE--YDNP-TTD--------HCGSCTACIDAC
QUEG_CELAD      GWIGKHSNLLTQKTGSFYFIAELIVDLDLT--YDHP-VTD--------HCGTCTACIDAC
QUEG_LEAB4      GWVGKNSNLINRKMGSFFFIAELILDLPLQ--ADGP-IRD--------YCGTCTACIDAC
QUEG_CYCMS      GWKGKNSLLLNKSSGSFFFLAELIIDLPLI--YDNPSDKD--------YCGTCTRCVDAC
QUEG_FRACF      GWQGKSSMLMNKAQGSFFFIGVIYSNLDLSKLPDSPKHQD--------SCGKCQACIKLC
QUEG_ALIF1      GWTGKHSLLLDKNAGSWFFLGELLVDIPLP--VDTP-VEN--------QCGKCTACISSC
QUEG_VIBCH      GWTGKHSLILDKENGSWFFLGELLVDIPLP--VDEP-SEN--------QCGKCTACITSC
QUEG_SHEON      GWTGKHSLILNHDAGSWFFLGELLINLPLP--VDIP-VQE--------GCHSCVACITSC
QUEG_YERPE      GWVGKHSLILNRDAGSWFFLGELLIDLPLP--VDKP-QEE--------QCGRCVACMTTC
QUEG_SALTY      GWTGKHSLILNREAGSFFFLGELLIDLPLP--VDQP-VEE--------GCGKCVACMTIC
QUEG_ECOLI      GWTGKHSLILNREAGSFFFLGELLVDIPLP--VDQP-VEE--------GCGKCVACMTIC
QUEG_SHIDS      GWTGKHSLILNREAGSFFFLGELLVDIPLP--VDQP-VEE--------GCGKCVACMTIC
QUEG_BURPS      GWRGKHTLLLQRDAGSFFFLGEIYVDVPLP--ADAQTSPDAAPETPGAHCGSCTRCLGAC
QUEG_ALIDK      GWRGKHTLVLSREAGSMFFLGEIYLDMALA--PTEP-VTA--------HCGSCQACMDVC
QUEG_XANCP      GWIGKHTCLIDRGGGSWFFLGEIYLDLPLP--IDTP-ATA--------HCGTCTRCIDIC
QUEG_PSEAE      GWIGKNTLVLNRKAGSYFFLGELFVDMPLP--VDPAMDSE--------HCGRCSACLDIC
                *: ..   :     *.   :. :     :                    *  *  *:  *

QUEG_LACGL      PTKALLGDGRLNAQRCLSYQT-QTRGV-MPEEYREKIKTVIYGCDICQVVCPYN----KG
QUEG_ENTFA      PTGALLGDGRMNAQKCLSYQT-QTKGM-MPEDYRKKMRNVIYGCDICQLVCPYN----KG
QUEG_STAA8      PTSALVGNGQLNSQKCISFLT-QTKGY-MPDQYRYKIGNRLYGCDTCQQVCPKN----RG
QUEG_LISMO      PTGSLLGEGKMNPKICLSYLT-QTKDF-LDEKYREVLHNRLYGCDTCQVVCPYN----RG
QUEG_BACSU      PTGALVNPGQLNAQRCISFLT-QTKGF-LPDEFRTKIGNRLYGCDTCQTVCPLN----KG
QUEG_BACAN      PTGALIQGGQLDSKKCIAFLT-QTKGF-LPEEYRDKIGNRIYGCDTCQTVCPKN----KG
QUEG_BACCR      PTGALIQGGQLDSKKCIAFLT-QTKGF-LPEEYRDKIGNRIYGCDTCQTVCPKN----KG
QUEG_PROMT      PTKAIEEPFIVNSYKCLAYHTLENRDQELPENIINKMGNWIAGCDICQDVCPWN---QKH
QUEG_SYNSC      PTHAIREPFVVDARRCLAFHTIENREDDLPENIRAALGSWVAGCDICQDVCPWN---HRS
QUEG_SYNR3      PTAAITEPFVVDSRRCIAFHTIENRDEQVPLPLHG----WVAGCDVCQEVCPWN---QHH
QUEG_GLOVI      PTAALVEPAVVDARKCLAYHTIENRAPELPEAIAEHQHGWVVGCDLCQTCCPFNLRAERW
QUEG_ATETH      PTKAIVHPFVVDSRRCIAYNTIENRSNDFPEYIKNNLNGWIAGCDLCQDVCPWN---KRF
QUEG_THEEB      PTGAIVEPYVVDANRCIAYHTIESRAPELPAAIAAHLEGWVAGCDICQEVCPWN---QRF
QUEG_SYNY3      PTQAIVEPFVVDSNKCIAYHTIENRAEILPTAIADNLQGWVAGCDICQDVCPWN---QRF
QUEG_ROSLO      PTDAFPAPYKLDARRCISYLTIEHKGP-VPTDLRPLLGNRIYGCDDCLAVCPWN----KF
QUEG_FLAPJ      PTDAIVAPYIVDGSKCISYFTIELKEN-IPTEMKGKFNDWAFGCDVCQDVCPWN----KF
