CLUSTAL format seed alignment for MF_00922

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

BAMD_DESVH            -------------------------MTAQRRPTPHSSIWNSSMRKTLLRAACMAALTFML
Q30ZN4_DESAG          ------------------------------------------MRRTIVRFMVMLSLLATL
C6BTV1_DESAD          ------------------------------------------MRNKFLSIFLASFLFISL
C7LR97_DESBD          ------------------------------------------MRNYLI----LFSFVLLL
F2NBZ0_DESAR          ----------------------------------------MQRYAFLSTCVITAMLFSLT
B8FB11_DESAA          ---------------------------------------------MKKTLLVLLILALMA
Q6AQ36_DESPS          ------------------------------------MNGIHFVRKSLHSFAIIIIAMSLL
M1P971_DESSD          -----------------------------MPCVSPLIRPLSFVRFTLNIVFISTLLLSL-
BAMD_PSEAE            ---------------------------------------------MQVKHLLLIAILALT
A4VQL7_PSEU5          MAERPLVSATRLCLNTASLSRRTGAPIITGRLRARQPAVTGTQAAMQVKHLLLIAIFALT
B3PE03_CELJU          -------------------MFKYPAAPTAAPIYIAIRVKCTMQVALRALPLLVLSLILVI
C5BQY5_TERTT          -------------------MIKHPAV------------------------IALVTAALLT
Q83DH4_COXBU          -------------------MFYNGRICLALN----------PEEGPMKKILFLATLLLIL
A1WZ88_HALHL          -------------------------------------------MHRIQRWATIALVALLA
BAMD_NEIMB            -------------------------------------------MKKILLTVSLGLALSAC
Q5F9W0_NEIG1          -------------------------------------------MKKILLTVSLGLALSAC
Q7VZ03_BORPE          ---------------------------------------------MALRAAIALSTILIV
A9IIW8_BORPD          --------MGHEDRSYNSACHPNTKDINPVIIRPVASPNRPARRGWPLRAAVVLSIALVA
E3HUN7_ACHXA          -----------------------------MIHHSAAPSNPASRSGPVLRVVIALFAVMVI
E8UD17_TAYEM          -----------------------------------------------------------M
B2JG73_PARP8          ------------------------MRALNIITQTVRKTVAHKLARKAALYGASVAAATLV
Q63UR5_BURPS          -----------------------------------MMHSTKRVAKPAAAWAVLAAAAALV
A9BWB6_DELAS          ------------------------------------------MQRIPLSIVPAMLVAGVL
A2SHC3_METPP          --------------------------------MTAMRMSPAAHWRATLAVVLAAASIG-L
A4G6E0_HERAR          ------------------------------------------MLKLTYIALAFLLSAC--
A5EX52_DICNV          ---------------------------------------------MKLRKNGVAIIAMVV
BAMD_ECOLI            ------------------------------------------MTRMKYLVAAATLSL-FL
Q32CS8_SHIDS          ------------------------------------------MTRMKYLVAAATLSL-FL
Q8ZMW8_SALTY          ------------------------------------------MTRMKYLVAAATLSL-FL
A6TCK3_KLEP7          ------------------------------------------MTRMKYLVAAATLSL-AL
A0A0U1EVV2_YERIN      ------------------------------------------MTRMKYLVAAATLSL-VL
BAMD_VIBCH            ---------------------------------------------MKYQTLSGLLALSLL
Q5E7D8_ALIF1          ---------------------------------------------MKRLTISSLLAVSLL
D4ZBK3_SHEVD          ------------------------------------------MHKFAKGAVLALFSIAIT
Q8EBE4_SHEON          ------------------------------------------MYKFSKGLTLVLFSLALS
A1SZN8_PSYIN          ------------------------------------------MKKILRLITSSLMIVLLS
C4LBU1_TOLAT          ------------------------------------------MQKVVRFFPVMLLSLSLL
BAMD_PASMU            ---------------------------------------------MRKLKSFTFIALTAF
BAMD_HAEIN            ---------------------------------------------MRKIKSLALLAVAAL
BAMD_HAEDU            ---------------------------------------------MRKLNSLVSLVLAGL
A3N1C5_ACTP2          ---------------------------------------------MRKFTSLASLVLAGL
Q7VQF4_BLOFL          ----------------------------------------------MRILFYIILALNMI
Q5NFJ0_FRATT          ---------------------------------------------MKRFLYLIIITFMLL
N9GM98_ACIHA          ---------------------------------------MSLPRYKITVLALSLGVASAF
BAMD_XYLFA            --------------------------------------MIQRPTFFTPTHLLAMLLATFV
Q8P681_XANCP          --------------------------------------MIRRSTFSAPARLIALMLVMAF
BAMD_RHILO            -------------------------------MFFKRVGQSKAPQRSVLLALSLVVPSLFL
Q7CXX0_AGRFC          -------------------------------MKHVGSGAMKGTMRGIAVSLMLVGASVVV
J7QLU7_METSZ          ------------------------------MGQHMSVFVRSFKVLALASALSIGAAPARA
Q89FV5_BRADU          ---------------------------MSAQRMTRGYLSISPLARGGLQAVTFIMLALPL
E3I232_RHOVT          ---------------------------------------MGLRSIGQTLAAVILATTLSS
Q3J4L3_RHOS4          ----------------------------------------MVKSG--ARLLGTALCVALM
A1BAK5_PARDP          ---------------------------------------MTVIRS--GSLVAAVLSLGLL
D5AQ06_RHOCB          --------------------------------------MATGKTA--ALRVGSLALLAAL
Q1GIU2_RUEST          --------------------------------------MIGIRAA--AKGIGVVALMATL
BAMD_CAUVC            --------------------------------------MLRIFQGRPAVTIAAVLVAASV
BAMD_RICPR            -------------------------------------------MKLTKLLSALLVIGLVL
H8K4C1_RICAG          -------------------------------------------MKLTKLLSTLLVIGLVL
D5BPR7_PUNMI          -------------------------------------------MVKHIPLIVLASTALLV
Q2RVV3_RHORT          --------------------------MTAERPIPFRRAPARSSSFRALAAAFLIGGALAL
BAMD_HELPY            ----------------------------------------MRLKHFKTFLFITMAIIVIG
Q7MQV7_WOLSU          -------------------------------------------MKPLVNLSLALALALTF
W8KJ78_CAMCO          ---------------------------------------------MKKNFFLCILLGILF
Q0P9I0_CAMJE          ---------------------------------------------MKKGIFLLVFLSVFF
A7ZEJ2_CAMC1          ------------------------------------------MKRFSKFLAVVALLGL-F
A7I0U7_CAMHC          ---------------------------------------------MKKFLIFAVFIAI-I
BAMD_BUCAI            ---------------------------------------------MKKKNSIIFVFMILF
Q2GFJ1_EHRCR          ----------------------------------------MCHSKIIRKAVYLLCCCFLM
A1WZM0_HALHL          --------------------------------------MGVSIRCLRYRVLSLLTAGLLL
W5WTR8_BDEBC          --------------------------------------------MLKTLRVITVLSLVLL
Q74FV2_GEOSL          ----------------------------------------MNVSRLCSLYPTLLIPLLFV
I4C8A4_DESTA          ------------------------------------------MPRYILSVFVICVAAVVC
                                                                                  

