CLUSTAL format seed alignment for MF_00924

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

BAMC_SHEON            ------------------MLKKVTPLFLVAAVAACSSPLERRQANGG------EDYVQAE
BAMC_SHESH            ------------------MLKQVTPLVLIAAVTACSSPVERRQANGG------DEYTNVK
BAMC_FERBD            ---------------MKHNRLAIAALAPVLILVGCSTPLERRQASGG------FDYLEQP
F5Z8A1_ALTNA          ----------------MNRTLAIVSSMVVIALAGCSSQTDRKTASGT------YKYLETK
BAMC_PSEA6            ----------------MTTKFFIGTAIAVSVLSACSSLEERQIASGN------FEYTKQQ
G4QGT6_GLANF          -----------------MKYKVVGLGLVAFAIAGCAGKEEREIASGS------FEYLEAA
BAMC_PSEU9            ---------------MQYWIPKALAVSVLVSLSGCSVFTSDAHNER-----------NYR
A0A0N1MRY5_9GAMM      ---------------MQYWIPKALAVSVLVGLSGCSVFTDEAHHKR-----------NYR
BAMC_YERPE            ----------MAISLQKSTVVKVVGVSLVMLLAACSTDQ-RYKRQVS----GDESYLTAP
BAMC_RAHSY            MASLFDKNSFQMTRLQKTAVAKVVGVSLIMLLAACSSDQ-RYKRQVS----GDEAYLDAS
Q8ZN72_SALTY          ----------MAYSVQKSRLAKVAGVSLVLLLAACSSDS-RYKRQVS----GDESYLDAA
D2TTB2_CITRI          ----------MAYSVQKSRLFRVAGVSLVLLLAACNSDS-RYKRQVS----GDESYLDAA
BAMC_ECOLI            ----------MAYSVQKSRLAKVAGVSLVLLLAACSSDS-RYKRQVS----GDEAYLEAA
E3G9E9_ENTLS          ----------MAYSVQKSQLAKVAGVSLVLLLAACSSDS-RYKRQVS----GDEAYLQAA
A7ML06_CROS8          ----------MAYSVQKSRVAKVATVSLVMLLAACSSDS-RYKRQVS----GDESYLDAA
D8MVL1_ERWBE          ----------MAYSVQKSTVAKVVGLSLVMLLAACSSDQ-RYKRQVS----GDESYLKAA
Q2NS75_SODGM          ----------MAYSMQKSQVAKVVGVSLIMLLSACTSDQ-RYKRQVN----GNEEYLKAP
E0SE29_DICD3          ---------MMSSSLQKSMVAKVVGVSLIMLLAACTSDQ-RYKRQVN----GDESYLKTP
BAMC_XENNA            ----------MATLLQTSKVMKVAGLSLVVFLAACSSDQ-RYKRQVN----GDESYLETP
BAMC_PHOAA            ----------MAILLQKSKVMKIAGMSLAMLLAACSSDQ-SYKRQVN----GDYAYLEAP
J7TFW8_MORMO          ----------MATLLQKSKVTKLAGLSVVLLLAACSGDQ-NYKRQVS----GDTSYLDAP
A0A2A2GVJ0_9GAMM      ----------MATILHKSKAIKLAGLSLAIFLVACTSNQ-RYKRQVS----GDESYLNTP
C4K790_HAMD5          ----------MKIKLNPKMLIIFLSLLLTVCAKNSNAKR-EMKSETKSAMKGEEYYLNTP
R8AU16_PLESH          ---MSHSLKGTAVLKNTLSVKSVLGLSLVMALTACSSDGGRFKREVN----GNDSYLNTP
Q7MIL3_VIBVY          ---------------MKFSRQLVLSSLAVFVLSACSGSATQRRQAKD-----DFAYLETP
BAMC_VIBTL            ---------------MKYSHQLVIGSLAVFVLTACSGSPTQRRQAKD-----DFEYLETP
BAMC_VIBCH            ---------------MKFSRQLVLGSLAVLVLSACSSSPTQRRQAKD-----DFDYLETT
Q87MI3_VIBPA          ---------------MKLSSQLVLSSLAVFVLTACSGGANQRRQAKD-----DFEYLNTP
E3BG46_9VIBR          ---------------MKLSHQLVVSTLAVLVLSACSSSPAQRRQAKN-----DFDYLNTT
Q6LN86_PHOPR          ---------------MNCNYRLVLTTVMVASLAACSGGADRRRQANQ-----DFTYLESK
D0YWF8_PHODD          ---------------MNHNYKLAIAAVIVTTLTACSS-ADRRRQANN-----DFNYLDTQ
BAMC_PASMU            ------------------MKKWLFPFAFVATLAGCSVSNESKQQAND----TYQKSDAAL
E1W3R7_HAEP3          ------------------MKKIVLSLVAAALLSACSNSVEKMQTAND----TYQNSDREI
BAMC_ACTSZ            ------------------MKKCLFPLSVLAVIVATGCGNTS-PYAND----SYEKHANAP
Q65VY6_MANSM          ------------------MKKWLLSVAVLATVTACSSSNESRQVAND----SYEKNAESK
