CLUSTAL format seed alignment for MF_00918

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y311_STRP8        ---MGRKWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQG-EPDPELNTALKFVIDRAKQ
Y316_STRP1        ---MGRKWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQG-EPDPELNTALKFVIDRAKQ
Y287_STRPB        ---MGRKWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQG-EPDPELNTALKFVIDRAKQ
Y231_STRP3        ---MGRKWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQG-EPDPELNTALKFVIDRAKQ
Y265_STRPZ        ---MGRKWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQG-EPDPELNTALKFVIDRAKQ
Y266_STRPD        ---MGRKWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQG-EPDPELNTALKFVIDRAKQ
Y268_STRPC        ---MGRKWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQG-EPDPELNTALKFVIDRAKQ
Y261_STRPM        ---MGRKWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQG-EPDPELNTALKFVIDRAKQ
Y1586_STRPG       ---MGRKWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQG-EPDPELNTTLKFVIDRAKQ
Y264_STRPF        ---MGRKWANIVAKKTAKDGATSKIYAKFGVEIYVAAKQG-EPDPELNTALKFVIDRAKQ
Y297_STRP6        ---MGRKWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQG-EPDPELNTALKFVIDRAKQ
Y1645_STRA5       ---MGRKWANIVAKKTAKDGANSKVYAKFGVEIYVAAKQG-EPDPESNSALKFVLDRAKQ
Y1658_STRA1       ---MGRKWANIVAKKTAKDGANSKVYAKFGVEIYVAAKQG-EPDPESNSALKFVLDRAKQ
Y1691_STRA3       ---MGRKWANIVAKKTAKDGANSKVYAKFGVEIYVAAKQG-EPDPESNSALKFVLDRAKQ
Y364_STRU0        ---MGRKWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQG-DPDPESNSALKFVIDRAKQ
Y1681_STREM       ---MGRKWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQG-EPDPELNTALKFVIDRAKQ
Y1904_STRE4       ---MGRKWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQG-EPDPELNTALKFVIDRAKQ
Y293_STRS7        ---MGRKWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQG-EPDPELNTALKFVIDRAKQ
Y195_STRT2        MNPMGRKWANIVAKKTAKDGANSKIYAKFGVEIYVAAKQG-EPDPESNSALKFVLERAKQ
Y242_STRTD        ---MGRKWANIVAKKTAKDGANSKIYAKFGVEIYVAAKQG-EPDPESNSALKFVLERAKQ
Y195_STRT1        MNPMGRKWANIVAKKTAKDGANSKIYAKFGVEIYVAAKQG-EPDPESNSALKFVLERAKQ
Y1789_STRMU       ---MGRKWANIVAKKTAKDGANSKVYAKFGVEIYVAAKQG-EPDPESNSALKFVLERAKQ
Y1725_STRP2       ---MGRKWANIVAKKTAKDGANSKVYAKFGVEIYVAAKKG-DPDPESNSALKFVIDRAKQ
Y1897_STRPS       ---MGRKWANIVAKKTAKDGANSKVYAKFGVEIYVAAKKG-DPDPESNSALKFVIDRAKQ
Y1835_STRP4       ---MGRKWANIVAKKTAKDGANSKVYAKFGVEIYVAAKKG-DPDPESNSALKFVIDRAKQ
Y1871_STRZT       ---MGRKWANIVAKKTAKDGANSKVYAKFGVEIYVAAKKG-DPDPESNSALKFVIDRAKQ
Y1919_STRZJ       ---MGRKWANIVAKKTAKDGANSKVYAKFGVEIYVAAKKG-DPDPESNSALKFVIDRAKQ
Y1922_STRPN       ---MGRKWANIVAKKTAKDGANSKVYAKFGVEIYVAAKKG-DPDPESNSALKFVIDRAKQ
Y1946_STRPJ       ---MGRKWANIVAKKTAKDGANSKVYAKFGVEIYVAAKKG-DPDPESNSALKFVIDRAKQ
Y1952_STRZP       ---MGRKWANIVAKKTAKDGANSKVYAKFGVEIYVAAKKG-DPDPESNSALKFVIDRAKQ
Y1738_STRR6       ---MGRKWANIVAKKTAKDGANSKVYAKFGVEIYVAAKKG-DPDPESNSALKFVIDRAKQ
Y2002_STRP7       ---MGRKWANIVAKKTAKDGANSKVYAKFGVEIYVAAKKG-DPDPESNSALKFVIDRAKQ
Y2064_STRPI       ---MGRKWANIVAKKTAKDGANSKVYAKFGVEIYVAAKKG-DPDPESNSALKFVIDRAKQ
Y586_STRSV        ---MGRKWANIVAKKTAKDGANSKVYAKFGVEIYVAAKKG-DPDPESNTALKFVIDRAKQ
Y454_STRGC        ---MGRKWANIVAKKTAKDGANSKVYAKFGVEIYVAAKKG-DPDPETNTALKFVIDRAKQ
Y387_STRS2        ---MGRKWANIVAKKTAKDGANSKVYAKFGVEIYVAAKKG-DPDPETNSALKFVIDRAKQ
Y402_STRSY        ---MGRKWANIVAKKTAKDGANSKVYAKFGVEIYVAAKKG-DPDPETNSALKFVIDRAKQ
Y237_LACLS        ---MGRKWANIVAKKTAKDGATSKVYAKFGVEIYAAAKQG-EPDPESNSSLKFVIERAKQ
Y242_LACLM        ---MGRKWANIVAKKTAKDGATSKVYAKFGVEIYAAAKQG-EPDPESNSSLKFVIERAKQ
YCDB_LACLA        ---MGRKWANIVAKKTAKDGATSKVYAKFGVEIYAAAKQG-EPDPESNSSLKFVIERAKQ
YEEN_ECO57        ---MGRKWANIVAKKTAKDGATSKIYAKFGVEIYAAAKQG-EPDPELNTSLKFVIERAKQ
YEEN_SHISS        ---MGRKWANIVAKKTAKDGATSKIYAKFGVEIYAAAKQG-EPDPELNTSLKFVIERAKQ
YEEN_ECOL5        ---MGRKWANIVAKKTAKDGATSKIYAKFGVEIYAAAKQG-EPDPELNTSLKFVIERAKQ
YEEN_SHIBS        ---MGRKWANIVAKKTAKDGATSKIYAKFGVEIYAAAKQG-EPDPELNTSLKFVIERAKQ
YEEN_ECOUT        ---MGRKWANIVAKKTAKDGATSKIYAKFGVEIYAAAKQG-EPDPELNTSLKFVIERAKQ
YEEN_ECOL6        ---MGRKWANIVAKKTAKDGATSKIYAKFGVEIYAAAKQG-EPDPELNTSLKFVIERAKQ
YEEN_ECOLI        ---MGRKWANIVAKKTAKDGATSKIYAKFGVEIYAAAKQG-EPDPELNTSLKFVIERAKQ
YEEN_SHIFL        ---MGRKWANIVAKKTAKDGATSKIYAKFGVEIYAAAKQG-EPDPELNTSLKFVIERAKQ
YEEN_SALCH        ---MGRKWANIVAKKTAKDGATSKVYAKFGVEIYAAAKQG-EPDPESNSALKFVIERAKQ
YEEN_SALPA        ---MGRKWANIVAKKTAKDGATSKVYAKFGVEIYAAAKQG-EPDPESNSALKFVIERAKQ