BAMD_DESVH            SGCGIIDYFYLP------------PPEDTAQELYESGNDAMREK---DYVAAAQAYTRLK
Q30ZN4_DESAG          SGCGIIDYFFLP------------PPEDTAQELFESGNDAMREK---DYASATDYFSKLK
C6BTV1_DESAD          SGCGVIDYYFLP------------KPEDTAQELFEAGVQAMKDK---EYFDATEYFSKLK
C7LR97_DESBD          NGCGAIDYYFLT------------PPDDTAQELFENARGFMQDK---EYAEAADSLTKLN
F2NBZ0_DESAR          AGCGWFS---------------KKKPEQPPETLVQEGMKKLRKG---KYEDAVDAFEKLK
B8FB11_DESAA          PGCSWFK---------------DSK-EKPAEELAADGIRYYEKG---DYTQAIESFEKLK
Q6AQ36_DESPS          GGCADMKSMFDIT-------YEKPDLEFPANDLIIKGMEDYNVG---KYFGAISYFQEIL
M1P971_DESSD          GGCAQISGLFGGD-------GKEKDVRLSAQTLAGEGMEEFSNG---RYYKARKIFDEIL
BAMD_PSEAE            AACSSNK-----------ETVDENL---SESQLYQQAQDDLNNK---SYNSAVTKLKALE
A4VQL7_PSEU5          AACSSN------------ETVDENL---GEVELYQQAQADLDNK---SYTSAISKLKALE
B3PE03_CELJU          TGCASK------------EKEPKVT---TEADLYQAAERQLNNS---QWQTAIKNLQTLE
C5BQY5_TERTT          VGCSSN------------DDKLAQS---SEQVTYNLAQKYLRSS---NWSAAIEALEVME
Q83DH4_COXBU          SGCVRKDVDP--------YQAYRGK---TSAELFTSGERALAKK---DYSEAVKNFEALD
A1WZ88_HALHL          TGCAGTD-----------PDGAAER---SVEELYTDARSSLSSG---NYSQAVERFENLV
BAMD_NEIMB            ATQGTVDKD---------AQITQDW---SVEKLYAEAQDELNSS---NYTRAVKLYEILE
Q5F9W0_NEIG1          ATQGTADKD---------AQITQDW---SVEKLYAEAQDELNSS---NYTRAVKLYEILE
Q7VZ03_BORPE          AGCGSSSTK---------YDKTAGW---SAEQLYADAKQEVAAG---NWTDARERLTAIE
A9IIW8_BORPD          AGCSGTDTK---------YDKTAGW---SAEQLYADAKAETAAG---AWNEARERLTAIE
E3HUN7_ACHXA          AGCGSTNSK---------YDKTTNW---SAEQLYADAKAEMSSG---GWKEARERLTAIE
E8UD17_TAYEM          SACGIFDRE---------IDETAGL---PADKLYDTARTYVRGR---DWDSARKYLAAIE
B2JG73_PARP8          AACHGLPEK---------TDETATW---TNNKLYTEAQDALSGG---DFGKCAKYFEALE
Q63UR5_BURPS          AGCHGLPQK---------SDETATW---SNNKLYSEAQDALTGG---DWGKCAKYFEALQ
A9BWB6_DELAS          TACSSTQQ-----------DPTAKW---TPDRIYTEARDEAASG---AFDKAVPLFEKLE
A2SHC3_METPP          IGCAGGPK-----------DEFAGK---STDKLYEEARDEAANG---NWERASKLYEKLE
A4G6E0_HERAR          -SLTPDQI-----------DETKNW---SPSKLYSEAREEMNTG---NYEKAVSHFEKLE
A5EX52_DICNV          FLAGCSGMQ---------LDHTANW---NAHQLYQAGKTEMESS---SYTTAIDYFTKLL
BAMD_ECOLI            AGCSGS---K--------EEVPDN----PPNEIYATAQQKLQDG---NWRQAITQLEALD
Q32CS8_SHIDS          AGCSGS---K--------EEVPDN----PPNEIYATAQQKLQDG---NWRQAITQLEALD
Q8ZMW8_SALTY          AGCSGS---K--------EEVPDN----PPNEIYATAQQKLQDG---NWKQAITQLEALD
A6TCK3_KLEP7          VGCSGS---K--------EEVPDN----PPNEIYATAQQKLQDG---NWKQAITQLEALD
A0A0U1EVV2_YERIN      TGCSSN---K--------DVVPDN----PPSELYATAQQKLQDG---NFKGAITQLEALD
BAMD_VIBCH            FGCSSS---P--------DVVPDV----PPSQLYSEAQTALQSG---TWLTAIEKLEALD
Q5E7D8_ALIF1          VGCSSS---D--------DVIPDI----PPSELYAQAQVSLQAG---NWTSAIERLEALD
D4ZBK3_SHEVD          A-CSSSPDEE--------LKASKT----SPDVLYSQARTSMELG---NYSKAVRSLEALD
Q8EBE4_SHEON          A-CSSSPEDN--------DIAAKT----SPDELYSQARTSMELG---NYSKAVRSLEALD
A1SZN8_PSYIN          TGCSSKKAEK--------PKVDDK----PPMVLYEQAKQALESA---SFEKASDILEALD
C4LBU1_TOLAT          AGCSSS-SDK--------PKVPDE----PLEVLYKQAQSKLHNG---DYERAVDILEALD
BAMD_PASMU            AITACSGSK----------DVEQR----PEQELYNVGQTHLQNG---DYSQAIRYLDAVR
BAMD_HAEIN            VIGCSSGSK----------DVEQA----SVNELYTKGTTSLQEG---SYSEAIRYLKATT
BAMD_HAEDU            LVIGCSNQNQ--------TEQEIL----SAQALYTQAQTQLEKG---DYASAIASFEKMG
A3N1C5_ACTP2          LVVGCSSAN---------KELEET----SAQDLYTKGQTYLQDG---DYNSAIRYLDAIG
Q7VQF4_BLOFL          MTISCTTISH--------HKIPDQ----DTNHLYKIAYNKLLQN---NYTEAIQDLLYLK
Q5NFJ0_FRATT          LLSSCGPKKD--------SELPQVYTGYTASFIYAKAHEQMQNQ---KYFDAIRSYKSLV
N9GM98_ACIHA          VGCSSNPSKK--------EVVDKGPQS-SEQVYFEKALKSLERN---QYTDAVKSLEALD
BAMD_XYLFA            LITGCHREAK---------KNADDG--MPVEHLYDKAHTLMKKG---NWAGAEVSFKRLI
Q8P681_XANCP          VVTGCHRGAK--------DKNPDEG--MPVEQLYGKGHGLMEKG---NWAGAEASYKRLI
BAMD_RHILO            SACMSSEKDIDL-----SKYVDQTEP---ADVLYNQGLANLNAG--RLDEAS-KKFDAVD
Q7CXX0_AGRFC          TACQS-DPDIDI-----TKLGVETDP---PDVLYKQGLANMNAG--NMTEAS-RKFEAID
J7QLU7_METSZ          DLMDSITSGFGLFGSGGTKYQTEITPDIPAEDFYNAGLARLKVK--DYEGAA-KKFGELE
Q89FV5_BRADU          AGCGTGALWDKFT----AKDDTFVEE--PADKIYNEGLYLMNEK--KDMKAANKKFEEVD
E3I232_RHOVT          SLGGCGSMGSMFS----SSESTQLDQR-PPDQIYKEADDLLGQG--KNNKAA-ELFERID
Q3J4L3_RHOS4          AGCG-----------GGSQKEP-PLENFTAEQIYQRGEYELEAR--TKPDRAIRYFSEVE
A1BAK5_PARDP          AGCS-----------GGAGKKPESFENFTAEEIYKRGEYELENS--RRPKDAVQYFTEVE
D5AQ06_RHOCB          AAC------------GPTQKEP-PLENFTAEEIYKRGEYELEVGNPRRPAEALRYFSEVE
Q1GIU2_RUEST          AACGG--------ADGDAQRSSLDLEGFSPAQIYERGEFELARS---REKDAAYFFSEVE
BAMD_CAUVC            AGCA-----------GKAKKPTLVYEERPVELLYSTGADRLDRG---NWNEAVDYFREVE
BAMD_RICPR            GGCK-------------SKKDS-NDIVAPIATLYNEGIILLDKK---KYKKAAEEFGKIF
H8K4C1_RICAG          GGCK-------------NKKNS-DDIVVPIPTLYNEGITLLEKK---KYKKAAEEFGRVF
D5BPR7_PUNMI          AGCS-------------STEVE-EQVERPVEQLYNEALNTALAG---NAKKAAPKFEEVE
Q2RVV3_RHORT          SACS-------------SKKDEPEYVERPVEELYNEAVDLLNTS---SYALAAKAFDEVE
BAMD_HELPY            TGCANKKKK-------------KDEYNKPAIFWYQGILREILFA---NLETADNYYSSLQ
Q7MQV7_WOLSU          WGCSQKSDE-------------AKEYNKPADYWYQRMLREIRAS---DLEKADDMFASLQ
W8KJ78_CAMCO          SACSTKND--------------EGLYNLSANEWYKQIIKDLQDK---DLEKADDHYNGMA
Q0P9I0_CAMJE          SACSTKND--------------EGLYNLSASEWYKQIIKDLQDK---DLEKADDHYNGMA
A7ZEJ2_CAMC1          SGCAEKY---------------TELYNLTPDEWYAQVIADIKDG---DLESADKHYVSMA
A7I0U7_CAMHC          SGCSAKKG--------------DEIYNLAPQAWFNLIIKDIKDS---NLKAADEHYVSFS
BAMD_BUCAI            FNSTVQS------------QSFKKNYFTERYTLYEKSNKELRKE---NFDNAISILEKIK
Q2GFJ1_EHRCR          VNCSFIK------------KGEKFVEDRTADEMYESALKKSNAK---EYKSAVKDLEEID
A1WZM0_HALHL          SGCAALG-------------GGSAQEREQARSLYAEALEAVERG---DLEAAQGMLDELQ
W5WTR8_BDEBC          IGCASTERNS-----------------ETPEGAFAIAEEYDQSE---RYEEAIRRYTEVK
Q74FV2_GEOSL          AGCGLFA-------------SSTAPVSRSPESMAREAEEFQSSR---RFEDAIAQWRKVK
I4C8A4_DESTA          SGCPSIW------------NTETAGKAASADELFSAAEADFQKK---NYPQAIETYERLK
                                                                         .        