BAMC_ACCPU            -----------MNKLNSVVVARGAVAVLLIGLAGCTGSLLEPKKIEYKT-------ASAN
BAMC_THIDA            --------------------MRLLPLFLMVTLAASGCGIVESKKIDYK---------SSN
A0KGP4_AERHH          ---------MFKANGKGNAVRLVLSVATVAVLAACSSPQERKMANRG-----FEYEDARL
BAMC_OCESG            ----------------------MISLLAVAVLAGCSNPETRSQANRG-----FDYEQETL
BAMC_PSYIN            ------------MSKFYKSGRVTTAVIVALSLSACARFDARTQANGD------FDYVQTP
BAMC_KANKD            -------------MSTLNKYKTLIIISSLAAVSSCSWFSAKDGTEDI-----DDRYMKSQ
                                                                                  

BAMC_SHEON            QAPMLKIPEGLKTPPYNKEYDVPALGPKAN-PALVGKNLDIRPPLQV------LPMAEGT
BAMC_SHESH            VQPALTIPEGLNAPTYSKEFDIPKLNSKAD-DKLVGKLLDIRPPLQV------LPMAEGT
BAMC_FERBD            APTPLVVPAGLDAPRLSREFDIPKLGDNAE-RDVVGPRLDVRPPLQV------LPLAPGT
F5Z8A1_ALTNA          EQTPVRVPADLDAPTFSREFAVPELDESVD-ESLVGKKLLVQSPALV------LPLVTGS
BAMC_PSEA6            PGHDIQVPADVDRPNFSQAYKLPALDADAP-RNFIGKKLKVVSPALV------LPLVTGS
G4QGT6_GLANF          QHKSLDVPEDFDSPNYSQRYILPDVGENAP-KDLKGKKLKVTPPSLI------LPLVAGT
BAMC_PSEU9            AHEPVKAPASLSQPAQDPVYKMDVGQYDNN-PEA----TNYRPPAQV------LTIAKGS
A0A0N1MRY5_9GAMM      ATAPVQVPGQLAQPAQDPTYKMEVAAYDNN-PDS----TNYRPPAQV------LTVAKGS
BAMC_YERPE            GLKPLNAPSGMILPVQNGEFDVRTVNSQ----GAVGKQLDIRPPVQP------LTLLSGS
BAMC_RAHSY            GLHELKAPVGMILPVQNGTYEVQAGSMQ----GAVGKQLDIRPPSQP------LALLSGS
Q8ZN72_SALTY          PLAELHAPAGMILPITTGDYVIPVTKGS----GAVGKALDIRPPAQP------LALVSGA
D2TTB2_CITRI          PLAELHAPAGMILPVTTSDYNIPVTNGS----GAVGKALDIRPPAQP------LALVSGA
BAMC_ECOLI            PLAELHAPAGMILPVTSGDYAIPVTNGS----GAVGKALDIRPPAQP------LALVSGA
E3G9E9_ENTLS          PLSELHAPAGMILPIQNGDYNIPVARGD----GATGKSLDIRPPAQP------LALVSGA
A7ML06_CROS8          PLAELHAPAGMILPVQNGDYNIPTPRTN----GPVGKQLDIRPPTQP------LALVSGA
D8MVL1_ERWBE          DVSDLHAPAGMVMPLQNGDFDIPSASTT----GAIGKQLDIRPPAQP------LALMNGT
Q2NS75_SODGM          PLRALSSPSGMILPLQNGDYEIPAVPRN----GAVGKGLDIRPPAQP------LALLNGS
E0SE29_DICD3          EHRALDVPSGLILPVQNGDYEVPPVNQN----GLVGKALDIRPPMQP------LALLNGS
BAMC_XENNA            PLKTLNIPGGMILPLQNGEYDVPSATST----GAVGKELDIRPPLQA------LALLTGS
BAMC_PHOAA            PLKALNVPAGMILPLQNGEYDIPPTISK----GLIGKELDIRPPSQA------LALLSGS
J7TFW8_MORMO          QLQALNVPQGMILPLQSGQYDIPQVKQD----GATGLALDIRPPVQT------VSLLAGS
A0A2A2GVJ0_9GAMM      PLKNLTIPQGISLPLQNGEYDIPPANQN----GAVGKALDIRPPIQT------LSLLSDT
C4K790_HAMD5          KLTSLKSPEGLMLPLKNSNYYVPDVTQK----EPVGKQVDIRPPVQI------LALIEAS
R8AU16_PLESH          AQTAMVWPAGVSAPLASNDYAIPSAGQ-----GPVGKQVDVRPPQQV------MPLLNGS
Q7MIL3_VIBVY          PLEQWQLPEG-ATPQFYPNYNIPQGEFA----GGIGKQVDIRPPQQI------LELIPGA
BAMC_VIBTL            EFSQWQLPED-AQPQFYPNFDIPSGEFS----GGTGRQVDIRPPQQV------LELIPGA
BAMC_VIBCH            EFKPWVLPQG-ATPQFYPNYDIPQGAFH----GGVGNVVDIRPPQQV------LELIPGA
Q87MI3_VIBPA          ALEAWNVPQG-AQPQFYPNYDIPQGNYA----GGLGKSVDIRPPQQV------LELIPGA
E3BG46_9VIBR          PLKDLQLLKD-AEPEFYKTYQIPSGQYT----GGQGKEVDIRPPQQV------LELIPGA