YEEN_SALTI        ---MGRKWANIVAKKTAKDGATSKVYAKFGVEIYAAAKQG-EPDPESNSALKFVIERAKQ
YEEN_SALTY        ---MGRKWANIVAKKTAKDGATSKVYAKFGVEIYAAAKQG-EPDPESNSALKFVIERAKQ
B1MWS5_LEUCK      ------------MKKAQTDGAAAKVNSKYGIEIYAAAKQGGSVDPEANSTLKFVIDRAKQ
Y3259_HALH5       ---MGRKWNNIKEKKAAKDKNTSRIYAKFGREIYVAAKQG-EPDPELNQALKFVLERAKT
Y743_BACP2        ---MGRKWNNIKEKKASKDASTSRIYAKFGREIYVAAKQG-EPNPESNQALRFVLERAKT
Y153_EXISA        ---MGRKWNNIKEKKASKDANTSRVYAKFGREIYVAARQG-EPDPELNQSLKFVVERAKT
Y4045_BACAC       ---MGRKWNNIKDKKASKDANTSRIYAKFGREIYVAAKQG-EPDPESNQALRVVLERAKT
Y622_BACAA        ---MGRKWNNIKDKKASKDANTSRIYAKFGREIYVAAKQG-EPDPESNQALRVVLERAKT
Y449_BACCZ        ---MGRKWNNIKDKKASKDANTSRIYAKFGREIYVAAKQG-EPDPESNQALRVVLERAKT
Y541_BACAN        ---MGRKWNNIKDKKASKDANTSRIYAKFGREIYVAAKQG-EPDPESNQALRVVLERAKT
Y541_BACC0        ---MGRKWNNIKDKKASKDANTSRIYAKFGREIYVAAKQG-EPDPESNQALRVVLERAKT
Y578_BACC3        ---MGRKWNNIKDKKASKDANTSRIYAKFGREIYVAAKQG-EPDPESNQALRVVLERAKT
Y453_BACHK        ---MGRKWNNIKDKKASKDANTSRIYAKFGREIYVAAKQG-EPDPESNQALRVVLERAKT
Y595_BACC1        ---MGRKWNNIKDKKASKDANTSRIYAKFGREIYVAAKQG-EPDPESNQALRVVLERAKT
Y605_BACCQ        ---MGRKWNNIKDKKASKDANTSRIYAKFGREIYVAAKQG-EPDPESNQALRVVLERAKT
Y615_BACC7        ---MGRKWNNIKDKKASKDANTSRIYAKFGREIYVAAKQG-EPDPESNQALRVVLERAKT
Y539_BACCR        ---MGRKWNNIKDKKASKDANTSRIYAKFGREIYVAAKQG-EPDPESNQALRVVLERAKT
Y577_BACC4        ---MGRKWNNIKDKKASKDANTSRIYAKFGREIYVAAKQG-EPDPESNQALRVVLERAKT
Y4761_BACC2       ---MGRKWNNIKDKKASKDANTSRIYAKFGREIYVAAKQG-EPDPESNQALRVVLERAKT
Y465_BACCN        ---MGRKWNNIKDKKASKDANTSRIYAKFGREIYVAAKQG-EPDPESNQALKVVLERAKT
Y723_BACVZ        ---MGRKWNNIKEKKASKDANTSRIYAKFGREIYVAAKQG-EPDPESNQALKVVLERAKT
YEEI_BACSU        ---MGRKWNNIKEKKASKDANTSRIYAKFGREIYVAAKQG-EPDPESNQALKVVLERAKT
Y754_BACLD        ---MGRKWNNIKEKKASKDANTSRIYAKFGREIYVAAKQG-EPDPELNQNLKFVLERAKT
Y1956_ALKCK       ---MGRKWNNIKEKKASKDANTSRIYAKFGREIYVAARQG-EPDPELNQALKAVLERAKT
Y1693_EXIS2       ---MGRKWNNIKEKKASKDKNTSRVYAKFGREIYVAAKQG-EPDPESNQALKVVLERAKT
Y1481_BREBN       ---MGRKWNNIKEKKASKDASTSRIYARFGKEIYVAAKQG-EPDPESNRALKVVLERAKT
F2F5J8_SOLSS      ---MGRKWNNIKDKKAGKDAANSRIYAKFGREIYVAAKSG-EPNPESNRALKTVLERAKT
Y322_STAEQ        ---MGRKWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSG-EPNPESNQTLRLVLERAKT
Y437_STAES        ---MGRKWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSG-EPNPESNQTLRLVLERAKT
Y618_STAAB        ---MGRKWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSG-EPNPESNQALRLVLERAKT
Y727_STAAC        ---MGRKWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSG-EPNPESNQALRLVLERAKT
Y624_STAAN        ---MGRKWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSG-EPNPESNQALRLVLERAKT
Y631_STAAW        ---MGRKWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSG-EPNPESNQALRLVLERAKT
Y634_STAAS        ---MGRKWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSG-EPNPESNQALRLVLERAKT
Y638_STAAE        ---MGRKWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSG-EPNPESNQALRLVLERAKT
Y655_STAA3        ---MGRKWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSG-EPNPESNQALRLVLERAKT
Y669_STAAM        ---MGRKWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSG-EPNPESNQALRLVLERAKT
Y675_STAA8        ---MGRKWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSG-EPNPESNQALRLVLERAKT
Y680_STAAR        ---MGRKWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSG-EPNPESNQALRLVLERAKT
Y690_STAAT        ---MGRKWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSG-EPNPESNQALRLVLERAKT
Y693_STAA9        ---MGRKWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSG-EPNPESNQALRLVLERAKT
Y708_STAA2        ---MGRKWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSG-EPNPESNQALRLVLERAKT
Y2225_STAHJ       ---MGRKWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSG-EPDPESNQALRLVLERAKT
Y2054_STAS1       ---MGRKWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSG-EPDPESNQALRLTLERAKT
Y317_STACT        ---MGRKWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSG-EPDPESNQNLRLVLERAKT
Y369_LISMO        ---MGRKWANIKEKKASKDKTNSRIYAKFGIEIYVAAKSG-DPDPHSNQKLRFVIERAKT
Y388_LISIN        ---MGRKWANIKEKKASKDKTNSRIYAKFGIEIYVAAKSG-DPDPHSNQKLRFVIERAKT
Y385_LISMF        ---MGRKWANIKEKKASKDKTNSRIYAKFGIEIYVAAKSG-DPDPHANQKLRFVIERAKT
Y2866_ENTFA       ---MGRKWANIKEKKAAKDANNSRVYAKFGIEIYVAAKSG-DPDPHANQKLRFVIERAKT
                     ***** **  **: .*   ::: :::* ***.**:.* . :*. *  *: .::*** 