BAMD_DESVH            DN-YPFSPYTIEAELSLADAYFLDEEYPAAAEAYKEFETLHPRHQ------AIPYVLYQV
Q30ZN4_DESAG          DN-FPFSPYAIEAELSLGDAYFLDEEYAMAAEAYKEFETLHPRHK------AIPYVLFQI
C6BTV1_DESAD          DR-YPFSPYTVKAEISLGDAYFLDKKYFDASEAYKEFAALHPGND------EIPYVLYQI
C7LR97_DESBD          DR-YPFSPYATEARLMLADAYALDSKYLEAVDAYEEFLNMHPRHE------SIDYVLFQI
F2NBZ0_DESAR          DR-YPYSDEALLASLKVADAKYYNKKYDEALLDYKEFEKLHPTNQ------IIPYVIYQQ
B8FB11_DESAA          DW-YPFSKYAILAELKLADSYFKRKNYEDAIYAYEYFESLHPRND------AIPYVIFQI
Q6AQ36_DESPS          EK-YPFSPEAPLAELKAADCNYYMDKYPEALAQYQDFEDRHPTNE------AIPYVMYQK
M1P971_DESSD          DY-YPFSPEAMLAQLKGADCNYYMENYQEALMLYHEFEERHPTNE------AIPYVMYQI
BAMD_PSEAE            SR-YPFGRYAEQAQLELIYANYKNMEPEAARAAAERFIRLHPQHP------NVDYAYYLK
A4VQL7_PSEU5          SR-YPFGRFAEQAQLELIYAYYRNAEPEAARSAAERFIRLHPQHP------NVDYAYYLK
B3PE03_CELJU          EN-FPFGTYAEQAQLELIYAYYMSGEPDAAIATANRFIRLHPQHR------NVDYAYYML
C5BQY5_TERTT          EN-FPFGSYAEQAQLELIYAYFRGNEYDAAIASADRFVRLHPQHR------NVDYAFYMR
Q83DH4_COXBU          AI-YPFGPHAEQAQLDIIYAYYKNNDTSSAIAAADRYIRLYPRGR------NVDYAYYMR
A1WZ88_HALHL          AR-YPFGTHAVQSQLMIIYAHYLAGQHESAIAAAERFQRMHPRNE------HVAYALYMR
BAMD_NEIMB            SR-FPTSRHAQQSQLDTAYAYYKDDEKDKALAAIDRFRRLHPQHP------NMDYALYLR
Q5F9W0_NEIG1          SR-FPTSRHARQSQLDTAYAYYKDDEKDKALAAIERFRRLHPQHP------NMDYALYLR
Q7VZ03_BORPE          SR-YPFGTYAQQALIELAYVNWKDGENEQALAAIDRFQQLYPNHP------GTDYVLYLK
A9IIW8_BORPD          SR-YPFGVYAQQALIDLAYVNWKDGENEQALAAIDRFQQMYPNHP------GTDYMLYLK
E3HUN7_ACHXA          SR-YPFGVYAQQALLELAYVNWKDGENEQALAAIDRFQQLYPNHP------GTDYALYLK
E8UD17_TAYEM          NR-HPYSSYAQQAMIDEAYVNWKDEQPERAIAVIDRFLQIYPSHP------GTEYMLYLK
B2JG73_PARP8          GR-DPFGHFAQQAQINVAYCNWKDSETDAADQAVNRFIQLHPDHP------DIPYAYYLK
Q63UR5_BURPS          GR-DPFGHFAQQAQINVAYCNWKDNETAAADQAVDRFIQLHPDHP------DVAYAYYLK
A9BWB6_DELAS          GR-AAGTPLAQQAQLDKAYAQYKSGDKIQATATLDRFLKLHPASP------ATDYALYLK
A2SHC3_METPP          AR-TAGTQQAQQTQIDLAYAYYKTNEKAQALSTIERFIKLHPSSP------AIDYAYYLQ
A4G6E0_HERAR          SR-YPFGTYAQQAQMEIAYAYYRQGDQPQALAAVERFIKLHPDHP------NVDYMYYLR
A5EX52_DICNV          AR-YPYGVLAQQSMLDIAYSYYRAGEAEKALAQLDSFSKTYPQHP------YIDYALYMK
BAMD_ECOLI            NR-YPFGPYSQQVQLDLIYAYYKNADLPLAQAAIDRFIRLNPTHP------NIDYVMYMR
Q32CS8_SHIDS          NR-YPFGPYSQQVQLDLIYAYYKNADLPLAQAAIDRFIRLNPTHP------NIDYVMYMR
Q8ZMW8_SALTY          NR-YPFGPYSQQVQLDLIYAYYKNADLPLAQAAIDRFMRLNPTHP------NIDYVMYMR
A6TCK3_KLEP7          NR-YPFGPYSQQVQLDLIYAYYKNADLPLAQAAIDRFMRLNPTHP------NIDYVIYMR
A0A0U1EVV2_YERIN      NR-YPFGPYSQQVQLDLIYAYYKSADLPMAQASIDRFMRLNPTHP------NIDYVLYMR
BAMD_VIBCH            SR-YPFGAYSEQVQLDLIYAYYKNDDLALGLATIERFTRLNPTHE------KMDWVLYMR
Q5E7D8_ALIF1          SR-YPFGAYSEQVQLDLIYVYYKNDDLALGLATIERFTRLNPTHP------KADWVLYMR
D4ZBK3_SHEVD          SR-YPFGPHKTQVQLDLIYAYYKLDDPASGIANIDRFIRLNPTHK------DIDYVYYMR
Q8EBE4_SHEON          SR-FPFGPHKTQVQLDLIYAYYKMDDVASGIANIDRFIRLNPTHP------NIDYVYYMR
A1SZN8_PSYIN          TR-YPFGPHSDQVQLDLIYAYYKRGETAFTLANIDRFLRLNPTHP------DLDYIYYMR
C4LBU1_TOLAT          SR-YPFGPYASQVQLQLIYAYYKKEDTAQAIANIDRFLRLNPTHK------DVDYVYYMR
BAMD_PASMU            SR-FPGSSYSEQTLLNLIYANYKTQDYTQTLVLADRFFQQYPTSR------NLDYVLYMA
BAMD_HAEIN            ER-FPGSVYQEQAMLDLIYANYKTQDYTQVLLMVDSFLHQFTQSP------NQAYAVYMA
BAMD_HAEDU            SRNVQANLFGEQIQLSLIFAHYKTGEYYKALSLAERFVRAYPNSN------NMDYVHYLV
A3N1C5_ACTP2          AKGGQG-TFGEQTQLSLIFANYKIGEYYKALDAAERFVRAYPNSA------SMDYVYYLA
Q7VQF4_BLOFL          NL-YLFEPCPQQIYLDLIYAYYKSNDLTSANNCINHFLNVYPNHK------NLDYVLYIH
Q5NFJ0_FRATT          AQ-YPFTPLAEKGMVDLIYVYYMDDESTMALALGQQFIKMYPYSI------YKGYVYYMI
N9GM98_ACIHA          TY-FPTGQYTQQAQLELLYAKFKQKDYEGTIALADRFIRLNPQHP------NVDYAYYVR
BAMD_XYLFA            AQ-YPYGPYTEQAMVENAYAQYKSGKHDDAVSSIDRFIRTYPTHH------NIPYLYYLR
Q8P681_XANCP          AQ-YPYGPYTEQAMIETAYAQYKAGKHDDTVSSVDRFIRTYPTHR------NISYLYYLR
BAMD_RHILO            RQ-HPYSEWARKSMVMGAFADYRKGSYDEAISSAKRYLALYPSTD------DAPYAQYII
Q7CXX0_AGRFC          KQ-YPFTEWGQKALVMQTFIATRTNKNDVAITSGSRFLRQYPRSK------DAAYVQYMI
J7QLU7_METSZ          KQ-YPSSDWARKGLLMTTFAQYEHPKYDDAVQSAMRYIGLYPNSP------DTPYVYYIA
Q89FV5_BRADU          RQ-HPYSDWARKSLLMSAYASYQGGDYDGCIGAATRYVTLHPGSP------DAAYAQYLI
E3I232_RHOVT          QL-YPYSEEAKKSTLMAAYAYQKAGKGPEAVAAARRFLSLHPGSK------EAALAQEII
Q3J4L3_RHOS4          RL-YPYTEWAKRALIMQAYSYHKAKDYEEARGAAQRFLDFYPGDE------DAAYAQYLL
A1BAK5_PARDP          RL-YPYSEWAKRALIMQAYSYHRARDYEEARGAAQRFIDTYPGDE------DAAYAKYLL
D5AQ06_RHOCB          RL-YPYSEYAKRALIMEAFAQHKAKKYEDARSSAQRYLDTYPGSE------DAAYAKYLL
Q1GIU2_RUEST          RL-YPYSEWAKQSLIMQAFTYHQAEDYENSRSAAQRYIDFYPTDA------DAAYAQYLL
BAMD_CAUVC            RQ-HPYSEWSRRSILMTGYAHYMGNQYAEAIGDADRFISLYPGNP------SAQYAFYLK
BAMD_RICPR            YQ-HPGNEMTPQAELMQAYSLFLAAQYEEAVDILNMFINLHPANI------DIAYAYYLK
H8K4C1_RICAG          YQ-HPGNEMTPQAELMQAYSLFLAAQYEEAVDVLDMFINLHPANV------DIAYAYYLK
D5BPR7_PUNMI          RQ-HPYSSLAVRAQLMAAWAFYQDNNYPRAIAALDRFVELNPADE------RVEYAYYLK
Q2RVV3_RHORT          RQ-HPYSSWATKAQIMSAYALYENEAYDDAVVAINRFIELHPGNR------DIAYAYYLR