QUEG_CELAD      PTQAIVQPYVVDGSKCISYFTIELKNE-IPQEFQGKFDDWAFGCDVCQDVCPWN----RF
QUEG_LEAB4      PTDAIT-PYEVDGSKCISYLTIELKDQ-IPNEFKGKMENWIFGCDICQDVCPWN----SF
QUEG_CYCMS      PTDAILQDNLIDGSKCISYLTIELKEA-IPDDFKGKMENWVFGCDICQDVCPWN----RF
QUEG_FRACF      PTGAIQPGKMIDSRKCISYLTIENKGS-IPLELRDKIGTRIYGCDDCQLVCPFN----NY
QUEG_ALIF1      PTNAILENGVIDARRCISYLTIENSGI-IPEEFRSLMGNRIYGCDDCQLVCPWN----RE
QUEG_VIBCH      PTNAIVAEGVVDARRCVSYLTIEYSGV-IPLEFRRAMGNRIYGCDDCQLVCPWN----RF
QUEG_SHEON      PTGAIVEPYTVDARRCISYLTIELQGA-IPEEFRPLMGNRIYGCDDCQLVCPVN----RA
QUEG_YERPE      PTGAIVAPYTVDARRCISYLTIELEGA-IPEEFRPLMGNRIYGCDDCQLICPWN----RF
QUEG_SALTY      PTGAIVEPYTVDARRCISYLTIELEGA-IPEAFRPLIGNRIYGCDDCQLICPWN----RY
QUEG_ECOLI      PTGAIVEPYTVDARRCISYLTIELEGA-IPEELRPLMGNRIYGCDDCQLICPWN----RY
QUEG_SHIDS      PTGAIVEPYTVDARRCISYLTIELEGA-IPEELRPLMGNRIYGCDDCQLICPWN----RY
QUEG_BURPS      PTGAIVAPYRVDARRCISYLTIELHGS-IPEPLRPLIGNRVYGCDDCQLVCPWN----KF
QUEG_ALIDK      PTQAIVAPHRVDARRCISYLTIEHAGP-IPPALRPLMGNRIYGCDDCQLICPWN----KF
QUEG_XANCP      PTQAIIAPHRLDARRCIAYLTIEHDGA-IPEDMRKPIGNRIFGCDDCQLICPWN----KF
QUEG_PSEAE      PTAAFVGPYRLDARRCISYLTIEYKGA-IPLELRPLIGNRVFGCDDCQIVCPWN----RF
                ** ::     ::   *::: * :     .             *** *   ** *      

QUEG_LACGL      INSHFHPEMEPDPDLTNPELLPLLDLSNKEFANKFGNMAGSWRGKNPIQRNVVYALGNA-
QUEG_ENTFA      KDFHFHEEMEPKIEEVYPKLAPLLTISNKEFKQQFGHLAGSWRGKKPLQRNALIALANL-
QUEG_STAA8      IN-TEQDDIILEPEILKPRLVPLLRMSNKEFKQTYGHLAGAWRGKKPIQRNAILALAHF-
QUEG_LISMO      HDFHFHEEMEPDPELVRPELKPLLHISNRAFKEQFGDMAGSWRGKKPIQRNAIIILARY-
QUEG_BACSU      KDFHLHPEMEPDPEIAKPLLKPLLAISNREFKEKFGHVSGSWRGKKPIQRNAILALAHF-
QUEG_BACAN      MDFHNHPEMEPDPELVKPLLTPLLTISNRDFKEKYGIMSGSWRGKKPLQRNAILALAHF-
QUEG_BACCR      MDFHNHPEMEPDPELVKPLLTPLLTISNRDFKEKYGIMSGSWRGKKPLQRNAILALAHF-
QUEG_PROMT      IPSTTEPDLQPSEWILHTTKQDLLSWDDAKWKESLKNSALKRIKPWMWRRNIDSISKKT-
QUEG_SYNSC      LPQSNDPDMQPRPWLLNLHKEEIQTWDDSVWEQKLRGSALRRIKPWMWRRNAAAAQPD--
QUEG_SYNR3      AQSSADPAVQPREWILSSTVNEMASWSDDTWSERLQASALRRIKPWMWRRNLA-DLG---
QUEG_GLOVI      GRYSEVADFAPRDPWNEITLDQLADLSDAEFERWSEGSAIRRVKASGLRRNARSALGAS-
QUEG_ATETH      SKETNIQDFYPQPGNISLDLKEISNLTEIQWQQKFSSSSLKRIKVKAWRRNAKANL----
QUEG_THEEB      AQPTDVEDFAARSPLLQTSLEELATLSDAAWDELTRGSALRRIKSAQWRRNAQAVLSSN-
QUEG_SYNY3      AQPTDVADFDPYEGNLNPELETLANITEADWQQQFTASALRRIKPAMLRRNAQANLQ---
QUEG_ROSLO      ATAARDMRLSARPELTAPRLADLAALDDAAFRALFSGSAVKRIGRNRFVRNVLYAIGNS-
QUEG_FLAPJ      SKPHNEPLFNPNPEVLSFTKKDWEEITEEIFKKTFKDSAVKRTKIGGLKRNINFLKD---
QUEG_CELAD      SKPHSEPLFNPHPDLLSLTKKDWEEITDDVFKKVFQKSAVKRTKYAGLKRNIDFLK----