Y311_STRP8        AQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVNRTAANVRTAYGK
Y316_STRP1        AQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVNRTAANVRTAYGK
Y287_STRPB        AQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVNRTAANVRTAYGK
Y231_STRP3        AQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVNRTAANVRTAYGK
Y265_STRPZ        AQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVNRTAANVRTAYGK
Y266_STRPD        AQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVNRTAANVRTAYGK
Y268_STRPC        AQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVNRTAANVRTAYGK
Y261_STRPM        AQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVNRTAANVRTAYGK
Y1586_STRPG       AQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVNRTAANVRTAYGK
Y264_STRPF        AQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVNRTAANVRTAYGK
Y297_STRP6        AQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVNRTAANVRTAYGK
Y1645_STRA5       AQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVNRTAANVRTAYGK
Y1658_STRA1       AQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVNRTAANVRTAYGK
Y1691_STRA3       AQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVNRTAANVRTAYGK
Y364_STRU0        AQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVNRTAANVRTAYGK
Y1681_STREM       AQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVNRTAANVRAAYGK
Y1904_STRE4       AQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVNRTAANVRAAYGK
Y293_STRS7        AQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVNRTAANVRAAYGK
Y195_STRT2        AQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVNRTAANVRTAFGK
Y242_STRTD        AQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVNRTAANVRTAFGK
Y195_STRT1        AQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVNRTAANVRTAFGK
Y1789_STRMU       AQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVNRTAANLRTAFGK
Y1725_STRP2       AQVPKHIIDKAIDKAKGNTDETFTEGRYEGFGPNGSMLIVDTLTSNVNRTAANVRAAFGK
Y1897_STRPS       AQVPKHIIDKAIDKAKGNTDETFTEGRYEGFGPNGSMLIVDTLTSNVNRTAANVRAAFGK
Y1835_STRP4       AQVPKHIIDKAIDKAKGNTDETFTEGRYEGFGPNGSMLIVDTLTSNVNRTAANVRAAFGK
Y1871_STRZT       AQVPKHIIDKAIDKAKGNTDETFTEGRYEGFGPNGSMLIVDTLTSNVNRTAANVRAAFGK
Y1919_STRZJ       AQVPKHIIDKAIDKAKGNTDETFTEGRYEGFGPNGSMLIVDTLTSNVNRTAANVRAAFGK
Y1922_STRPN       AQVPKHIIDKAIDKAKGNTDETFTEGRYEGFGPNGSMLIVDTLTSNVNRTAANVRAAFGK
Y1946_STRPJ       AQVPKHIIDKAIDKAKGNTDETFTEGRYEGFGPNGSMLIVDTLTSNVNRTAANVRAAFGK
Y1952_STRZP       AQVPKHIIDKAIDKAKGNTDETFTEGRYEGFGPNGSMLIVDTLTSNVNRTAANVRAAFGK
Y1738_STRR6       AQVPKHIIDKAIDKAKGNTDETFTEGRYEGFGPNGSMLIVDTLTSNVNRTAANVRAAFGK
Y2002_STRP7       AQVPKHIIDKAIDKAKGNTDETFTEGRYEGFGPNGSMLIVDTLTSNVNRTAANVRAAFGK
Y2064_STRPI       AQVPKHIIDKAIDKAKGNTDETFTEGRYEGFGPNGSMLIVDTLTSNVNRTAANVRAAFGK
Y586_STRSV        AQVPKHVIDKAIDKAKGNTDETFTEGRYEGFGPNGSMLIVDTLTSNVNRTAANVRAAFGK
Y454_STRGC        AQVPKHVIDKAIDKAKGNTDETFTEGRYEGFGPNGSMLIVDTLTSNVNRTAANVRAAFGK
Y387_STRS2        AQVPKHIIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVNRTAANVRSAFGK
Y402_STRSY        AQVPKHIIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVNRTAANVRSAFGK
Y237_LACLS        AQVPKHVIDKAIDKAKGGGDETFVQGRYEGFGPNGSMVIAETLTSNVNRTIANVRTTFHK
Y242_LACLM        AQVPKHVIDKAIDKAKGGGDETFVQGRYEGFGPNGSMVIAETLTSNVNRTIANVRTTFHK
YCDB_LACLA        AQVPKHVIDKAIDKAKGGGDETFVQGRYEGFGPNGSMVIAETLTSNVNRTIANVRTTFHK
YEEN_ECO57        AQVPKHVIDKAIDKAKGGGDETFVQGRYEGFGPNGSMIIAETLTSNVNRTIANVRTIFNK
YEEN_SHISS        AQVPKHVIDKAIDKAKGGGDETFVQGRYEGFGPNGSMIIAETLTSNVNRTIANVRTIFNK
YEEN_ECOL5        AQVPKHVIDKAIDKAKGGGDETFVQGRYEGFGPNGSMIIAETLTSNVNRTIANVRTIFNK
YEEN_SHIBS        AQVPKHVIDKAIDKAKGGGDETFVQGRYEGFGPNGSMIIAETLTSNVNRTIANVRTIFNK
YEEN_ECOUT        AQVPKHVIDKAIDKAKGGGDETFVQGRYEGFGPNGSMIIAETLTSNVNRTIANVRTIFNK
YEEN_ECOL6        AQVPKHVIDKAIDKAKGGGDETFVQGRYEGFGPNGSMIIAETLTSNVNRTIANVRTIFNK
YEEN_ECOLI        AQVPKHVIDKAIDKAKGGGDETFVQGRYEGFGPNGSMIIAETLTSNVNRTIANVRTIFNK
YEEN_SHIFL        AQVPKHVIDKAIDKAKGGGDETFVQGRYEGFGPNGSMIIAETLTSNVNRTIANVRTIFNK
YEEN_SALCH        AQVPKHVIDKAIDKAKGGGDETFVQGRYEGFGPNGSMVIAETLTSNVNRTIANIRTIFNK
YEEN_SALPA        AQVPKHVIDKAIDKAKGGGDETFVQGRYEGFGPNGSMVIAETLTSNVNRTIANIRTIFNK
YEEN_SALTI        AQVPKHVIDKAIDKAKGGGDETFVQGRYEGFGPNGSMVIAETLTSNVNRTIANIRTIFNK
YEEN_SALTY        AQVPKHVIDKAIDKAKGGGDETFVQGRYEGFGPNGSMVIAETLTSNVNRTIANIRTIFNK