BAMD_HELPY            SE-HINSPLVPEAMLALGQAHMKKKEYVLASFYFDEYIKRFGTKD------NVDYLTFLK
Q7MQV7_WOLSU          SE-HINSPLVPEAMLILGRAHMDDREYVLAEFYFEEYLKRFGTSE------NADFIGYLK
W8KJ78_CAMCO          SE-HIADPLLETTQIILAQAHMDEEEYQLAEFYLDEYNKKFGNSR------NADYIRYLK
Q0P9I0_CAMJE          SE-HVADPLLETTLIILAQAHMDEEEYKLAEFYLDEYNKKFGNSR------NADYIRYLK
A7ZEJ2_CAMC1          SE-HVASPLLEQILLILAQAHANDEEYLMANHYLDEYIKRYGDNGP-----KTEFAQYLK
A7I0U7_CAMHC          SE-HIGSPLLESMTLILAQAHTMEEDYTLANTYLDEYIRRYGTDD------KIQYAKFLK
BAMD_BUCAI            KNNNTANISNDKIQIDLIYAYYKILNFDQARKNIEEFMYFYPNHP------NIDYVVYIQ
Q2GFJ1_EHRCR          NL-YPFSPVAIKARLMMSFLNYELGDYSRAEIYADDYIQLYPDSK------DIDFAYYLR
A1WZM0_HALHL          EA-YPETRHARQALLEAAYVEYRLGQYPQAIERAEIFHRQAAQTEEQADDEDLRYALYLR
W5WTR8_BDEBC          NK-YPYSNFATKSELAIADVYFKQESYAEAQVSYQMFKELHPTVP------NSDYVQYKI
Q74FV2_GEOSL          ES-YISPELITLAEIKIADAQFDSGNYIEAAASYEEFRKLHPNHE------KSAYALYRQ
I4C8A4_DESTA          SA-YPDFKQIPEVYLKIADSFFEQGQYEKAISRYLQFVELHPGHK------ELQRAKYQI
                                    :                     :                       

BAMD_DESVH            GMARLKSFISV--------------DRPVNNVQEAYQYFQRLRESYPGTEYAAKAEEHMK
Q30ZN4_DESAG          GNANLKSFVSI--------------DRPQTNVAEAYEYFSRVRESYPGSEYAQKAGELLG
C6BTV1_DESAD          GLSNFNLFSSI--------------DRPQSNITEALEYFYRVEEAYPETQYAKSAKEYIV
C7LR97_DESBD          GVNKYNSHRSI--------------DLPHTQLGEAVESFRRLVSGYPKSIYREQALDYIV
F2NBZ0_DESAR          GMCYYRQRSTI--------------DRDPTYTVKAVQEYRRLKERYPQYEKISKAEDYMD
B8FB11_DESAA          GMCYFEQKALP--------------DRDQTATESALENFLRLTREYPASAEAAMALEHIK
Q6AQ36_DESPS          GMSNYKQIDRI--------------DRDPIVARRAVDFFSQLLRAFPNSPYTTNARKNIA
M1P971_DESSD          AMSHYQQIDRI--------------DRDTNGAENAIREFSKLLRAFPDSPYRNEARARIR
BAMD_PSEAE            GLSSFDQDRG----LLARFLPLDMTKRDPGAARDSFNEFAQLTSRFPNSRYAPDAKARMV
A4VQL7_PSEU5          GLASFDQDRG----LLARFLPLDMTKRDPGAARDSFNEFAQLTSRYPNSRYSPDAKARMI
B3PE03_CELJU          GMSSFTKDKG----MFERVLPVDITRRDPGAARESLANFTQLLNRYPDSAYAADAKKRML
C5BQY5_TERTT          GIAAFHNDT-----AFYSMLPTDITQRDAGTAKDSFDYFAQLIDRYPDSPYALDAQKRMI
Q83DH4_COXBU          GVISFDLGLS----WLQKLARVSPVSRDVSTLQQSFTSFATLAEVFPHSRYTPDALTRMR
A1WZ88_HALHL          GVSRQAQGPG----GLGDLFNVDANLRDPEPKRRAFADFRELTEQYPDSEYIDDAVERME
BAMD_NEIMB            GLVLFNEDQS----FLNKLASQDWSDRDPKANREAYQAFAELVQRFPNSKYAADATARMV
Q5F9W0_NEIG1          GLVLFNEDQS----FLNKLASQDWSDRDPKANREAYQAFAELVQRFPNSKYAADATARMV
Q7VZ03_BORPE          GLVNFTPASA----FMSNLTGQDPAERDPKGLRASYDAFNELVQRFPNSKYTPDAQKRMT
A9IIW8_BORPD          GLINFTPASA----FMSNLTGQDPAERDPKGLRASYDAFNELIKRYPSSKYTPDAEKRVT
E3HUN7_ACHXA          GLINFTPASA----FMSSITGQDPAERDPKGLRASYDAFNELIKRYPDSKYTVDAEKRVA
E8UD17_TAYEM          GLITFTPPTH----FLTSFAGQKPSERDPRGLRQSYTAFKVLIDNYPNSRYAADARQRLV
B2JG73_PARP8          GMIHFNDDLG----LFGRFSGQDMSERDPKSLRESYDAFKVVVDKYPQSKYAPDAAQRMR
Q63UR5_BURPS          GMIHFNDDLG----LFGRFSGQDMSERDPQALRESYDAFRAVVDRYPKSKYAPDAAARMR
A9BWB6_DELAS          GLVNFNDNLG----MFSWLSRQDLSERDQKAAKDSFESFRELVTRFPESRYAEDSRLRMQ
A2SHC3_METPP          GLINFNENLG----LLGGLARQDLSERDQQAARDAYQSFRQLTLQFPNSKYTPDAQLRMN
A4G6E0_HERAR          GLINFNDKVS----VFDFLSRQDPTERDPKAAREAFDSFKLLTERFPDSKYTPDASARLA
A5EX52_DICNV          GVVEYEKNIS----FFKRLLPTDLSQTDPTPLKNAFDLFAQLVERFPQSEYAEDARYRMI
BAMD_ECOLI            GLTNMALDDS----ALQGFFGVDRSDRDPQHARAAFSDFSKLVRGYPNSQYTTDATKRLV
Q32CS8_SHIDS          GLTNMALDDS----ALQGFFGVDRSDRDPQHARAAFSDFSKLVRGYPNSQYTTDATKRLV
Q8ZMW8_SALTY          GLTNMALDDS----ALQGFFGVDRSDRDPQHARAAFNDFSKLVRSYPNSQYTTDATKRLV
A6TCK3_KLEP7          GLTNMALDDS----ALQGFFGVDRSDRDPQHARDAFNDFSKLVRGYPNSQYATDAYKRMV
A0A0U1EVV2_YERIN      GLTDMALDDS----ALQGFFGIDRSDRDPQHARAAFRDFNQLIQNYPNSQYATDAQKRLV
BAMD_VIBCH            GLTHMAQDRN----FMHDLFNIDRRDRDPEPVKAAFADFKKLLQRYPNSPYAEDAQRRMF
Q5E7D8_ALIF1          GLTHMAQDRS----FMHDLFRVDRSDRDPEPARSAFKDFKRLLERYPNSLYAEDAQTRMY
D4ZBK3_SHEVD          GLVNMQSDSY----MFHDMLNIDRTDRDPQVAINAFKDFDRLIKSYPNSKYANDAAERMQ
Q8EBE4_SHEON          GLVNMQADSY----LFHDMLNIDRTDRDPKNAQDAFKDFDRLIKTYPNSKYAADAQKRML
A1SZN8_PSYIN          GLTYISADQQ----FFQDLFGIDRYNRDPNNAIQAFKDLSRIIKYYPSSEYAVDAQQRII
C4LBU1_TOLAT          GLANMQEDYN----FFHDKFGIDRSDRDPQYARQAFKDFQLVLKNYPDSLYASDARARAV
BAMD_PASMU            GLTNAALGDN----YIQDLFRIDRATRESSSIKAAFANFQTLVQNFPNSPYAQDALARMA
BAMD_HAEIN            GLTNAATGDN----FIQDFFGIDRATRETTSMRTAFSNFQNLVRVFPNSPYSQDALARMA
BAMD_HAEDU            GLSNVRLGDN----FIQDFFHVNRSSRTIESIRNAYGNFQMIVRIYPQSQYVNDAQQWMV
A3N1C5_ACTP2          GLSNARLGDN----FIQDFFGVNRASRALDSVRNAYGSFQTIVQHYPQSQYARDAQNWMA
Q7VQF4_BLOFL          GIINMHLDRNNPFPLLIKHLYTCWFNHNPIHANIAFHSFSKLIQNYPNSQYAPDSYKRLI
Q5NFJ0_FRATT          GVVGFEDGRG----MLQTYAPYDMNYHDPTGYQDAYTNFEKAIQLDPNGSFVPDAKRRMV
N9GM98_ACIHA          GVANMEMNYD----SLIRYTSLKQAHRDVSYIKVAYQNFVDLIRRFPSSQYSVDAAQRMK
BAMD_XYLFA            GLSNSNRDTI----FLRKVWSLDLSRRDLSAPQQAYNDFKTVLDRYPNSRYAADAKKQMT
Q8P681_XANCP          GLANSNRDTV----FLRRVWSLDPSRRDLSSPQQAYNDFNTVTDRYPNSRYAPDARKRMI
BAMD_RHILO            GLSYYRQIKD--------------VTQDQKEARQTLQTMQDLVTRWPTSEYVDDAKEKIR