QUEG_LEAB4      ARPHSTEEFYPNENL--KTFQDWDEITSEIFSHLFKKSAVERTKLEGLKRNIAFVKEV--
QUEG_CYCMS      SKPHKEEAFLPHADLEKSA---WEEMTKETFNKVFKRSALKRTKWEGFQRNIHFVKNEA-
QUEG_FRACF      APITTEKDFQQRDFLVNKPLLELLAWSEKDFDKYTQGSAIRRIGYAAWIRNIAIAVGNS-
QUEG_ALIF1      AEITQQADFHRRSSLGNSDLISLFSWDESTFLKNMEGSAIRRIGHIQWLRNLSIAMGNA-
QUEG_VIBCH      APLTQQSDFHRRQSLNNADLVVLFEWDEATFLKNMEGSAIRRIGHQQWRRNLIIAMGNA-
QUEG_SHEON      APLTQESDFHIRPKLKQPELLTLFTWSETEFLKQTEGSAIRRIGHQRWLRNIAVALGNA-
QUEG_YERPE      SQLTDEDDFSPRAVLHTPQLLDLFAWNEEKFLRVTEGSAIRRIGHLRWLRNISVALGNA-
QUEG_SALTY      SQLTDEADFSPRKALHNPDLLELFSWSEAQFLKVTEGSAIRRIGHLRWLRNVAVALGNA-
QUEG_ECOLI      SQLTTEEDFSPRKPLHAPELIELFAWSEEKFLKVTEGSAIRRIGHLRWLRNIAVALGNA-
QUEG_SHIDS      SQLTTEDDFSPRKPLHAPELIELFAWSEEKFLKVTEGSAIRRIGHLRWLRNIAVALGNA-
QUEG_BURPS      AQAAPVADFDVRHGLDRASLVELFEWTAEQFDERMQGSAIRRIGYERWLRNLAVGLGNAL
QUEG_ALIDK      AQPSSLPDFDARAPLEGQQLAQLFAWDEAMFLRMTEGGPIRRIGHERWLRNIAVALGNAL
QUEG_XANCP      AQRTDEPDFRARNDLDVATLPQLFAWDEAEFLRRTEGSPIRRSGHERWLRNIAVGLGNA-
QUEG_PSEAE      ARPTGQGDFQPRHSLDNAELAELFLWSEEEFLGRTEGSPLRRAGYERWLRNLAVGLGNA-
                        .                     :       .  .       **         

QUEG_LACGL      ---------NDRSALPKLHDIAEND--VRDYMVDAAEWAIEKLENKHRMRPRKR------
QUEG_ENTFA      ---------GGREAIPQIILCLNDQ---RPVIRGTAAWSLGQLAKREPEQSLEALNYLLS
QUEG_STAA8      ---------NEVDAIPELKKVATTD--ERPLIRATAYWAIGQILGEEARDFINA---NYD
QUEG_LISMO      ---------KDKTAVPDLIDCLQND--PRPVIRGTAGWALRKIGGRDAEEAVER---ALQ
QUEG_BACSU      ---------KDASALPELTELMHKD--PRPVIRGTAAWAIGKIGDPAYAEELEK---ALE
QUEG_BACAN      ---------KEASAIPDLIGVMKDD--PRPVLRGTAAWALGKIGGDGVGEAIEK---AMQ
QUEG_BACCR      ---------KEASAIPDLIGVMKDD--PRPVLRGTAAWALGKIGGDGVGEAIEK---AME
QUEG_PROMT      ------------------------------------------------------------
QUEG_SYNSC      ---------------------------PTPTL----------------------------
QUEG_SYNR3      ------------------------------------------------------------
QUEG_GLOVI      ---------GDSLAQAH-------------------------------------------
QUEG_ATETH      ------------------------------------------------------------
QUEG_THEEB      ---------PYD------------------------------------------------
QUEG_SYNY3      ------------------------------------------------------------
QUEG_ROSLO      ---------GEAS-LRQIASELTDD--PDDAVADAARWAVAQLGG---------------
QUEG_FLAPJ      ------------------------------------------------------------
QUEG_CELAD      ------------------------------------------------------------
QUEG_LEAB4      ------------------------------------------------------------