B1MWS5_LEUCK      AQVPKHVIERALEKASGSGDETFITGRYEGFGPNGSLIIVDTLTSNVNRTATNVRTAFNK
Y3259_HALH5       YNVPKAIIERAIEKAKGGSDETFDELRYEGFGPSGSMVIVDALTNNVNRTASEVRAAFGK
Y743_BACP2        YSVPKHIVDRAIEKAKGGAEENFDELRYEGFGPNGSMVIVDALTNNVNRTASDVRAAFGK
Y153_EXISA        YNVPRAIIDRAIDKAKGGDEENFDELRYEGFGPNGSMVIVDTLTNNVNRTASEVRAAFGK
Y4045_BACAC       YNVPRTIIDRAVEKAKGGSEENYDELRYEGFGPNGAMVIVDTLTNNVNRTAADVRAAFSK
Y622_BACAA        YNVPRTIIDRAVEKAKGGSEENYDELRYEGFGPNGAMVIVDTLTNNVNRTAADVRAAFSK
Y449_BACCZ        YNVPRTIIDRAVEKAKGGSEENYDELRYEGFGPNGAMVIVDTLTNNVNRTAADVRAAFSK
Y541_BACAN        YNVPRTIIDRAVEKAKGGSEENYDELRYEGFGPNGAMVIVDTLTNNVNRTAADVRAAFSK
Y541_BACC0        YNVPRTIIDRAVEKAKGGSEENYDELRYEGFGPNGAMVIVDTLTNNVNRTAADVRAAFSK
Y578_BACC3        YNVPRTIIDRAVEKAKGGSEENYDELRYEGFGPNGAMVIVDTLTNNVNRTAADVRAAFSK
Y453_BACHK        YNVPRTIIDRAVEKAKGGSEENYDELRYEGFGPNGAMVIVDTLTNNVNRTAADVRAAFSK
Y595_BACC1        YNVPRTIIDRAVEKAKGGSEENYDELRYEGFGPNGAMVIVDTLTNNVNRTAADVRAAFSK
Y605_BACCQ        YNVPRTIIDRAVEKAKGGSEENYDELRYEGFGPNGAMVIVDTLTNNVNRTAADVRAAFSK
Y615_BACC7        YNVPRTIIDRAVEKAKGGSEENYDELRYEGFGPNGAMVIVDTLTNNVNRTAADVRAAFSK
Y539_BACCR        YNVPRTIIDRAVEKAKGGSEENYDELRYEGFGPNGAMVIVDTLTNNVNRTAADVRAAFSK
Y577_BACC4        YNVPRTIIDRAVEKAKGGSEENYDELRYEGFGPNGAMVIVDTLTNNVNRTAADVRAAFSK
Y4761_BACC2       YNVPRTIIDRAVEKAKGGSEENYDELRYEGFGPNGAMVIVDTLTNNVNRTAADVRAAFSK
Y465_BACCN        YSVPKSIIDRAIEKAKGGSEENYDELRYEGFGPNGSMIIVDTLTNNVNRTAADVRAAFNK
Y723_BACVZ        YSVPKNIIERAIEKAKGGAEENFDELRYEGFGPNGSMIIVDALTNNVNRTAPEVRAAFGK
YEEI_BACSU        YSVPKNIIERAIEKAKGGAEENYDELRYEGFGPNGSMIIVDALTNNVNRTAPEVRAAFGK
Y754_BACLD        YNVPKAIIERAIEKAKGGSEENYDELRYEGFGPNGAMVIVDALTNNVNRTAADVRSTFGK
Y1956_ALKCK       YNVPKSIIDRAIEKAKGGSDESYEERRYEGFGPNGAMVIVDALTNNVNRTASDVRAAFGK
Y1693_EXIS2       YSVPRAIVDRAIEKAKGGAEENFDVLRYEGFGPSGSMVIVETLTNNVNRTASDVRAAFGK
Y1481_BREBN       YSVPKAIIDRAIDKAKGGSDETFSDLRYEGFGPNGSMIIVDALTNNVNRTAPEVRAAFNK
F2F5J8_SOLSS      YSVPKHIIEKAIDKAKGGGDEQFDELRYEGFGVAGTMVIVDALTNNVNRTASEVRAAFGK
Y322_STAEQ        YSVPNHIIDRAIDKAKGAGDENYDHLRYEGFGPNGSMLIVDALTNNVNRTASDVRAAFGK
Y437_STAES        YSVPNHIIDRAIDKAKGAGDENYDHLRYEGFGPNGSMLIVDALTNNVNRTASDVRAAFGK
Y618_STAAB        YSVPNHIIEKAIDKAKGAGDENFDHLRYEGFGPSGSMLIVDALTNNVNRTASDVRAAFGK
Y727_STAAC        YSVPNHIIEKAIDKAKGAGDENFDHLRYEGFGPSGSMLIVDALTNNVNRTASDVRAAFGK
Y624_STAAN        YSVPNHIIEKAIDKAKGAGDENFDHLRYEGFGPSGSMLIVDALTNNVNRTASDVRAAFGK
Y631_STAAW        YSVPNHIIEKAIDKAKGAGDENFDHLRYEGFGPSGSMLIVDALTNNVNRTASDVRAAFGK
Y634_STAAS        YSVPNHIIEKAIDKAKGAGDENFDHLRYEGFGPSGSMLIVDALTNNVNRTASDVRAAFGK
Y638_STAAE        YSVPNHIIEKAIDKAKGAGDENFDHLRYEGFGPSGSMLIVDALTNNVNRTASDVRAAFGK
Y655_STAA3        YSVPNHIIEKAIDKAKGAGDENFDHLRYEGFGPSGSMLIVDALTNNVNRTASDVRAAFGK
Y669_STAAM        YSVPNHIIEKAIDKAKGAGDENFDHLRYEGFGPSGSMLIVDALTNNVNRTASDVRAAFGK
Y675_STAA8        YSVPNHIIEKAIDKAKGAGDENFDHLRYEGFGPSGSMLIVDALTNNVNRTASDVRAAFGK
Y680_STAAR        YSVPNHIIEKAIDKAKGAGDENFDHLRYEGFGPSGSMLIVDALTNNVNRTASDVRAAFGK
Y690_STAAT        YSVPNHIIEKAIDKAKGAGDENFDHLRYEGFGPSGSMLIVDALTNNVNRTASDVRAAFGK
Y693_STAA9        YSVPNHIIEKAIDKAKGAGDENFDHLRYEGFGPSGSMLIVDALTNNVNRTASDVRAAFGK
Y708_STAA2        YSVPNHIIEKAIDKAKGAGDENFDHLRYEGFGPSGSMLIVDALTNNVNRTASDVRAAFGK
Y2225_STAHJ       YSVPNHIIDRAIDKAKGAGDENYDHLRYEGFGPSGSMLIVDALTNNVNRTASDVRAAFGK
Y2054_STAS1       YSVPNHIIEKAIEKAKGSGEENYDELRYEGFGPSGSMIIVDALTDNVNRTASDVRSAFGK
Y317_STACT        YNVPRNIIDRAIDKAKGSDDENYDNLRYEGFGPNGSMLIVDALTNNVNRTASDVRAAFGK
Y369_LISMO        YNVPKHIIDRAIEKAKGTGDETYSELRYEGFGPNGSMIIVDALTNNVNRTASDVRAAYSK
Y388_LISIN        YNVPKHIIDRAIEKAKGTGDETYSELRYEGFGPNGSMIIVDALTNNVNRTASDVRAAYSK
Y385_LISMF        YNVPKHIIDRAIEKAKGTGDETYSELRYEGFGPNGSMIIVDALTNNVNRTASDVRAAYSK
Y2866_ENTFA       YNVPKHIIDRAIEKAKGSADEQYSELRYEGFGPNGSMVIVDALTNNVNRTAADVRAAFGK
                   .**. ::::*::**.*  :* :   ******  *:::*.::**.***** .::*: : *

Y311_STRP8        NGGNMGASGSVSYLFDKKGVIVFAGDDADSVFEQLLEADVDVDDVEAEEGTITVYTAPTD
Y316_STRP1        NGGNMGASGSVSYLFDKKGVIVFAGDDADSVFEQLLEADVDVDDVEAEEGTITVYTAPTD
Y287_STRPB        NGGNMGASGSVSYLFDKKGVIVFAGDDADSVFEQLLEADVDVDDVEAEEGTITVYTAPTD
Y231_STRP3        NGGNMGASGSVSYLFDKKGVIVFAGDDADSVFEQLLEADVDVDDVEAEEGTITVYTAPTD
Y265_STRPZ        NGGNMGASGSVSYLFDKKGVIVFAGDDADSVFEQLLEADVDVDDVEAEEGTITVYTAPTD
Y266_STRPD        NGGNMGASGSVSYLFDKKGVIVFAGDDADSVFEQLLEADVDVDDVEAEEGTITVYTAPTD
Y268_STRPC        NGGNMGASGSVSYLFDKKGVIVFAGDDADSVFEQLLEADVDVDDVEAEEGTITVYTAPTD