Q7CXX0_AGRFC          GLAYSKQISD--------------VTQDQRAAQRTIEAMNKVVNDYPSSEYVADAQAKIR
J7QLU7_METSZ          GMSFYNQVPD--------------VMRDQQSAEKALEVFTQLVQKFPKSEYVNDAKYKIQ
Q89FV5_BRADU          AASHYDQIPD--------------ISRDQSRTEKAIASLEEVIRKYPTSEYATSAKAKIE
E3I232_RHOVT          ASSYFERISG--------------PTRDQGETKKAIAELETLISRYPDSRYSEDAKRRIK
Q3J4L3_RHOS4          ALSYYDQIDE--------------VGRDQGLTFQALQALRVVIEDYPESEYAQSAILKFD
A1BAK5_PARDP          ALSYYDQIDE--------------IGRDQGLTFQALQSLREVIEQYPDTEYARSAILKFD
D5AQ06_RHOCB          ALSYYDQIDE--------------VGRDQGLTFQALQALRAVIEEYPDSDYARSAALKFD
Q1GIU2_RUEST          ALSYYDQIDE--------------VGRDQGLTFQALQALRTVIEVYPESEYASSAILKFD
BAMD_CAUVC            AICYFEQIVD--------------VNRDQAATEQALAALRDVVQRYPNTEYATDARLKID
BAMD_RICPR            ALSYYMLISD--------------VNHDQSRTFLSKDSFEDVITKFPNTKYAIDSSLKID
H8K4C1_RICAG          ALSYYMLISD--------------INHDQSRTFLAKDSFEDVIAKFPNTKYAIDSSLKID
D5BPR7_PUNMI          ALCYYEQIVD--------------VQRDAEMTKLAMQAFEELVRRFPDGDYFRDATLKID
Q2RVV3_RHORT          GLCYYEQISD--------------VRRDQQITRQAMSNLRDVVTRFPDSPYARDARLKID
BAMD_HELPY            LQSHYYAFKN--------------HSKDQEFISNSIVSLGEFIEKYPNSRYRPYVEYMQI
Q7MQV7_WOLSU          LQANFFAFSR--------------ETLNQQLLLDSIDEVEEYIKKYPYSRYKPYADTMLL
W8KJ78_CAMCO          IKAKFDAFAV--------------PNRNQALMLESQKEIDSFLNDYPYTEYEPLVQTMLT
Q0P9I0_CAMJE          IKAKFDAFAV--------------PNRNQALMLESQKEIDTFLKDYPYTEYEPLVQTMLT
A7ZEJ2_CAMC1          IKANFDSFTQ--------------PNRNQKLMEDSVTEIEKFLYMYPNTEYKPLIETMLI
A7I0U7_CAMHC          IKSNFDSFNK--------------PNRNQKLVQISIVEIQNFLMQYPDTKYKPLLETMLI
BAMD_BUCAI            CLISMSLDKNR----FFSVFPINYYKNDYFYAKNAFFQLKYFIYQYPKSRYVVNAKKNLI
Q2GFJ1_EHRCR          IMANYMQISD--------------IDRDQSSVHKVLELLNEFIRLFPNSMYLEEVMKRLE
A1WZM0_HALHL          AAAAHALWDA----------TEGEAERDAAGARRAFGYYRDIVRDYPESERAEEAARRMN
W5WTR8_BDEBC          GLSYFNQLPAT-------------IDRDLSLAHDTILNLSDFIRRFPNSEYIADAKEKRS
Q74FV2_GEOSL          GLSYFNQIHG--------------FDTDQTPVSNTVTIFESFLRLYPQSEHAEEVRNKLD
I4C8A4_DESTA          ALAHFNQIKN--------------ADLDSALAQRSAKAFKAIMDDPDAGEFAKQAEEKYK
                                                                                  

BAMD_DESVH            ECRRLLAERELFIADVYWRTGKYGAAWQRYSFVRDNFKDVPHAVEYATEKANVAYLRHRE
Q30ZN4_DESAG          ECRRLMAEHELFVADFYWRTGKFRSAASRYQHVAQEFPDVEDLRAYAEEKGKIAYLRATE
C6BTV1_DESAD          KCRRALADHELYIADFFWRSSKFGSAWKRYAYVVRNFKDLPEVRKYAMKQAEMSYYEYQK
C7LR97_DESBD          KCRKLMAEHEMFVADFYFKSGSYNAAWTRYVYIIDNFPELEEIVQMAKSKSKVAYYYAQE
F2NBZ0_DESAR          KCLNELADHEYYVGEFYFKNKHYQAALERFAIIEQEYPDYLKMPRVKQYMARCEDILANP
B8FB11_DESAA          ICQETLARHDLFVGAYYFKAKEFHAARVRFRDILAAYPDVGVHRQALEYVALCDAFIAKE
Q6AQ36_DESPS          EAISFLADHEFAVIEFYLRTEKYEQAETRLEYLITAYPNTNVIPKAEKILAEIQAGNPPR
M1P971_DESSD          AANEFLVNHEYFVVEFYLRTEKYKEAQTRLQYLINTYPDATITPKATKLLKRLEAGDPPG
BAMD_PSEAE            YLRNLLAAYEVHVGHYYLKRQAYVAAANRGRYVVENFQETPAVGDGLAIMVEAYRRLGLD
A4VQL7_PSEU5          YLRNLLAANEIHVAHYYLKRQAYVAAANRGRYVVENFQGTPAVADGLAVMTEAYQRLGLD
B3PE03_CELJU          FLRNLLARYEIHVANYYFKRGAYIAAVGRGRYVLENFPKTPAIPDALAVMVQGYRLMSMS
C5BQY5_TERTT          YLRNMLARYEIHVANYYFKRSAYLAAANRGRYVVENFEGTPAVPDGLAVMAQAYQMLGMD
Q83DH4_COXBU          YIRNLMAQREIMIAEFYMKRRAYVAAANRGSYVVQHFQGSPQVAKALAIMVQAYRALGLP
A1WZ88_HALHL          QIRVALAEHELYVGRFYLERSAYIASANRARTIIARYPGTPAVPEAMGMLAESYRRLGLD
BAMD_NEIMB            KLVDALGGNEMSVARYYMKRGAYIAAANRAQKIIGSYQNTRYVEESLAILELAYKKLDKP
Q5F9W0_NEIG1          KLVDALGGNEMSVARYYMKRGAYIAAANRAKKIIGSYQNTRYVEESLAILELAYKKLDKP
Q7VZ03_BORPE          WLVNAIAMNEVHVARYYYERGAYVAAANRAQTVITDFEGAPASEEALYIMVESYDKLGMT
A9IIW8_BORPD          WLVNAIAMNEVYVARYYYERGAYVAAANRAQTVITDFEGVPAAEEALVIMAASYDKLGMT
E3HUN7_ACHXA          WLVNTIAMNEVHVARYYYERGAYVAAANRAQTVITDFEGAPATEEALYLMVESYDKLGMT
E8UD17_TAYEM          WLVTTLAEHEANVAKYYYEKKAYVAAINRAQVVLTEFSGVPSAELALYVLMKSYEALGSE
B2JG73_PARP8          YIVNALASHEVHAADYYYRRGAYVAAINRAQLAIKEYKNAPAIEDALHIMMLSYQKLDQP
Q63UR5_BURPS          YIVNALASHEVHAADYYYRRGAYVAAINRAQLAIKEYKNAPAIEDALHIMMLSYAKLNQP
A9BWB6_DELAS          YIVNSLAQYEVHVARYYYGRGAYVAAIARAQTAVKDYQGVPAVREAMQILVNSYDALGMT
A2SHC3_METPP          YIVNTLATYEVHVARYYYRRGAYVAAANRAQQAVQEFQRAPATEEALYILGISYDKLGLT
A4G6E0_HERAR          YLVNAMAQYDVHVANYYYRRGAYLAAANRAQAAVKNYPGAPAAEGALYVMIQSYDALNLP
A5EX52_DICNV          FLHNLLGKHDLEIADFYLRKGDFVAAAARAKNILEHYETTPSAPYALAIMIRAYRELGQK
BAMD_ECOLI            FLKDRLAKYEYSVAEYYTERGAWVAVVNRVEGMLRDYPDTQATRDALPLMENAYRQMQMN
Q32CS8_SHIDS          FLKDRLAKYEYSVAEYYTERGAWVAVVNRVEGMLRNYPDTQATRDALPLMENAYRQMQMN
Q8ZMW8_SALTY          FLKDRLAKYEYSVAEYYTARGAWVAVVNRVEGMLRNYPDTQATRDALPLMENAYRQMQLN
A6TCK3_KLEP7          FLKDRLAKYELSVVDYYTDRGAWVAVVNRVEGMMRNYPDTQATRDALPKMENAYRQMQMN
A0A0U1EVV2_YERIN      FLKDRLAKYELAVAQYYTKRGAYVAVVNRVDQMMRDYPDTQATRDALPLMENAYKQLQLN
BAMD_VIBCH            ALKNRLAEYDLATADFYLRREAWIAAINRTQELQKTYPDTEAARKSLEIQLEAYQQLGLT
Q5E7D8_ALIF1          ALKNRLADYELATADFYLRREAWISAINRCQELQRTYPDTEAARKSLTIMLSAYKELKLE
D4ZBK3_SHEVD          YLKNRLAKYSINVAEYYMKMNAWSAAAIRAQSVMETYPGTSSTERALEIMADAYGELGQE