Q6LN86_PHOPR          PLESWTLPAG-AEPFSTDDYAIKNKAYQ----GEIGSGVDIRPPQQV------LELIPGA
D0YWF8_PHODD          PLESWTQPEG-ARAFDTNVYAIPTQSFS----GEIGSQVDIRPPAEI------LNLIPGA
BAMC_PASMU            PLFAPLNTAGVSLPKQDTTYQLP--QVK----VKKADQVDIRPPETP------LAIIQNS
E1W3R7_HAEP3          PSFSPLASGGVTLPQADPTYELP--QLN----AKK-ERVDIRPPSTP------LAIIKNS
BAMC_ACTSZ            -TFTTIDTAGIRIIGQNDTYLLP--ATN----VKKGENMDIRPPAIP------MAIIGNS
Q65VY6_MANSM          INFSPLATGGVTIVGQDNKYQLP--TTN----ISKGPAVDIRPPTTP------MSIIGNS
BAMC_ACCPU            KVPTLEVPPDLTSPTRDDRYAVPDTSGKGA-ATFSAYSAERSPQARAQQKSDVLPEVDTA
BAMC_THIDA            KLPTLEIPPDLVAPTADNRYAIPDTEGSGT-ATLSTYSAER--KAAPSGTPSLLPAQDKA
A0KGP4_AERHH          EGRAFLVPAGLNTPAFNSSFDIPALPESSR-DGALGAKVDVRPPAQL------LTVVPGS
BAMC_OCESG            RTAPLLIPEGLQAPRFNTEYVIPKGTAQ----GVTGKVLDIRPPTQV------LPLVRGS
BAMC_PSYIN            RGEHYQ-TAHFTQNEARDIYDIPALTEQQKRIGFLSSNVDIRPPTQL------IPVIDGV
BAMC_KANKD            QDLELQVPPNVKQIEVQDRYRVPEGVIITN-RNAKGKALSLDPPQLL--------LVGGD
                                         : :                                      

BAMC_SHEON            HVEEGS-DNIKIVVESIDNNVDLKQEIFTNLDDFFAKQAIPIRSRDFDKGSIETDWIESR
BAMC_SHESH            HVEESG-DSIKIVVESIDKDVDLKQELYTVLNNYLASQSINVLSEDYDKGLIETDWIENE
BAMC_FERBD            RIQDGV-DSITVLVESNQDDIDLAQEIHDTLLKFLDDKSINVARD--DSGVIVTDWIENE
F5Z8A1_ALTNA          HVEEGK-STATIWFDQVDDSQPLSQAVWNSLLSFLEEQGIGVDFFDPEQQVLNTDWMIIK
BAMC_PSEA6            HVDDGS-KDAKVFFDQVDDSQPLDTTIWNSLLSYLEEQGIGIESFDKDKQRLVTDWVVAK
G4QGT6_GLANF          HVEEGS-EDAKVLFDQVNDNEPLQKTVWDTVLTYLEKSSVGVEKFEKENNILVTDWVTEI
BAMC_PSEU9            WVEEAD-KQARIYFDKNDGIEDLDVFIWDSIQAVLADNNISATQLDKTQGTLVTDWYAIV
A0A0N1MRY5_9GAMM      WVEETD-KQARVFFDKNDGIVDLNKFITESVKAVLAEQQTRVQKEDNTTGTIETDWYSII
BAMC_YERPE            RAENAT-DTSKLLLENS----PQNRDLWAQVTRVLQDHNWPIASRQDASQTLTTDWIKWN
BAMC_RAHSY            QTQFSG-NSSTVLLENT----AQNRDLWNNVVKAVEQNNFKIANRDDANQTLTTDFVDWN
Q8ZN72_SALTY          RTQFSG-DTATLLVEN-----GRSSTLWPQVVSVIQAKNYPIEKRDDASQTLTTDWVNWN
D2TTB2_CITRI          RTQFAG-DTATLLVEN-----GRGNTLWPQVVSVIQSKNYTIEKRDDASQTLTTDWVEWN
BAMC_ECOLI            RTQFTG-DTASLLVEN-----GRGNTLWPQVVSVLQAKNYTITQRDDAGQTLTTDWVQWN
E3G9E9_ENTLS          RTQFTG-DTATLLVES-----GRSGSLWPQVVSIVQAKNYTITKRDDASQSLNTDWVQWN
A7ML06_CROS8          RTQFTG-DTATLLLES-----GRNGALWPQVVSVVQSLNYTIEKRDDAAQTLNTDWVQWN
D8MVL1_ERWBE          RTQFAG-NSGVLLLDS-----ARTGSLWPQVVDVVQAKNYPIASRTDATQTLTTDWVQWN
Q2NS75_SODGM          RSQYSG-NRAVIQLENS----AQGRDLWSQVAAVVQSKVYPIASRQDAQLSLNTDWIAWT
E0SE29_DICD3          RGQVSG-NSATLLLENN----ARNSSLWAVLTQVLQSKGYTIASRQDASRTLTTDWVNWK
BAMC_XENNA            RIENSA-QSSKLLLENT----SEYSKLWSQVVSLLAKKNYQISQKDEAAQTLTTDWITWQ
BAMC_PHOAA            RTENSI-KSSKLLLENT----PENSNLWSQINNVLLKKGDKISQRDDANQTLVTDWIEWQ
J7TFW8_MORMO          RTETAG-DASRLLLENS----AENRTLWAQINRVLADRSVPVSQRDEAGGVIVTDWIVWQ
A0A2A2GVJ0_9GAMM      HTENSL-TASRLFLTNT----AENSALWSQINAILQQKMIIVRQKNDPDHSLITDWITWP
C4K790_HAMD5          QSQYAN-GISTLFLED------SPGNLWLEVLNIIKKKNLPIANQNDRDQTLTTDWITWN