Y261_STRPM        NGGNMGASGSVSYLFDKKGVIVFAGDDADSVFEQLLEADVDVDDVEAEEGTITVYTAPTD
Y1586_STRPG       NGGNMGASGSVSYLFDKKGVIVFAGDDADSVFEQLLEADVDVDDVEAEEGTITVYTAPTD
Y264_STRPF        NGGNMGASGSVSYLFDKKGVIVFAGDDADSVFEQLLEADVDVDDVEAEEGTITVYTAPTD
Y297_STRP6        NGGNMGASGSVSYLFDKKGVIVFAGDDADSVFEQLLEADVDVDDVEAEEGTITVYTAPTD
Y1645_STRA5       NGGNMGASGSVSYLFDKKGVIVFAGDDADTVFEQLLEADVDVDDVEAEEGTITVYTAPTD
Y1658_STRA1       NGGNMGASGSVSYLFDKKGVIVFAGDDADTVFEQLLEADVDVDDVEAEEGTITVYTAPTD
Y1691_STRA3       NGGNMGASGSVSYLFDKKGVIVFAGDDADTVFEQLLEADVDVDDVEAEEGTITVYTAPTD
Y364_STRU0        NGGNMGASGSVSYMFDKKGVIVFEGDDADTVFEQLLEADVEVDDVEAEDGAITVYTAPTD
Y1681_STREM       NGGNMGAAGSVSYLFDKKGVIVFKGDDADSIFELLLEADVDVDDVEAEDGSITVYTAPTD
Y1904_STRE4       NGGNMGAAGSVSYLFDKKGVIVFKGDDADSIFELLLEADVDVDDVEAEDGSITVYTAPTD
Y293_STRS7        NGGNMGAAGSVSYLFDKKGVIVFKGDDADSIFELLLEADVDVDDVEAEDGSITVYTAPTD
Y195_STRT2        NGGNMGASGSVSYMFDKKGVIVFAGEDADAIFEQLLEADVDVEDVEAEDGTITVYTEPTD
Y242_STRTD        NGGNMGASGSVSYMFDKKGVIVFAGEDADAIFEQLLEADVDVEDVEAEDGTITVYTEPTD
Y195_STRT1        NGGNMGASGSVSYMFDKKGVIVFAGEDADAIFEQLLEADVDVEDVEAEDGSITVYTEPTD
Y1789_STRMU       NGGNMGAAGSVSYMFDKKGVIVFAGDDADSIFEQLLEADIDVEDVEAEDGSVTVYTAPTD
Y1725_STRP2       NGGNMGASGSVSYLFDNKGVIVFGGEDADAVFEQLLEADVDVDDVEAQEGTITVYTAPTD
Y1897_STRPS       NGGNMGASGSVSYLFDNKGVIVFGGEDADAVFEQLLEADVDVDDVEAQEGTITVYTAPTD
Y1835_STRP4       NGGNMGASGSVSYLFDNKGVIVFGGEDADAVFEQLLEADVDVDDVEAQEGTITVYTAPTD
Y1871_STRZT       NGGNMGASGSVSYLFDNKGVIVFGGEDADAVFEQLLEADVDVDDVEAQEGTITVYTAPTD
Y1919_STRZJ       NGGNMGASGSVSYLFDNKGVIVFGGEDADAVFEQLLEADVDVDDVEAQEGTITVYTAPTD
Y1922_STRPN       NGGNMGASGSVSYLFDNKGVIVFGGEDADAVFEQLLEADVDVDDVEAQEGTITVYTAPTD
Y1946_STRPJ       NGGNMGASGSVSYLFDNKGVIVFGGEDADAVFEQLLEADVDVDDVEAQEGTITVYTAPTD
Y1952_STRZP       NGGNMGASGSVSYLFDNKGVIVFGGEDADAVFEQLLEADVDVDDVEAQEGTITVYTAPTD
Y1738_STRR6       NGGNMGASGSVSYLFDNKGVIVFGGEDADAVFEQLLEADVDVDDVEAQEGTITVYTAPTD
Y2002_STRP7       NGGNMGASGSVSYLFDNKGVIVFGGEDADAVFEQLLEADVDVDDVEAQEGTITVYTAPTD
Y2064_STRPI       NGGNMGASGSVSYLFDNKGVIVFGGEDADAVFEQLLEADVDVDDVEAQEGTITVYTAPTD
Y586_STRSV        NGGNMGASGSVAYLFDNKGVIVFAGDDADSVFEQLLEADVDVDDVEAEEGSITVYTAPTD
Y454_STRGC        NGGNMGASGSVSYLFDNKGVVVFAGDDADSIFELLLEADVDVDDVEAEEGTITVYTAPTD
Y387_STRS2        NGGNMGASGSVSFMFDKKGVVVFAGDDADAIFELLLEADVEVDDVEAEDGTITIIQLQLD
Y402_STRSY        NGGNMGASGSVSFMFDKKGVVVFAGDDADAIFELLLEADVEVDDVEAEDGTITIYTAPTD
Y237_LACLS        NGGNIGAAGAVSYMFDNTGVIVFEGTDPDHIFEILLDAEVDVRDVTEEEGNIVVYTEPTD
Y242_LACLM        NGGNIGAAGAVSYMFDNTGVIVFEGTDPDHIFEILLDAEVDVRDVTEEEGNIVVYTEPTD
YCDB_LACLA        NGGNIGAAGAVSYMFDNTGVIVFEGTDPDHIFEILLDAEVDVRDVTEEEGNIVVYTEPTD
YEEN_ECO57        KGGNIGAAGSVSYMFDNTGVIVFKGSDPDHIFEILLEAEVDVRDVTEEEGNIVIYTEPTD
YEEN_SHISS        KGGNIGAAGSVSYMFDNAGVIVFKGSDPDHIFEILLEAEVDVRDVTEEEGNIVIYTEPTD
YEEN_ECOL5        KGGNIGAAGSVSYMFDNTGVIVFKGTDPDHIFEILLEAEVDVRDVTEEEGNIVIYTEPTD
YEEN_SHIBS        KGGNIGAAGSVSYMFDNTGVIVFKGTDPDHIFEILLEAEVDVRDVTEEEGNIVIYTEPTD
YEEN_ECOUT        KGGNIGAAGSVSYMFDNTGVIVFKGTDPDHIFEILLEAEVDVRDVTEEEGNIVIYTEPTD
YEEN_ECOL6        KGGNIGAAGSVSYMFDNTGVIVFKGTDPDHIFEILLEAEVDVRDVTEEEGNIVIYTEPTD
YEEN_ECOLI        KGGNIGAAGSVSYMFDNTGVIVFKGTDPDHIFEILLEAEVDVRDVTEEEGNIVIYTEPTD
YEEN_SHIFL        KGGNIGAAGSVSYMFDNTGVIVFKGTDPDHIFEILLEAEVDVRDVTEEEGNIVIYTEPAD
YEEN_SALCH        KGGNIGAAGAVSYMFDNTGVIVFKGTDPDHIFEILLDAEVDVRDVTEEEGNIVIYTEATD
YEEN_SALPA        KGGNIGAAGAVSYMFDNTGVIVFKGTDPDHIFEILLDAEVDVRDVTEEEGNIVIYTEATD
YEEN_SALTI        KGGNIGAAGAVSYMFDNTGVIVFKGTDPDHIFEILLDAEVDVRDVTEEEGNIVIYTEATD
YEEN_SALTY        KGGNIGAAGAVSYMFDNTGVIVFKGTDPDHIFEILLDAEVDVRDVTEEEGNIVIYTEATD
B1MWS5_LEUCK      NGGTYGAAGSVSYLFDETGVIVFAGDDADDVLETLLDAEVDVRDAEQQDDQVVVYTEPSD
Y3259_HALH5       NGGNMGVSGSVAYMFDQTAIIGVQGKTEEDVLELLMEADLDVRDLVQEDEVTIVYAEPDQ
Y743_BACP2        NGGNMGVSGSVAYMFDQTAVIGVEGKSEEETLELLMEADVDVRDIMEEDETVIVYAEPDQ
Y153_EXISA        NGGNMGVSGSVAYMFDATAVIGVNEMSADDVLELMMEHDLDVRDVIEEDETVIVYAEPEA
Y4045_BACAC       NSGNMGVNGSVAYMFDATAVIGLEGKTSDEVLEILMEADVDARDILEEEDAVIVYAEPDQ
Y622_BACAA        NSGNMGVNGSVAYMFDATAVIGLEGKTSDEVLEILMEADVDARDILEEEDAVIVYAEPDQ
Y449_BACCZ        NSGNMGVNGSVAYMFDATAVIGLEGKTSDEVLEILMEADVDARDILEEEDAVIVYAEPDQ
Y541_BACAN        NSGNMGVNGSVAYMFDATAVIGLEGKTSDEVLEILMEADVDARDILEEEDAVIVYAEPDQ
Y541_BACC0        NSGNMGVNGSVAYMFDATAVIGLEGKTSDEVLEILMEADVDARDILEEEDAVIVYAEPDQ
Y578_BACC3        NSGNMGVNGSVAYMFDATAVIGLEGKTSDEVLEILMEADVDARDILEEEDAVIVYAEPDQ