Q8EBE4_SHEON          SLKNRLAKYSIQVAEYYIKMNAWSAAAVRAQSVLETYPGTPSTERALEIMAEAYGELGQN
A1SZN8_PSYIN          DLKDRLARYEIGIAQWYLKREAYIAAINRCKIVLNNYPDMPAVEQALEIMIASYNVLGIE
C4LBU1_TOLAT          YLKNRLAKFDLAIADFYMRREAWVSAANRAKYLIENYPDTEMTQPALEIMVQAYEKMDLT
BAMD_PASMU            YIKASLARHELAIAKFYAKRDAHVAVANRVVGMLQQYPDTQATYEALPLMQEAYEKMNLN
BAMD_HAEIN            YIKDALARHELEIAKFYAKRKAWVAVANRVVGMLKQYPDTKATYEGLFLMQEAYEKMGLT
BAMD_HAEDU            YLLNRMAEHELSIVKFYDKRDASVAVVNRVEEMLRFYPASKSTFDALPYMQKAYQRMGLK
A3N1C5_ACTP2          YLINRMAEHELSIVKFYDEREAYVAVVNRVEEMMRFYPESKPTYQALSYMQKAYEQMGVK
Q7VQF4_BLOFL          FLKNRIAYYKLAIIKFYDKKNAYISVITRSEEMLRYFPDTQATYQALHYMRRAYQNIHLI
Q5NFJ0_FRATT          FINNIIARHYDDIAHFYFKRGAYNAAIDRASQVIRNYPQSTSTEDALVLTIRAYNKLGLY
N9GM98_ACIHA          YIGQELAESEMNAARFNIQRKAWLAAAERARWVLEYYPQTPQTPEALATLAYSYQQLGDK
BAMD_XYLFA            ELRNMFAQYEMNVTLYYLRRTAWVAAAGRANFLLETYPQSAFQYDAVAALGEAYTHLGNK
Q8P681_XANCP          ELRDIFAQHELDNALYYLRRDAWVSAAGRANYLLETYPQSAFQYDAVAVLAEAYTHLGNK
BAMD_RHILO            FANDQLAGKEMQIGRYYLERREYIAAVKRFRTVVENYSNTRHVEEALARLTESYYAMGLT
Q7CXX0_AGRFC          FARDQLAGREMQVGRYYLERKEYLAAVSRFRIVVEQYQNTNQIEEALARLTEAYYAMGLV
J7QLU7_METSZ          VTRDQLAAKEMNVGRFYLLRKNYPAAINRFHDVLGKYQMTRHTEEALYRLTEAYLAMGVT
Q89FV5_BRADU          GARDQLAGKEMNVGRYYMQKRDYTAAINRYKAVVTQYQTTRHVEEALYRLTEAYMAIGIV
E3I232_RHOVT          LARDTLAASEMNVGRYWQKKGNYLGAVNRFKTVVTEYQQTTHVEEALMRLTECYMALGIV
Q3J4L3_RHOS4          LAFDHLAAKEMEIGRYYLKRGHYTAAINRFRTVVEDFQTTTHTAEALHRLVESYLALGLV
A1BAK5_PARDP          LAFDHLAAKEMEIGRYYLKRGHYTAAINRFRVVVEEFQTTSHTPEALMRLTEAYLALGLN
D5AQ06_RHOCB          LAFDHLASKEMEIGRFYLKKGHYTAAINRFRVVVEQYQTTTHTPEALMRLVECYLSLGLT
Q1GIU2_RUEST          LAFDHLAGKEMEIGRYYLKRQHYSAAINRFRVVVEDFQTTSHTAEALYRLIEAYLSLGLT
BAMD_CAUVC            MVNDQLAGKEMAIGRWYLKNGQTLAAIGRFKAVIERHQTTSHTPEALFRLVEAYLTIGLN
BAMD_RICPR            LVNDHLAGKEMMIGRFYLKKKNPMAAINRFEEVIDNYQTTYHSVEALYRLVESYMMLGLH
H8K4C1_RICAG          LVNDHLAGKEMMVGRFYLKKKNPMAAINRFEEVIDNYQTTSHAVEALYRLAESYMMLGLP
D5BPR7_PUNMI          LTRSHLAGKEMAVGRFYLSKQHYGAALRRFENVVTDYDTTNQVPEALYRMTEAYLSLGLA
Q2RVV3_RHORT          LARDHIAGKEMSVGRFYLKRQDFLAALNRFRVVVEQYDQTTHVPEALYRMVEINTLLGLP
BAMD_HELPY            KFILGQNELNRAIANVYKKRHKPEGVKRYLERIDETLEKETKPKPSHMPWYVLIFDW---
Q7MQV7_WOLSU          KLHLANLHLNKEIARIYTIQGKEEAAENYRERFKHHWLKEIVSKEPDMPWYRQLFNW---
W8KJ78_CAMCO          KFNLAVFYLNDTIQDLYERTGHTQSAEIYQERLQESEFYQQSIIKPELPWYRSIFEKF--
Q0P9I0_CAMJE          KFNLAVFYLNSTIENLYQRIGHDESAQIYKQRLQESEFYQQSIIKPELPWYRSIFERF--
A7ZEJ2_CAMC1          KFKLALYFLDMQIADLYKRTGRDVSAKIYEQKLEESPFKNSDLIKPDVAWYRKLFE----
A7I0U7_CAMHC          KFRLAENELNKSIKNLYEKTGRDESAQIYKERIGTSPVAGTDTIKPESPWYRVIFE----
BAMD_BUCAI            YIKNRLSEHDLSILKFYFFHKEYIAVINRGEEMLQRYSETPSARKALIYIEKSYYALKIF
Q2GFJ1_EHRCR          LVHQHIAGKEFSIGKFYLQRGEYVAAIKRFSTILNKYKDTKYYSESLYRIAEAYLALGDI
A1WZM0_HALHL          EIRSDVAEEELRRARRRLDDGAYAEAAERGAWIAEQYPGQQAAADALALQVDALERLGRE
W5WTR8_BDEBC          QTIKMLAEKEEYIADFYFKRKIYTSALTRYENLYANYSGLGFDQKALSRAALCAQKIGDS
Q74FV2_GEOSL          AARQNQVQYEIYVGQFYYRTEKYTSAIKRLEDALKRYPRSPLHDETLYYLGKAYIKAGDK
I4C8A4_DESTA          ECLKKLAAKELYKARTYVGMGNYQAARMAAKRVLDEYPKLGFDEEANELIGSIKNK----
                                                                                  

BAMD_DESVH            AQSENIREAREGSWKQWFKWL---------------------------------------
Q30ZN4_DESAG          EKAQQDRDRRHGSWKQWFEWL---------------------------------------
C6BTV1_DESAD          TLSQEERERLQGSWKELVDWL---------------------------------------
C7LR97_DESBD          K--DNDTVRHPSKLKQYLDWL---------------------------------------
F2NBZ0_DESAR          VKAEPPMLLKPFSYLFDANW----------------------------------------
B8FB11_DESAA          EAQAMELKAKAQEERREEAEKYKKKLDKERAKAVKKGIVIPEAESGPPESE---------
Q6AQ36_DESPS          RPLFSWFPDFKLPDWTKVADDEDNTINTEPNR----------------------------
M1P971_DESSD          FNLSSWFKKTLLPDWAQFKSEEDSGVPSSLNEVEPLNTRY--------------------
BAMD_PSEAE            DLASTSLETLKLNYPDNASL-KDGEFVARESEADTR-SWLAKATLGLIEGGEPPPHMETQ
A4VQL7_PSEU5          DLADASLKTLQLNYPDHATL-EDGKFTPIEREEDTR-SWLSKATLGLIEGEAPRPD-TSR
B3PE03_CELJU          TQADEMLEILRTNYPNYPALDKDGQFNDRYMYDDGHFNLFAWLTFGLFS-----------
C5BQY5_TERTT          DYSKSAEKVLVKNFPNHPAL-KDGKFDYRFDRDDNR-TWVDYVTLGLFK-----------
Q83DH4_COXBU          KMADASNHLLQTNYPHTLEARKLRKA----------------------------------
A1WZ88_HALHL          PLDEDVERALRERHEVPAPELGGR------------------------------------
BAMD_NEIMB            RLAADTRRVLETNFPKSP-------FLKQPWRSDD--MPWWRYWH---------------
Q5F9W0_NEIG1          QLAADTRRVLETNFPKSP-------FLTHAWQPDD--MPWWRYWH---------------
Q7VZ03_BORPE          ELKGDAERVLDQNYPNSK-------FKTQGLSAD---KSWWNPFSWR-------------
A9IIW8_BORPD          DLKNDAERVLKTNYPDST-------MTPQNLLTD---KSWWNPFSWK-------------
E3HUN7_ACHXA          ELKNDSQRVYDKNFPNSE-------FKTKGLKAD---KSWWNPFN---------------
E8UD17_TAYEM          DQAADAKSVLVKNYPNSR-------YLTHGFKGEGGIMKYLSPTNWFN------------
B2JG73_PARP8          QLAEDTKRVLAGTFPDSP-------YITGRSRPGKE-KSWWQF-----------------