R8AU16_PLESH          RTQSEG-NLSQVIMEGRL---YPAQTLWGNLLSALQQEKVTIASQSAADMTLTTDWVNWT
Q7MIL3_VIBVY          RYERS--QGEVTLWLIKQ---EEADEVWQTVKDMLAERQIPIDMQSDTH--IETGWVTWR
BAMC_VIBTL            RTERQ--NGEVTLWLLRA---EEADRVWQTAVDMLTQRNIGIREQSEND--IETDWVTWV
BAMC_VIBCH            RAERQ--NGEVTLWMLRQ---DEAQKVWDTALKMIAERKIPLRKQTDSM--VETDWVDWV
Q87MI3_VIBPA          RLDRSS-NGEVTLWLLRK---DELDKVWQTVQGMVEARKIPVESQTDSR--IETGWVTWN
E3BG46_9VIBR          RVERK--NGDITLWVLKE---DELKKIWRTTQDLFVKRGVSMRENTESR--IETDWLSWQ
Q6LN86_PHOPR          RSVKD--ADGVTLLLPKA---EELPKVWLLIQGIIAEQNVKIRNQAANS--IETDWVTWT
D0YWF8_PHODD          RSFHD--QEGVTMLLPSS---AEMNRLWNVTKQMITKRDVKLLSDTTNE--IKTDWVSWT
BAMC_PASMU            IAQFDG-ERALIAYPID----KREVYNLQQVARLLKEQGIGYQLT---NEKIVTDWAPTG
E1W3R7_HAEP3          LTQFDG-ERALIVYTDA----QAELYNLKQIERLLKEEGTNSTLN---GAVLISDWAPTG
BAMC_ACTSZ            VAQFDG-ERASIIYPSE----KAEVYNIRQMARLLEERSIKFTTK---DNQIETDWTNFG
Q65VY6_MANSM          VAQFDG-ERASIVYPAA----KSAVYNLDQVARLLKEENIEFTRQ---ENKLLTDWAPTG
BAMC_ACCPU            RIERSG-NQRWLVASGS------PDKLWGPVKDFWQETGFVIKLELPDAGVMETDWAENR
BAMC_THIDA            RIERAG-TQRWLVVQAT------PQQVWPVIKDFWQENGFIVNLESPETGVIETDWAENR
A0KGP4_AERHH          QVVANA-GEPTMAFYALSTSQSVERDTWAFLMNFLAQYKVTTEKLDQQAGVLQTGWFDNT
BAMC_OCESG            EAMTEG-SGLWFYQQRLD----------QPLERELNQALTVFFEQTDTDYDAVANGFESS
BAMC_PSYIN            VLEANNSDKTTVLFNAFNHTENMKDKVWTLLESYIAANNIEVAAKDSNLTQIETGMFRHQ
BAMC_KANKD            GVREDSEQSHPTVWVRH-----QDTPFMNYVSRFMMQKNIPVISSTEKQ--ISSDWISDE
                                                                           :.     

BAMC_SHEON            EVLESSLWG------SDKEYLLRQRYRFDVE----TRPHGRTANIVIHLVEHEEFYDGKE
BAMC_SHESH            EVIDSSFWG------SDEIYQLRQRYQFEVD----VRPHGRSGNIAINLIDHEESFDGKQ
BAMC_FERBD            EVIGKSWF-------RDKVYQIRQRYEFDTV----VKDHGRSGSITIELVDHEEGLDGVD
F5Z8A1_ALTNA          KEVDSPWYSW-----TSTESEVGRRFEFVLD----VKPHGRTAALSVDLKDYMATT-GDD
BAMC_PSEA6            EILDDHWYSW-----SSVERDTSQRFEFDLE----MKPHGRTATLNAHLVDYKERQ-GEA
G4QGT6_GLANF          REVPSSWYDF-----TDNLVTVKKKFKFTMT----LAPHGRTAALRTELVDYVDEQ-GRA
BAMC_PSEU9            K--PEESWLW-----GNDESVDLERFKFTIE----EKEHQRTASLTAELIDFK-------
A0A0N1MRY5_9GAMM      K--PDDGW-F-----ADSAPVSQQRFIFTLE----EKSHQRTASLSSKLVDYKS------
BAMC_YERPE            R--------------ADEDVQFEGRYQISV------QEQGYQLALVVKSLELQQG-----
BAMC_RAHSY            R--------------ADEDFQYQGRYQISV------KQQSYQLALTVKTLELKQQ-----
Q8ZN72_SALTY          R--------------LDEDEQYRGRYQISV------KPQGYQQAVTVKLVNLEQA-----
D2TTB2_CITRI          R--------------LDEDQQYRGRYQISV------KPQGYQQAVMVKLINLEQA-----
BAMC_ECOLI            R--------------LDEDEQYRGRYQISV------KPQGYQQAVTVKLLNLEQA-----
E3G9E9_ENTLS          R--------------LDEDQQYRGRYQISV------KPQGYQQAVVVKLINLEQG-----
A7ML06_CROS8          R--------------ADEDQQYRGRYQVSV------KPQGYQQALVVKLVNLEQD-----
D8MVL1_ERWBE          R--------------ADEDHQYRGRYQISV------QQQGYQQALSVKLLELQQE-----
Q2NS75_SODGM          R--------------ADEDEQYSGRYQISL------ATQGYQASLQVTSLGLQQQ-----