Y453_BACHK        NSGNMGVNGSVAYMFDATAVIGLEGKTSDEVLEILMEADVDARDILEEEDAVIVYAEPEQ
Y595_BACC1        NGGNMGVNGSVAYMFDATAVIGLEGKTSDEVLEILMEADVDARDILEEEDAVIVYAEPDQ
Y605_BACCQ        NGGNMGVNGSVAYMFDATAVIGLEGKTSDEVLEILMEADVDARDILEEEDAVIVYAEPDQ
Y615_BACC7        NGGNMGVNGSVAYMFDATAVIGLEGKTSDEVLEILMEADVDVRDILEEEDAVIVYAEPDQ
Y539_BACCR        NSGNMGVNGSVAYMFDATAVIGLEGKTSDEVLEILMEADVDARDILEEEDSVIVYAEPDQ
Y577_BACC4        NSGNMGVNGSVAYMFDATAVIGLEGKTSDEVLEILMEADVDARDILEEEDSVIVYAEPDQ
Y4761_BACC2       NSGNMGVNGSVAYMFDATAVIGLEGKTSDEVLEILMEADVDARDILEEEDSVIVYAEPDQ
Y465_BACCN        NGGNMGVNGSVAYMFDATAVIGLEGKTADEVLEILMEADVDARDILEEEDSVIIYAEPDQ
Y723_BACVZ        NGGNMGVSGSVAYMFDATAVIGVEGKTADEALELLMEADVDVRDILEEDDSVIVYAEPDQ
YEEI_BACSU        NGGNMGVSGSVAYMFDATAVIGVEGKTADEALEILMEADVDVRDILEEDDSAIVYAEPDQ
Y754_BACLD        NGGNMGVSGSVAYMFDPTAVIGFEGKTADETLELLMEADIDVRDILEEDDAVIVYAEPDQ
Y1956_ALKCK       NGGNMGVSGSVAYMFDRVAVIGFEGKTADEALEILMDADVDAKDIIEEDDTVIVYAEPDQ
Y1693_EXIS2       NGGNMGVSGSVAYMFDATAIFAFEGKTADDILELMMEADIDVRDILEEEESVIIYAEPEQ
Y1481_BREBN       NGGNMGVSGSVAYMFDPTAVFGLEGKSSDEVLEILMEADVDVRDILEEDGAVIVYADAEQ
F2F5J8_SOLSS      NGGNMGVSGSAAHMFQNTAVFGIEGKSEDEILEILMEADLDMRDIMDEEGTIIVYVEPEQ
Y322_STAEQ        NGGNMGVSGSVAYMFDHTATFGVEGKSVDEVLETLMEQDIDVRDVIDDNGLTIVYAEPDQ
Y437_STAES        NGGNMGVSGSVAYMFDHTATFGVEGKSVDEVLETLMEQDIDVRDVIDDNGLTIVYAEPDQ
Y618_STAAB        NGGNMGVSGSVAYMFDHVATFGIEGKSVDEILETLMEQDVDVNDVIDDNGLTIVYAEPDQ
Y727_STAAC        NGGNMGVSGSVAYMFDHVATFGIEGKSVDEILETLMEQDVDVNDVIDDNGLTIVYAEPDQ
Y624_STAAN        NGGNMGVSGSVAYMFDHVATFGIEGKSVDEILETLMEQDVDVNDVIDDNGLTIVYAEPDQ
Y631_STAAW        NGGNMGVSGSVAYMFDHVATFGIEGKSVDEILETLMEQDVDVNDVIDDNGLTIVYAEPDQ
Y634_STAAS        NGGNMGVSGSVAYMFDHVATFGIEGKSVDEILETLMEQDVDVNDVIDDNGLTIVYAEPDQ
Y638_STAAE        NGGNMGVSGSVAYMFDHVATFGIEGKSVDEILETLMEQDVDVNDVIDDNGLTIVYAEPDQ
Y655_STAA3        NGGNMGVSGSVAYMFDHVATFGIEGKSVDEILETLMEQDVDVNDVIDDNGLTIVYAEPDQ
Y669_STAAM        NGGNMGVSGSVAYMFDHVATFGIEGKSVDEILETLMEQDVDVNDVIDDNGLTIVYAEPDQ
Y675_STAA8        NGGNMGVSGSVAYMFDHVATFGIEGKSVDEILETLMEQDVDVNDVIDDNGLTIVYAEPDQ
Y680_STAAR        NGGNMGVSGSVAYMFDHVATFGIEGKSVDEILETLMEQDVDVNDVIDDNGLTIVYAEPDQ
Y690_STAAT        NGGNMGVSGSVAYMFDHVATFGIEGKSVDEILETLMEQDVDVNDVIDDNGLTIVYAEPDQ
Y693_STAA9        NGGNMGVSGSVAYMFDHVATFGIEGKSVDEILETLMEQDVDVNDVIDDNGLTIVYAEPDQ
Y708_STAA2        NGGNMGVSGSVAYMFDHVATFGIEGKSVDEILETLMEQDVDVNDVIDDNGLTIVYAEPDQ
Y2225_STAHJ       NGGNMGVSGSVAYMFDHTATFGIEGKSADDILEALMEQDVDVRDVIEDGDLTIVYAEPDQ
Y2054_STAS1       NGGNMGVSGSVAYMFEYTAVFGIEDKSADDILESLMEQDIDVRDVIDENGLTIVYAEPDQ
Y317_STACT        NGGNMGVSGSVSYMFDHTATFAFEGKSADEILEVLMEQDLDVRDVVDDGNLTIVYAEPDQ
Y369_LISMO        NGGNMGVSGSVAYMFDNTAIFGVEGKDADELLELLMEADIDVRDILDEDGQAIIYAEPED
Y388_LISIN        NGGNMGVSGSVAYMFDNTAIFGVEGKDADELLELLMEADIDVRDILDEDGQAIIYAEPED
Y385_LISMF        NGGNMGVSGSVAYMFDNTAIFGVEGKDADELLELLMEVDIDVRDILDEDGQAIIYAEPED
Y2866_ENTFA       NGGNMGVSGAVSYMFDNTGIIGFAGDDADEILEYLMEKDIDVRDVVEEDGQIIVYTEPED
                  :.*. *. *:.:.:*:  . . .     :  :* ::: :::  *   :     :      

Y311_STRP8        LHKGIQALRDNGVEEFQVTELEMIPQSEVVLEGDDLETFEKLIDALESDDDVQKVYHNVA
Y316_STRP1        LHKGIQALRDNGVEEFQVTELEMIPQSEVVLEGDDLETFEKLIDALESDDDVQKVYHNVA
Y287_STRPB        LHKGIQALRDNGVEEFQVTELEMIPQSEVVLEGDDLETFEKLIDALESDDDVQKVYHNVA
Y231_STRP3        LHKGIQALRDNGVEEFQVTELEMIPQSEVVLEGDDLETFEKLIDALESDDDVQKVYHNVA
Y265_STRPZ        LHKGIQALRDNGVEEFQVTELEMIPQSEVVLEGDDLETFEKLIDALESDDDVQKVYHNVA
Y266_STRPD        LHKGIQALRDNGVEEFQVTELEMIPQSEVVLEGDDLETFEKLIDALESDDDVQKVYHNVA
Y268_STRPC        LHKGIQALRDNGVEEFQVTELEMIPQSEVVLEGDDLETFEKLIDALESDDDVQKVYHNVA
Y261_STRPM        LHKGIQALRDNGVEEFQVTELEMIPQSEVVLEGDDLETFEKLIDALESDDDVQKVYHNVA
Y1586_STRPG       LHKGIQALRDNGVEEFQVTELEMIPQSEVVLEGDDLETFEKLIDALESDDDVQKVYHNVA
Y264_STRPF        LHKGIQALRDNGVEEFQVTELEMIPQSEVVLEGDDLETFEKLIDALESDDDVQKVYHNVA
Y297_STRP6        LHKGIQALRDNGVEEFQVTELEMIPQSEVVLEGDDLETFEKLIDALESDDDVQKVYHNVA
Y1645_STRA5       LHKGIQALRDNGVEEFQVTELEMIPQSEVVLEGDDLETFEKLIDALESDDDVQKVYHNVA
Y1658_STRA1       LHKGIQALRDNGVEEFQVTELEMIPQSEVVLEGDDLETFEKLIDALESDDDVQKVYHNVA
Y1691_STRA3       LHKGIQALRDNGVEEFQVTELEMIPQSEVVLEGDDLETFEKLIDALESDDDVQKVYHNVA
Y364_STRU0        LHKGIQALRDNGIETFKVTELEMIPQSEVTLEGDDLATFEKLVDALEADDDVQKVYHNVA
Y1681_STREM       LHKAILALRESGISEFQVTELEMIPQSEVTLEGDDLAVFEKLVDALEADDDVQKVYHNVA
Y1904_STRE4       LHKAILALRESGISEFQVTELEMIPQSEVTLEGDDLAVFEKLVDALEADDDVQKVYHNVA