Q63UR5_BURPS          QLADDTKRVLASTFPDSP-------YVTGHARPGSK-KSWWQF-----------------
A9BWB6_DELAS          QLRDDAQRVLTASYGQE---------SDQDL-TAKQ-KSWWKLW----------------
A2SHC3_METPP          ELRDDAQRVLQTNFPESR-------YVKDGF-ETAD-KPWWQIW----------------
A4G6E0_HERAR          QLRDDAERVMKTNFPNSV-------YFHGG--PKKD-KPWWQIW----------------
A5EX52_DICNV          LLADDAMRVFNMNYVDSLESPEIKRYLQGNIHKQANFFDRMRGSSIKKL-----------
BAMD_ECOLI            AQAEKVAKIIAANSSNT-------------------------------------------
Q32CS8_SHIDS          AQAEKVAKIIAANSSNT-------------------------------------------
Q8ZMW8_SALTY          AQADKVAKIIAANSKNT-------------------------------------------
A6TCK3_KLEP7          AQADKVAKIIAANSKNT-------------------------------------------
A0A0U1EVV2_YERIN      AQADKVAKIIAANPA---------------------------------------------
BAMD_VIBCH            DAIERTKQLMQLNPL---------------------------------------------
Q5E7D8_ALIF1          DAIKRTEELIALNPQ---------------------------------------------
D4ZBK3_SHEVD          KLKNNVLTVMKANYPDNKRLAD--------------------------------------
Q8EBE4_SHEON          QLKQNVLMVMQANFPNNEILSN--------------------------------------
A1SZN8_PSYIN          EPKMNALAVLKLNYPKNLTLIDVKP-----------------------------------
C4LBU1_TOLAT          DLAKHARQMLSTNYPDSEYLHP--------------------------------------
BAMD_PASMU            DLAAKTAAIIEANKGRTFAEIEKPAEPEGLLKQ---------------------------
BAMD_HAEIN            ALANDTQKIIDANKDKTFAPIEKPNEPDLKVPAVK-------------------------
BAMD_HAEDU            DSEAKVAELIEMNKAKVFPKITKPEYSKQF------------------------------
A3N1C5_ACTP2          DSAEKVAALIEANKDKNFPEAIKPEYSEQF------------------------------
Q7VQF4_BLOFL          DQANIINQIITENQ----------------------------------------------
Q5NFJ0_FRATT          DQAKANIRVLKKNYPKNKFIKNLRPDGTEEPSWYQRWFGWL-------------------
N9GM98_ACIHA          ATSQQYIEILKLNYPNLVKSNGEVNLRAARKEGSWVNRATLGLLGRESQHIEVENNETQI
BAMD_XYLFA            TLADNARQVLQTNAPDHPWLKGKWPKYPAAIRKLNPFAGEKSAATGQINAVVDSN-----
Q8P681_XANCP          TLAADARRVLELNSPQHPWLTGDWPKYPWAVRKLNPFAGEKSAATGQRNAQMSRD-----
BAMD_RHILO            SEAQTAAAVLGTNYPDSPWYKDSYKLLQSNGLSPREN------AGSWISKAGKLITGA--
Q7CXX0_AGRFC          DEAQTAAAVLGNNYPDSQWYADSYKLLKGQGLEPREN------KGSWISRAGKKLIGA--
J7QLU7_METSZ          NEAQTAAAILGHNYPDSQWYKDAHALLKTDGLEPHEY------TDSWLSKIGKTLHAI--
Q89FV5_BRADU          GEAQTAAAVLGHNFPDSRWYKDAYNLVKSGGLEPSEN------QGSWISKTFKKMGLG--
E3I232_RHOVT          NEAQTAAAVLGHNFPDSPWYKDAYALLQSGGTAPRED------SGSWISHAWKRTVGSVA
Q3J4L3_RHOS4          NEAQTAGAILGHNYRSSPFYEDSYKLLTGRGLSMEAK------GDSWLSKVYRQMIRGEW
A1BAK5_PARDP          DEAQTAGAILGHNFQSSPFYQDAFAQLRGRGLQAEAR------GDSWLTRVYRQVIQGKW
D5AQ06_RHOCB          DEAQTAGAILGHNFQSSPFYDDAYKRLKKMGLEPEAK------GSSWLSAIYRQVIKGEW
Q1GIU2_RUEST          DEAQSAGAILGHNFQSTDWYEDGYRLLTAQGLKLKDR------GNNWLAKIYRQSIKGQW
BAMD_CAUVC            EEAKRNGAVLGYNFPGDRWYVDAYRLLNDNGLRPAVEPLKAGAKRNALERILSKDKEATL
BAMD_RICPR            DEAKKYTSVLGYNYPNSKWYSYAYRLVKNYQN----------------------------
H8K4C1_RICAG          DEAKKYASVLGYNYPDSQWYSYAYRLVQNHQN----------------------------
D5BPR7_PUNMI          SEANRVEEVAVYNYPKSIWTQRLLELRANPERELEAGWFERTAES--VVNLFD-------
Q2RVV3_RHORT          DEAKRVAAVLGHNFPGSDWYGDAYRLITGEKVPSATEGAEPPPSSSWTDSLTGWL-----
BAMD_HELPY            ------------------------------------------------------------
Q7MQV7_WOLSU          ------------------------------------------------------------
W8KJ78_CAMCO          ------------------------------------------------------------
Q0P9I0_CAMJE          ------------------------------------------------------------
A7ZEJ2_CAMC1          ------------------------------------------------------------
A7I0U7_CAMHC          ------------------------------------------------------------
BAMD_BUCAI            DTAKKISKIILLNKIQ--------------------------------------------
Q2GFJ1_EHRCR          AAYARYMSLLKECCIDTGWYKEPLVK----------------------------------
A1WZM0_HALHL          REAEATRRMLEIKHPDHPALR---------------------------------------
W5WTR8_BDEBC          TKAKKYSELLAKDFPESKELKGLRKEIE--------------------------------
Q74FV2_GEOSL          AGGREAFQRLFNEFRTSKYVDEARSFLDKNF-----------------------------
I4C8A4_DESTA          ------------------------------------------------------------
                                                                                  

BAMD_DESVH            --------------------------------------------------------
Q30ZN4_DESAG          --------------------------------------------------------
C6BTV1_DESAD          --------------------------------------------------------
C7LR97_DESBD          --------------------------------------------------------
F2NBZ0_DESAR          --------------------------------------------------------
B8FB11_DESAA          --------------------------------------------------------
Q6AQ36_DESPS          --------------------------------------------------------
M1P971_DESSD          --------------------------------------------------------
BAMD_PSEAE            AAKDVIKQYEDAEREIPAELKPENQDHSADDEKPESDDDEDSGRSWWSYMTFGLFD