E0SE29_DICD3          R--------------EDEDVAHQARYQISL------QTQGYQLALTVKLLDLQQN-----
BAMC_XENNA            R--------------ADENVPYQGRYHVSV------SQQDYQTTLSVSSDGLKQG-----
BAMC_PHOAA            R--------------TDEDVPYQTRHRISI------AHQNYQIELSVANEGLRQG-----
J7TFW8_MORMO          R--------------ADEDLPLQSRQRIKI------EPAGSQVAVVVTSEGLKQG-----
A0A2A2GVJ0_9GAMM      R--------------GDEDIAIQTRQKIQL------NPQNNQIVITVTNEGIKQG-----
C4K790_HAMD5          N--------------MNENPPFSGRYEISV------KQNERPKRLILKTLDLHQG-----
R8AU16_PLESH          Q--------------SDEVQNMRARYQLQV------QSQGYNTVLQSRLTELQDSQ----
Q7MIL3_VIBVY          S--------------EDEEMEIGSRYAIDR------FEANNRHGFKINLIEWREGT----
BAMC_VIBTL            S--------------EDEEVEIGSRYSISR------FQANNRHGFKINLIDWREGS----
BAMC_VIBCH            S--------------EDEDVTIGSRYLMSM------VETNNRYGFKISLIGWRENG----
Q87MI3_VIBPA          S--------------PDEELEIGSRYEISR------AEANGRHGFKVSLIDWREGD----
E3BG46_9VIBR          T--------------EDEDSAVAARFVLEK------VSSLRNLGIKISLVDWREGA----
Q6LN86_PHOPR          H--------------EDENTEIGNRYLIEK------SSESNRYSFKVSLIDWREDG----
D0YWF8_PHODD          D--------------EEKDAKISSRFDIVR------SPAEN--SFRVKLAAMQQDG----
BAMC_PASMU            R--------------ADEIGDTQVRYEIEQ------VSSGNYSALFVSILQMKRNE----
E1W3R7_HAEP3          R--------------ADDKANTEIRYKIEQ------VMAQDASALAVSVEQMRRDG----
BAMC_ACTSZ            A--------------KTDQGETLLRYQINQ------VGNQEANALVVSVLEAKRDD----
Q65VY6_MANSM          R--------------VDEVGDVKLRYLIEQ------LGNKEANALSVTVLEAKRNE----
BAMC_ACCPU            AKIQQDFIRNILGKVIDSVYSTAERDKFRTR----LEPGSTPGTTDIFISHRGMYEIFVT
BAMC_THIDA            AKIPQDVIRRTLGKVLDGLYSTAERDKFRTR----IEAGS--GGTEIYLSHRGMMEVYAT
A0KGP4_AERHH          KALDGWSE-------EDDDFVIRQRYQFTLR----NDPQRHAVNMSVRVLDHEETV-DGE
BAMC_OCESG            G---------------DAIGAPSQQFRWQL------MPDAVRRAVAVQVQSTEGGG----
BAMC_PSYIN            QAYGSFL--------FRTKVVRESSYRFTLN----QPQGGQNAALTVEVLSYSEKNDNVD
BAMC_KANKD            D--------------EDIFSQYIGSYNLDGQRHKVTLEIIGQNANEVAVQARNTQSQRLV
                                                                                  

BAMC_SHEON            QKVMLSGEDKQRYTIDMLNSAIAYMSVKREQT--IQANRLKQTLGINVDLITPEEG----
BAMC_SHESH            QNILLSGEDKRRYTIDMLNNAVAYMSVKRSQA--IKAKRLRESLGIDVNVVKGAPATVEG
BAMC_FERBD            DSIVLTDADRRRYAIDMLNNAIAYMNFERQQR--QATQELLNGRGIKTELGFDSDE----
F5Z8A1_ALTNA          VVAEISSMQERREEVDVLNQVIGHYEYQIQLQ--ETRRIARIRQGLNTEMGFNDDG----
BAMC_PSEA6            VVAEKSDVDSRAKEVDILNKVIGHYEYQIRVA--DAKRLREIRRGMQITIGQDGED----
G4QGT6_GLANF          ALDQVDLISKRTAESNFLNNVITEYDFGIRLA--NTQRIAKIRQGFNTDMGFDADG----
BAMC_PSEU9            GDKPLTDLLKQQLEVRALNQVVSEFDYRYRQL--EVDMRKRQG-IISLELGFDNKG----
A0A0N1MRY5_9GAMM      ASEKLTPLLQQQLEVRALNQVIAEFDYRYRQL--QVEMRKQQG-IISLEMGFDNKG----
BAMC_YERPE            GKTITQYSEIQRYNSAMLNAIIEGLDKVRADS--ESSQASRKVGTLDVQSGSDDTG----
BAMC_RAHSY            DKPVTSSAEIQRYNSQMMNAITANLDKVQQDT--QARLDNRRVGEIDVQSGADDTG----
Q8ZN72_SALTY          GKPVADAASLQRYSTEMMNVISAGLDKTATDA--ANAAQNRSAATMDVQSAADDTG----
D2TTB2_CITRI          GKPVADAASLQRYSAEMMNVISAGLDKNATDA--ANAAQNRSAMTMDVQSAADETG----