Y293_STRS7        LHKAILALRESGISEFQVTELEMIPQSEVTLEGDDLAVFEKLVDALEADDDVQKVYHNVA
Y195_STRT2        LHKALEALRANGQEEFQVTELEMIPQTEVTLEGEDLETFKGLIDALEADDDVQKVYHNVA
Y242_STRTD        LHKALEALRANGQEEFQVTELEMIPQTEVTLEGEDLETFKGLIDALEADDDVQKVYHNVA
Y195_STRT1        LHKALEALRANGQEEFQVTELEMIPQTEVTLEGEDLETFKGLIDALEADDDVQKVYHNVA
Y1789_STRMU       LHRGIEALRAGGVAEFQVTELEMIPQSEVTLEGEDLETFEKLIDALEDDDDVQKVYHNVD
Y1725_STRP2       LHKAIVALRESGIEEFQVTELEMIPQSEVELSGEDLETFEKLYSVLEDDEDVQKIYTNVD
Y1897_STRPS       LHKAIVALRESGIEEFQVTELEMIPQSEVELSGEDLETFEKLYSVLEDDEDVQKIYTNVD
Y1835_STRP4       LHKAIVALRESGIEEFQVTELEMIPQSEVELSGEDLETFEKLYSVLEDDEDVQKIYTNVD
Y1871_STRZT       LHKAIVALRESGIEEFQVTELEMIPQSEVELSGEDLETFEKLYSVLEDDEDVQKIYTNVD
Y1919_STRZJ       LHKAIVALRESGIEEFQVTELEMIPQSEVELSGEDLETFEKLYSVLEDDEDVQKIYTNVD
Y1922_STRPN       LHKAIVALRESGIEEFQVTELEMIPQSEVELSGEDLETFEKLYSVLEDDEDVQKIYTNVD
Y1946_STRPJ       LHKAIVALRESGIEEFQVTELEMIPQSEVELSGEDLETFEKLYSVLEDDEDVQKIYTNVD
Y1952_STRZP       LHKAIVALRESGIEEFQVTELEMIPQSEVELSGEDLETFEKLYSVLEDDEDVQKIYTNVD
Y1738_STRR6       LHKAIVALRESGIEEFQVTELEMIPQSEVELSGEDLETFEKLYSVLEDDEDVQKIYTNVD
Y2002_STRP7       LHKAIVALRESGIEEFQVTELEMIPQSEVELSGEDLETFEKLYSVLEDDEDVQKIYTNVD
Y2064_STRPI       LHKAIVALRESGIEEFQVTELEMIPQSEVELSGEALETFEKLYSVLEDDEDVQKIYTNVD
Y586_STRSV        LHKAIVALRESGIQEFQVTELEMIPQSEVELTGEDLETFEKLYSVLEDDEDVQKIYTNVD
Y454_STRGC        LHKAIVALRESGIEEFQVTELEMIPQSEVELSGDDLATFEKLVDVLEDDEDVQKVYTNVE
Y387_STRS2        LHKAIVALKESGIQEFNVTELEMIPQSEVSLEGDDLATFEKLYDALEDDEDVQKIYTNVD
Y402_STRSY        LHKAIVALKESGIQEFNVTELEMIPQSEVSLEGDDLATFEKLYDALEDDEDVQKIYTNVD
Y237_LACLS        LHKGIAALKAAGITEFSTTELEMIAQSEVELSPEDLEIFEGLIDALEDDDDVQKVYHNVA
Y242_LACLM        LHKGIAALKAAGITEFSTTELEMIAQSEVELSPEDLEIFEGLVDALEDDDDVQKVYHNVA
YCDB_LACLA        LHKGIAALKEAGITEFSTTELEMIPQSEVELSPEDLEIFEGLIDALEDDDDVQKVYHNVA
YEEN_ECO57        LHKGIAALKAAGISEFSTTELEMIAQSEVELSPEDLEIFEGLVDALEDDDDVQKVYHNVA
YEEN_SHISS        LHKGIAALKAAGITEFSTTELEMIAQSEVELSPEDLEIFEGLVDALEDDDDVQKVYHNVA
YEEN_ECOL5        LHKGIAALKAAGITEFSTTELEMIAQSEVELSPEDLEIFEGLVDALEDDDDVQKVYHNVA
YEEN_SHIBS        LHKGIAALKAAGITEFSTTELEMIAQSEVELSPEDLEIFEGLVDALEDDDDVQKVYHNVA
YEEN_ECOUT        LHKGIAALKAAGITEFSTTELEMIAQSEVELSPEDLEIFEGLVDALEDDDDVQKVYHNVA
YEEN_ECOL6        LHKGIAALKAAGITEFSTTELEMIAQSEVELSPEDLEIFEGLVDALEDDDDVQKVYHNVA
YEEN_ECOLI        LHKGIAALKAAGITEFSTTELEMIAQSEVELSPEDLEIFEGLVDALEDDDDVQKVYHNVA
YEEN_SHIFL        LHKGIAALKAAGITEFSTTELEMIAQSEVELSPEDLEIFEGLVDALEDDDDVQKVYHNVA
YEEN_SALCH        LHKGIAALKAAGITEFSTTELEMIAQSEVELSPEDLEIFEGLVDALEDDDDVQKVYHNVA
YEEN_SALPA        LHKGIAALKAAGITEFSTTELEMIAQSEVELSPEDLEIFEGLVDALEDDDDVQKVYHNVA
YEEN_SALTI        LHKGIAALKAAGITEFSTTELEMIAQSDVELSPEDLEIFEGLVDALEDDDDVQKVYHNVA
YEEN_SALTY        LHKGIAALKAAGISEFSTTELEMIAQSEVELSPEDLEIFEGLVDALEDDDDVQKVYHNVA
B1MWS5_LEUCK      LHKAIGALRQSGVSEFSTTEITMLPQAEVTLEGDDLATFEKLVDVLESDEDVQTVHHNVS
Y3259_HALH5       FHAVQEAFKQTGVEEFVVAEISMIPQTEVSLSQEDQEQFEKLIDVLEDLEDVQQVYHNVD
Y743_BACP2        FHQVQEAFKQAGVEEFTVAEITMLPQNEVTLDDESKEQFEKLIDVLEELEDVQQVYHNVD
Y153_EXISA        FHAVQTAFKAAGVEEFAVAELTMLPQNEVSLDDASQEQFEKLIDVLEDLEDVRQVYHNVE
Y4045_BACAC       FHAVQSALKDAGVEEFTVAELTMLAQNDVTLPEDAQAQFEKMVDALEDLEDVQQVYHNVD
Y622_BACAA        FHAVQSALKDAGVEEFTVAELTMLAQNDVTLPEDAQAQFEKMVDALEDLEDVQQVYHNVD
Y449_BACCZ        FHAVQSALKDAGVEEFTVAELTMLAQNDVTLPEDAQAQFEKMVDALEDLEDVQQVYHNVD
Y541_BACAN        FHAVQSALKDAGVEEFTVAELTMLAQNDVTLPEDAQAQFEKMVDALEDLEDVQQVYHNVD
Y541_BACC0        FHAVQSALKDAGVEEFTVAELTMLAQNDVTLPEDAQAQFEKMVDALEDLEDVQQVYHNVD
Y578_BACC3        FHAVQSALKDAGVEEFTVAELTMLAQNDVTLPEDAQAQFEKMVDALEDLEDVQQVYHNVD
Y453_BACHK        FHAVQSALKDAGVEEFTVAELTMLAQNDVTLPEDAQAQFEKMVDALEDLEDVQQVYHNVD
Y595_BACC1        FHAVQSALKDAGVEEFTVAELTMLAQNDVTLPEDAQAQFEKMVDALEDLEDVQQVYHNVD
Y605_BACCQ        FHAVQSALKDAGVEEFTVAELTMLAQNDVTLPEDAQAQFEKMVDALEDLEDVQQVYHNVD
Y615_BACC7        FHAVQSALKDAGVEEFTVAELTMLAQNDVTLPEDAQAQFEKMVDALEDLEDVQQVYHNVD
Y539_BACCR        FHAVQSALKGAGVEEFTVAELTMLAQSDVTLPEDAQAQFEKMVDALEDLEDVQQVYHNVD
Y577_BACC4        FHAVQSALKGAGVEEFTVAELTMLAQSDVTLPEDAQAQFEKMVDALEDLEDVQQVYHNVD
Y4761_BACC2       FHSVQSALKGAGVEEFTVAELTMLAQSDVTLPEDAQVQFEKMVDALEDLEDVQQVYHNVD
Y465_BACCN        FHAVQEALKAAGTTEFTVAELTMLAQNDVELSEEAQAQFEKLIDALEDLDDVQQVYHNVD
Y723_BACVZ        FHAVQEAFKNAGVEEFTVAELTMLAQNEVELPEDAKAQFEKLIDVLEDLEDVQQVYHNVD
YEEI_BACSU        FHAVQEAFKNAGVEEFTVAELTMLAQSEVTLPDDAKEQFEKLIDALEDLEDVQQVYHNVD