A4VQL7_PSEU5          ANRDVLRQYENAARDLPEELRPVLKEVEQQEPK----------RSWWSRLTFGLFD
B3PE03_CELJU          --KSEVTGFDTRELYDPQYIKAPAKSVN----------------------------
C5BQY5_TERTT          --RRPTINFDTREIYNPFYNEDLDPQPPG---------------------------
Q83DH4_COXBU          --------------------------------------------------------
A1WZ88_HALHL          --------------------------------------------------------
BAMD_NEIMB            --------------------------------------------------------
Q5F9W0_NEIG1          --------------------------------------------------------
Q7VZ03_BORPE          --------------------------------------------------------
A9IIW8_BORPD          --------------------------------------------------------
E3HUN7_ACHXA          --------------------------------------------------------
E8UD17_TAYEM          --------------------------------------------------------
B2JG73_PARP8          --------------------------------------------------------
Q63UR5_BURPS          --------------------------------------------------------
A9BWB6_DELAS          --------------------------------------------------------
A2SHC3_METPP          --------------------------------------------------------
A4G6E0_HERAR          --------------------------------------------------------
A5EX52_DICNV          --------------------------------------------------------
BAMD_ECOLI            --------------------------------------------------------
Q32CS8_SHIDS          --------------------------------------------------------
Q8ZMW8_SALTY          --------------------------------------------------------
A6TCK3_KLEP7          --------------------------------------------------------
A0A0U1EVV2_YERIN      --------------------------------------------------------
BAMD_VIBCH            --------------------------------------------------------
Q5E7D8_ALIF1          --------------------------------------------------------
D4ZBK3_SHEVD          --------------------------------------------------------
Q8EBE4_SHEON          --------------------------------------------------------
A1SZN8_PSYIN          --------------------------------------------------------
C4LBU1_TOLAT          --------------------------------------------------------
BAMD_PASMU            --------------------------------------------------------
BAMD_HAEIN            --------------------------------------------------------
BAMD_HAEDU            --------------------------------------------------------
A3N1C5_ACTP2          --------------------------------------------------------
Q7VQF4_BLOFL          --------------------------------------------------------
Q5NFJ0_FRATT          --------------------------------------------------------
N9GM98_ACIHA          EPPRRSLTNRLSFGLFDKPETEQSSEEDAAN-------------------------
BAMD_XYLFA            --------------------------------------------------------
Q8P681_XANCP          --------------------------------------------------------
BAMD_RHILO            --------------------------------------------------------
Q7CXX0_AGRFC          --------------------------------------------------------
J7QLU7_METSZ          --------------------------------------------------------
Q89FV5_BRADU          --------------------------------------------------------
E3I232_RHOVT          G-------------------------------------------------------
Q3J4L3_RHOS4          L-------------------------------------------------------
A1BAK5_PARDP          L-------------------------------------------------------
D5AQ06_RHOCB          L-------------------------------------------------------
Q1GIU2_RUEST          L-------------------------------------------------------
BAMD_CAUVC            APPGERKAKKGLLGPLGM--------------------------------------
BAMD_RICPR            --------------------------------------------------------
H8K4C1_RICAG          --------------------------------------------------------
D5BPR7_PUNMI          --------------------------------------------------------
Q2RVV3_RHORT          --------------------------------------------------------
BAMD_HELPY            --------------------------------------------------------
Q7MQV7_WOLSU          --------------------------------------------------------
W8KJ78_CAMCO          --------------------------------------------------------
Q0P9I0_CAMJE          --------------------------------------------------------
A7ZEJ2_CAMC1          --------------------------------------------------------
A7I0U7_CAMHC          --------------------------------------------------------
BAMD_BUCAI            --------------------------------------------------------
Q2GFJ1_EHRCR          --------------------------------------------------------
A1WZM0_HALHL          --------------------------------------------------------
W5WTR8_BDEBC          --------------------------------------------------------
Q74FV2_GEOSL          --------------------------------------------------------
I4C8A4_DESTA          --------------------------------------------------------