BAMC_ECOLI            GKPVADAASMQRYSTEMMNVISAGLDKSATDA--ANAAQNRASTTMDVQSAADDTG----
E3G9E9_ENTLS          GKPVADAASMQRYSAEMLNVISAGLDKNATNA--QNAAQSRAGATFDVQSAADDTG----
A7ML06_CROS8          GKPVADTASLQRYSAEMLNAIASGLDKNETAR--QNAADNRSASQIDVTSGSDDVG----
D8MVL1_ERWBE          GKGVNSPVQLQRYTAQMLNELSSGLDKNETSR--ENAAAKRSSAQIDVQSGADDTG----
Q2NS75_SODGM          GKPVTNPALVQRYTVEMLNSVASGLQQLNDDR--ANRVAQGETADLSVQSGADESG----
E0SE29_DICD3          TSPVTERSEIQRYTALMLNTLSDELDKRLNDN--DSAQANRNSQQLNVQSGADDSG----
BAMC_XENNA            EQDITDPAAIQRYNVLMLNELAGGLSQQQEEA--GQN-NAKDSGALTVQSGSDNTG----
BAMC_PHOAA            GQQVTDPVEIQRYNALMLNELIEGVNRQRERM--SDNPAAHNLGPLDVQSGGDTSG----
J7TFW8_MORMO          ENPVTDKTEITRYNNLTLNELVDGLDRMRNAA--RQETNASQYAAPDVQSGSDKTG----
A0A2A2GVJ0_9GAMM      EENITDQAEIQRYNVLMLNELIDSINKLRSTA--TSSGGQGRYAIIDVQTGSDSSG----
C4K790_HAMD5          EKKTTDPNYIQRYNNTVLNTIIEGLYQTQVDA--ENTRVIHKAGSLDVQSSSNENG----
R8AU16_PLESH          GQSVTESTEIQRYNAMLLNNLMSTMDAQSRAQ--EAARLAQQGAVLNVQAGQDNTG----
Q7MIL3_VIBVY          ELKPVTVTNKERYNVFMTNLVTSQYDQVKRDE--AQRRAQELVKQIPITMGTDRSG----
BAMC_VIBTL            EEKPVSATNKERYNAFLTNLVMARYDADLRAE--AALKAQELVKRIPISMGSDRSG----
BAMC_VIBCH            QVQTVSTTNKERYNAFMTNLVTTRYDSDVRAE--AARRAQELVKQIPITMGSDRSG----
Q87MI3_VIBPA          QVKEVTATNRERYNVFMTNLVTARYDQEVREE--AQRKAQELVKQIPVTMGKDRSG----
E3BG46_9VIBR          QSLSVTASNKERYTTLLTNIIESRYDDERRQE--MARKAEQLVKHIPISLGVDRSG----
Q6LN86_PHOPR          VEKPVSVVNKERYSIAMLNLVTAKYDQQVRDE--ARLRAQELVKQIPISMGKDRSG----
D0YWF8_PHODD          KDVAITPAIQARSSITVANIVSVAYDQQLRDE--AAARAQEMLKHVPITMSTDNAG----
BAMC_PASMU            VVFSPHLADKQRYSSDRLNQLVGELDASYRKQ--VRDLNNSGLMPIQSVLGTDSNG----
E1W3R7_HAEP3          VIYTPNQADKQRYASDRLNRFVAALTNAYNKQ--QQDLNNASAGPFQSGLITDTNG----
BAMC_ACTSZ            ILFTPSQKEKERYTSSLLNQFIGELNADYRSQ-AQAVATPTTTGPVQTAIITDGNN----
Q65VY6_MANSM          IIFTPSVTDKQRYTSDRLNNFVGNLNHAYRTQMAQTAPVATSNGAIQAEIVTDGNN----
BAMC_ACCPU            EGKDQTKWQPRPADPELEAEMLRRLMVRLGSEEKRATAAMQAAQEKPLERAKMTRGP---
BAMC_THIDA            EGKDKTVWQPRPADPELEAEMLRRLMLRFGVEENRAQTLLTAKQTP--DQARVIRDA---
A0KGP4_AERHH          TSKELTPADAQRYATRALNQFSLYYDKQLKSR-----EQHKANDGMGLELGLDNNE----
BAMC_OCESG            ----VLAQDRLRAEASMLNAFSLSYQRELSRQ---QELLDQGPIALTLDAGQ--------
BAMC_PSYIN            LKVNLTARSKKSIELRLVNDLLKYAYQLKESS----ELQVANSQPLPIKLGYDDNN----
BAMC_KANKD            DDKWVTMNTSKTVASQFLNAFLGFYDTERTKE---ARERILEEGTINVSLGTNSQG----
                                                                                  

BAMC_SHEON            ----AAYWSAKAAYKQVWDRLRIVLPEMGFEISDMDSAKGLYFIKFTD-NSGFWSSLWNN
BAMC_SHESH            EAAEQSYWLADAPFERTWDRLRIVLPEMGFEIVDMDSNKGLYYINVND-DSGFWSSLWSE
BAMC_FERBD            ----NTAFVAEASFDQVWRRMDKVLPLLGFQVRDLDQQLATYFVDYEP-DGGFWASLWGD
F5Z8A1_ALTNA          ----NPAFMVDAQYDVVWPRMLLVLRKLGFDVKDLDKSNGLLFVTYNGSETGWWGGLFSS
BAMC_PSEA6            ----APAFIIDSNYDTAWPRVLLVLRKLGFDVKDYDKSNGLLFVKYNGTESGWWDSVWSN
G4QGT6_GLANF          ----NPAFVVDAVYENTWPRLLLVLRKMGFDVKDLDQSTGLLFVQYNGIESSWWSGLFGS