QUEG_CYCMS      ---------S--------------------------------------------------
QUEG_FRACF      ---------PFNQDNIQALELKKLEFSDNQLVLEHLDWAINKQKLLS-------------
QUEG_ALIF1      ---------PHSEAIISALQDRLGL---DENLDIHIQWAIKQQSLVIT-----------S
QUEG_VIBCH      ---------PYSPRIIDTLQRHLGQ---SELLDEHIHWALEEQTQKTA-----------T
QUEG_SHEON      ---------PSSADIISALEQRKAQADVDEMVKEHIDWALAQQRAGDLQT---------N
QUEG_YERPE      ---------PYLDSIVLALETRRGL---HPMLDEHIEWAISQQLARRATQAVEV-----Q
QUEG_SALTY      ---------PWSNAVITALESRKGE---HPLLDEHIEWAIAQQIEKRNACIIEV-----Q
QUEG_ECOLI      ---------PWDETILTALESRKGE---HPLLDEHIAWAIAQQIERRNACIVEV-----Q
QUEG_SHIDS      ---------PWDETILAALESRKGE---HPLLDEHIAWAIAQQIERRNACIVEV-----Q
QUEG_BURPS      RAAPGGIGPDARAAIVAALRARLDDPCVSALVREHVEWALRAA-----------------
QUEG_ALIDK      RATRDA---GEAGALRAALATRAND--ASALVREHVAWALAQ-GI---------------
QUEG_XANCP      ---------PGSEDVLAALESRRHD--DSALVREHVGWALAQHGL---------------
QUEG_PSEAE      ---------PSTIPVLEALKARRGF--PSELVREHVEWALRRHGET--------------
                                                                            

QUEG_LACGL      -----------------------------
QUEG_ENTFA      VETEEEVIEEAQKAIHLLTSKKGSRSTE-
QUEG_STAA8      QE-DAEVQNEMIKGLDTRRE---------
QUEG_LISMO      TEQDVQVLQELTAIPN-------------
QUEG_BACSU      KEKDEEAKLEIEKGIELLKASGMTKQGLS
QUEG_BACAN      REKDEEVLHEMNRGLELLAQKKE------
QUEG_BACCR      REKDEEVLHEMNRGLELLAQKKE------
QUEG_PROMT      -----------------------------
QUEG_SYNSC      -----------------------------
QUEG_SYNR3      -----------------------------
QUEG_GLOVI      -----------------------------
QUEG_ATETH      -----------------------------
QUEG_THEEB      -----------------------------
QUEG_SYNY3      -----------------------------
QUEG_ROSLO      -----------------------------
QUEG_FLAPJ      -----------------------------
QUEG_CELAD      -----------------------------
QUEG_LEAB4      -----------------------------
QUEG_CYCMS      -----------------------------
QUEG_FRACF      -----------------------------
QUEG_ALIF1      NRKEQRLIRIIEKGLPRDA----------
QUEG_VIBCH      PRQHARLIRIIEKGLPRDA----------
QUEG_SHEON      NRKTERLVRVIQKGLPRDA----------
QUEG_YERPE      LPQKKRLIRAIEKGLPRDA----------
QUEG_SALTY      LPKKQRLVRVIEKGLVRDA----------
QUEG_ECOLI      LPKKQRLVRVIEKGLPRDA----------
QUEG_SHIDS      LPKKQRLVRVIEKGLPRDA----------
QUEG_BURPS      -----------------------------
QUEG_ALIDK      -----------------------------
QUEG_XANCP      -----------------------------
QUEG_PSEAE      -----------------------------