Y754_BACLD        FHAVQEALQNAGITEFTVAELTMLAQNDVALPEDARAQFEKLIDALEDLEDVQQVYHNVD
Y1956_ALKCK       FHAVQEAFRNAGIEEFSVAEFSMIAHNEVTLSEDVQAQFEKMIDAIEDLEDVQQVYHNVD
Y1693_EXIS2       FHAVQETLKEAGITDFSVAELVMLAQNEVTLSDEDVQQFEKMIDALEDLEDVQQVYHNVE
Y1481_BREBN       FHAVQEALKNGGVSEFTVAELTMLPQNEVTLTEDVQAQFEKLIDALEDLDDVQQVYHNVD
F2F5J8_SOLSS      FHATQEAFKGAGIEDFTVAELTMLPMTDVALTGDDLVKFEKMIDALEDLEDVQRVYHNAD
Y322_STAEQ        FAQVQDALREAGVEEFKVAEFEMLPQTDIELSEEDQAIFEKLIDALEDLEDVQNVFHNVD
Y437_STAES        FAQVQDALREAGVEEFKVAEFEMLPQTDIELSEEDQAIFEKLIDALEDLEDVQNVFHNVD
Y618_STAAB        FAVVQDALRAAGVEEFKVAEFEMLPQTDIELSEADQVTFEKLIDALEDLEDVQNVFHNVD
Y727_STAAC        FAVVQDALRAAGVEEFKVAEFEMLPQTDIELSEADQVTFEKLIDALEDLEDVQNVFHNVD
Y624_STAAN        FAVVQDALRAAGVEEFKVAEFEMLPQTDIELSEADQVTFEKLIDALEDLEDVQNVFHNVD
Y631_STAAW        FAVVQDALRAAGVEEFKVAEFEMLPQTDIELSEADQVTFEKLIDALEDLEDVQNVFHNVD
Y634_STAAS        FAVVQDALRAAGVEEFKVAEFEMLPQTDIELSEADQVTFEKLIDALEDLEDVQNVFHNVD
Y638_STAAE        FAVVQDALRAAGVEEFKVAEFEMLPQTDIELSEADQVTFEKLIDALEDLEDVQNVFHNVD
Y655_STAA3        FAVVQDALRAAGVEEFKVAEFEMLPQTDIELSEADQVTFEKLIDALEDLEDVQNVFHNVD
Y669_STAAM        FAVVQDALRAAGVEEFKVAEFEMLPQTDIELSEADQVTFEKLIDALEDLEDVQNVFHNVD
Y675_STAA8        FAVVQDALRAAGVEEFKVAEFEMLPQTDIELSEADQVTFEKLIDALEDLEDVQNVFHNVD
Y680_STAAR        FAVVQDALRAAGVEEFKVAEFEMLPQTDIELSEADQVTFEKLIDALEDLEDVQNVFHNVD
Y690_STAAT        FAVVQDALRAAGVEEFKVAEFEMLPQTDIELSEADQVTFEKLIDALEDLEDVQNVFHNVD
Y693_STAA9        FAVVQDALRAAGVEEFKVAEFEMLPQTDIELSEADQVTFEKLIDALEDLEDVQNVFHNVD
Y708_STAA2        FAVVQDALRAAGVEEFKVAEFEMLPQTDIELSEADQVTFEKLIDALEDLEDVQNVFHNVD
Y2225_STAHJ       FAHVQDALRQTGVEEFKVAEFEMLPQTDIELSEDDQATFEKLIDALEDLEDVQNVFHNVD
Y2054_STAS1       FAQVQDALRETGVDTFKVAEFEMLPQTDIELSAEDQETFETLVEALEDLDDVQNVFHNVD
Y317_STACT        FAQVQDALRQDGVEDFQVAEFEMLPQNDIQLSDEDKATLEGLIDALEDLEDVQNVYHNVD
Y369_LISMO        FHKVQEGLKAAGIEEFTVAEIEMIPQNDIQLSGEDLEKFERLIDALEDLEDVQKVYHNVE
Y388_LISIN        FHKVQEGLKAAGIEEFTVAEIEMIPQNDIQLSGEDLEKFEKLIDALEDLEDVQKVYHNVE
Y385_LISMF        FHKVQEGLKAAGIEEFTVAEIEMIPQNDIQLSGEDLEKFEKLIDALEDLEDVQKVYHNVE
Y2866_ENTFA       FHHAQEALKEKGIEEFTVTELEMVPQNEVTLEGDDLGNFEKMLDVLEDLEDVQKVHHNVD
                  :      ::  *   * .:*: *:.  :: *       :: : ..:*  :**: :. *. 

Y311_STRP8        DF-
Y316_STRP1        DF-
Y287_STRPB        DF-
Y231_STRP3        DF-
Y265_STRPZ        DF-
Y266_STRPD        DF-
Y268_STRPC        DF-
Y261_STRPM        DF-
Y1586_STRPG       DF-
Y264_STRPF        DF-
Y297_STRP6        DL-
Y1645_STRA5       DF-
Y1658_STRA1       DF-
Y1691_STRA3       DF-
Y364_STRU0        DF-
Y1681_STREM       DV-
Y1904_STRE4       DV-
Y293_STRS7        DV-
Y195_STRT2        DM-
Y242_STRTD        DM-
Y195_STRT1        DM-
Y1789_STRMU       GL-
Y1725_STRP2       GF-
Y1897_STRPS       GF-
Y1835_STRP4       GF-
Y1871_STRZT       GF-
Y1919_STRZJ       GF-
Y1922_STRPN       GF-
Y1946_STRPJ       GF-
Y1952_STRZP       GF-
Y1738_STRR6       GF-
Y2002_STRP7       GF-
Y2064_STRPI       GF-
Y586_STRSV        GF-
Y454_STRGC        GF-
Y387_STRS2        GF-
Y402_STRSY        GF-
Y237_LACLS        NL-
Y242_LACLM        NL-
YCDB_LACLA        NL-
YEEN_ECO57        NL-
YEEN_SHISS        NL-
YEEN_ECOL5        NL-
YEEN_SHIBS        NL-
YEEN_ECOUT        NL-
YEEN_ECOL6        NL-
YEEN_ECOLI        NL-
YEEN_SHIFL        NL-
YEEN_SALCH        NL-
YEEN_SALPA        NL-
YEEN_SALTI        NL-
YEEN_SALTY        NL-
B1MWS5_LEUCK      L--
Y3259_HALH5       LGE
Y743_BACP2        LGE
Y153_EXISA        M--
Y4045_BACAC       LGE
Y622_BACAA        LGE
Y449_BACCZ        LGE
Y541_BACAN        LGE
Y541_BACC0        LGE
Y578_BACC3        LGE
Y453_BACHK        LGE
Y595_BACC1        LGE
Y605_BACCQ        LGE
Y615_BACC7        LGE
Y539_BACCR        LGE
Y577_BACC4        LGE
Y4761_BACC2       LGE
Y465_BACCN        LGE
Y723_BACVZ        LGE
YEEI_BACSU        LGE
Y754_BACLD        LGA
Y1956_ALKCK       LA-
Y1693_EXIS2       L--
Y1481_BREBN       LGE
F2F5J8_SOLSS      LGE
Y322_STAEQ        LK-
Y437_STAES        LK-
Y618_STAAB        LK-
Y727_STAAC        LK-
Y624_STAAN        LK-
Y631_STAAW        LK-
Y634_STAAS        LK-
Y638_STAAE        LK-
Y655_STAA3        LK-
Y669_STAAM        LK-
Y675_STAA8        LK-
Y680_STAAR        LK-
Y690_STAAT        LK-
Y693_STAA9        LK-
Y708_STAA2        LK-
Y2225_STAHJ       LK-
Y2054_STAS1       LK-
Y317_STACT        LDS
Y369_LISMO        LED
Y388_LISIN        LED
Y385_LISMF        LED
Y2866_ENTFA       LPE