BAMC_PSEU9            ----NAALVTEQAYDTVFDRFSGFLERLSFTIVEINQETGLITADYAKVESSVWDSIWGD
A0A0N1MRY5_9GAMM      ----NAALVTEQDYSVIFERFSGFLERLSFTIVEINQEKGLITADYKKPESSVWDSIWGD
BAMC_YERPE            ----LPLLIVRAPYAVVWERLPAALEKVGMKVTDRSRPQGTVSVTSKSLS-SSSWDALGA
BAMC_RAHSY            ----LPVLIVRESYGVVWDRLPNALTKVGMKVTDSSRPQGTLSVTYKPLN-DDAWQTLGA
Q8ZN72_SALTY          ----LPMLVVRGPFNLVWQRLPAALEKVGMKVTDSTRSQGSMAVTYKPLS-DSDWRDLGA
D2TTB2_CITRI          ----LPMLVVRGPFNVVWQRLPAALEKAGMKVTDSTRSQGSMAVTYKPLS-DSEWRELGA
BAMC_ECOLI            ----LPMLVVRGPFNVVWQRLPAALEKVGMKVTDSTRSQGNMAVTYKPLS-DSDWQELGA
E3G9E9_ENTLS          ----LPMLVVRAPFNQVWQRLPATLEKVGMKVTDSTRSQGSVAITYKPLS-DSGWQALGT
A7ML06_CROS8          ----LPVLVVRAPFNAVWNRLPDTLAKVGMKVTDSTRSTGSVAVTYKALS-DSDWQALGA
D8MVL1_ERWBE          ----LPDLIVRAPFNTVWERLPAALQRAGWKVTDTNRSQGSLNVTYKTLG-SDEWDALGA
Q2NS75_SODGM          ----LPLLVVRSSYNTVWTHLPSALSRIGMKVKDSSRPLGTVSVTYDAPG-SGTWDDLGA
E0SE29_DICD3          ----LPLLVVRGSYNQVWDRLPKALEKVGMTVNDRSRPQGSVSVSYKAPG-SGTWNELGA
BAMC_XENNA            ----LAQIIVRAPYNVVWNRLPYALESIGMQVTDRTRSTGSIAVTYKGRS-SSDWKALGV
BAMC_PHOAA            ----LPQMIVRAPYNIVWDRLPAALEKVGMKVGNRSRSTGSITVAYKSLS-TSEWKSMGV
J7TFW8_MORMO          ----LPQIIVRAPFDVVWSRLPVVLESVGMKVGDRTRSTGNIEVTYKGLS-SAEWSSLGM
A0A2A2GVJ0_9GAMM      ----LPQIIVRAPYDVVWDRLPSVLESIGMQVGDRSRSTGSITLTFNGMS-DSDWQAIGV
C4K790_HAMD5          ----LPNIVIRASYATVWERLPLAIKKIGMVITESRRSEGTFSVIYKPVS-DEQWEKMGI
R8AU16_PLESH          ----LPVYIVRAGYDVVWARLPATLSKLGFTVEERNRPQGQMTLSYKNIG-DSGWSALSA
Q7MIL3_VIBVY          ----FPVIIARTPYNVLWQRLPTILPQMGFTIDERNQSQGTIKAKYASPD-DEFWNEIGV
BAMC_VIBTL            ----FPVIIARTPYNVLWQRLPTLLPTMGFELEERNQSQGTVKAKYAAPD-DEFWEEIGL
BAMC_VIBCH            ----FPVIIARTPYDVLWQRLPELLPKMGFTIEERNQSQGTVKAKYAAPD-DEFWQQVGV
Q87MI3_VIBPA          ----LPVIIARAQYNVLWQRLPNILPKMGFTIEERSQSQGTVTAKYASPD-DEFWNEIGV
E3BG46_9VIBR          ----LPVIIARISYDLLWDKLPTLLPAMGFEIEERNQSQGTVKAKYAAPD-DEFWTRIGV
Q6LN86_PHOPR          ----LPIIIARAAYNVFWERLPSLVEDLGFTVEGRNRSQGVVEVKFRSPD-DAFWTELGT
D0YWF8_PHODD          ----LPVIIARAPYNLFWDRLPTVLEQLGFSVEDKNESQGTMTVKYSAPD-DDYWEKLGV
BAMC_PASMU            ----RTALVLGAPFNHAWTKLGQVLPQLEFDIKDEIIGRGVRELKYRPAGAKSWWWPFGR
E1W3R7_HAEP3          ----RMALGMDASFGQAWQRLGSALPKLGFKATSESAGRGYRELKYKPLD-KQEWLRLGV
BAMC_ACTSZ            ----HLALAMSSEFQQSWSKLGDALPQLGFETEEETVGRGYRKLNYKPLG-ATEWARLGV
Q65VY6_MANSM          ----RTALGLTSSFAQSWEKLGQVLPELGFEIDEETAGRGYRVLKYKPVD-DSQWARLGV
BAMC_ACCPU            --DGSGTLEVEESFDRAWRRVGLALDRVGFTVEDRDRSRGLYFVRYVDPEIDNE-KKEEG
BAMC_THIDA            --GGS-LLEMDEGFDRAWRRVGLALDRVGFAVEDRDRSKGTYFVRYIDPDADNASKRDEG
A0KGP4_AERHH          ----LSAWIVDGSFDQVWRRLNQVLPAYGFTIKDTQQSLGWIDVEYDEPG-SEFWKAKGS
BAMC_OCESG            -----GLLLAEQDYDRTWKRLITLLPRLGFDISNRQQALGYVDVEFDGLS-KGDWQDLRL
BAMC_PSYIN            ----QMVWIVDADFIVSWTKLPDLLALLRFEQVDADKNLGYYLVKFKAPN-AKYWPENNL
BAMC_KANKD            ----QIALIAERDLIAIWEHLPSVLEDLNLSVSDRDQSAGIYYFNVKEPETGFWAWLWGN
                                       : :.   :              .                    

BAMC_SHEON            N--QLSLKE-------GSYRLLLEDGDTPDETKIWLRDAEDQPLSNDVVSKVYESLSSLM
BAMC_SHESH            K--KLPVEE-------GSYRMLLKEGDSEDKTRIYLHNSEDKPLDNVVVEAVYEGFSELM
BAMC_FERBD            ND-ELPLEE-------GPYQIRLEP--MGERTAITLMDNEANPLPTETVTQMYNRFAELL
F5Z8A1_ALTNA          DN--ELLEK-------GDYRLKVSR-AGEKRSSVTFMNNESEPFEANQVSDLYGAFAEVM
BAMC_PSEA6            DENALPLEK-------QEYRFRVED-AGE-HTSLTVLDNESTPFTKDKLSGLYDVFARVM
G4QGT6_GLANF          EDK-LDIEK-------NEYRLQLGG-VGE-KTTVTFMDNESKPFDAKRITKIFAPFKDFM
BAMC_PSEU9            EPTELPIDE-------GQYQILVSK-TKQGGTSLTWMDDKGETLEPGTMNGLQQALEAAL
A0A0N1MRY5_9GAMM      ELAELPIDE-------GQYQILVSR-TKEGGTSLTWMDDKGATLEPGTMNDLQQALENAL
BAMC_YERPE            K--DPELPE-------GDYKLQVGD--LDNRSSLQFIGPKGHTLTQAQNDALVAVFQAAF
BAMC_RAHSY            K--DPGLTS-------GDYKLQVGD--LDNRSSLQFLDPKGHALSQSQNDAMVAVMQAAF
Q8ZN72_SALTY          S--DPGLAS-------GDYKLQVGD--LDNRSSLQFIDPKGHTLTQSQNDALVAVFQAAF
D2TTB2_CITRI          S--DPGLAS-------GDYKLQVGD--LDNRSSMQFIDPKGHTLTQSQNDALVAVFQAAF
BAMC_ECOLI            S--DPGLAS-------GDYKLQVGD--LDNRSSLQFIDPKGHTLTQSQNDALVAVFQAAF
E3G9E9_ENTLS          R--DPGLTS-------GDYKLQVGD--LDNRSSMQFIDPKGHTLTQSQNDALVSVFQAAF
A7ML06_CROS8          R--DPGLSN-------GDYKLQVGD--LDNRTSLQFIDPKGHTLTQSQNDALVAAFQAAF
D8MVL1_ERWBE          K--DPGLTN-------GDYKLQVGD--LDNRSSLQFLDPKGHTLTQSQNDALVAVFNAAF
Q2NS75_SODGM          K--DPDLRN-------GDYKLQVGD--LGNRSTLQFTDPKGHTLTQSQNDSLVAVFQAAF
E0SE29_DICD3          H--DPELSN-------GDYKLQVGD--LGNRSTLQFIDSKGHTLSQSQNDALVAVFQAAF
BAMC_XENNA            E--EPSVRE-------GNYKLQVGD--LDNRSSLQFISEKGKPLTQSENDQMVAVLEAAF
BAMC_PHOAA            N--EPSISE-------GDYKLQIGD--LNNRSSLQFISDKGKPLTQVQNDELVAVLKAAF
J7TFW8_MORMO          D--DPSVAE-------GDYTLQVGD--LDNRSSLQFISAKGKPLTQKENDEMVKALEAAF
A0A2A2GVJ0_9GAMM      D--HPTMTK-------GDYKLQVGD--MNNHSSLQFMAVKGTTLTQKQNDEMVAALKAAF
C4K790_HAMD5          K--KPDLKP-------GEYKLQLGD--LKNRSSLQFMNSNGQTLIQSENDDLVPVLKAVF
R8AU16_PLESH          K--DPQLSR-------SEYKLQVGD--LGNRTSLALTDADGKPLSDSSFEALLPAVQAVF
Q7MIL3_VIBVY          K--PMEMKS-------GTYTFLFGD--LGNRTSINVTDSSGKPVEEAFLKSMAPVLAAVV
BAMC_VIBTL            Q--PIDLAP-------GTYTFLFGD--LGNRTSINVTDASGKPVEEELLKSMVPVLAHVA
BAMC_VIBCH            K--PIELKS-------GTYTFLFGD--LGNRTSINVTDSAGKPVNEALLKEMVPVLSAVV
Q87MI3_VIBPA          K--PIDLKA-------GKYTFLLGD--LGNRTSINITDPSGKPVEEEFLKSLVPVLGAVV
E3BG46_9VIBR          K--PINLKS-------GSYTFLFGD--LGNRTSINVTDSKGKPIEEKLLKDMVPVLAAIA
Q6LN86_PHOPR          K--PIMLDD-------STYKLQLGD--LGNRTSINVTDSNGKPITEEALNTIAPVFALAI
D0YWF8_PHODD          Q--PINLDN-------DTYKIQVGD--LGNRTSISVNDDDGKPVTAQALQSLAPVLAAQL
BAMC_PASMU            AEGSSGLKT-------GTYFMQLSA--LGKQSAVVMTDDDGNALSGEQAQALYQALQNLL
E1W3R7_HAEP3          N--PPNLEK-------GVYQMQISA--VGKQSAVVITDEDGKTLPNEAAQSLYSALGVLL
BAMC_ACTSZ            N--RPELED-------GEYSMQISA--HGKQSSVVISDEDGNAISGDAAQAMYRALANLI
Q65VY6_MANSM          N--KPELEK-------GEYSMQLSA--YGNQSAVVLMDEDKAALEGDKAQAVYKALQVLM
BAMC_ACCPU            FLSKLNIFKSSSSGKPQTQYRIFVKDDA-SRSTVQVLTLEGGVDQSETSKRILSLLYDQL
BAMC_THIDA            MFAKLAFWRSKKD-QASPQLQIVVDEAGEGKSRVRVAGGEGRAADAATQNRIINLLHKEL
A0KGP4_AERHH          E--PFKLDE-------DKYRFQLGE-MAGGKTSITLFDKDKKPVSSGVISQMYISLSEAF
BAMC_OCESG            P--ALDIPE-------QEYRIQLGD--LGSRTSLSLSNKDREPVAADVLSKLVNTLAPAF
BAMC_PSYIN            N--SFELDN-------AEYFIQLGE-LNSGSTSITWLDADKKPLADEKVTEIYFSITSKI
BAMC_KANKD            DETNAKVDME-----PGDYQIHLAA--TTYGVSMTFKDEEGNLLDSNLVTKIYPEFAASF
                            .               .          :                 :   .    

BAMC_SHEON            K-EERKLR------
BAMC_SHESH            Q-EDRKIR------
BAMC_FERBD            QKESRDLQ------
F5Z8A1_ALTNA          SEDNLDI-------
BAMC_PSEA6            ADDNLDI-------
G4QGT6_GLANF          GNEDLDI-------
BAMC_PSEU9            IKRGIKI-------
A0A0N1MRY5_9GAMM      RQRGIKI-------
BAMC_YERPE            SQTSATAIK-----
BAMC_RAHSY            SQSNAK--------
Q8ZN72_SALTY          NK------------
D2TTB2_CITRI          SK------------
BAMC_ECOLI            SK------------
E3G9E9_ENTLS          SK------------
A7ML06_CROS8          SK------------
D8MVL1_ERWBE          SK------------
Q2NS75_SODGM          SRSTSH--------
E0SE29_DICD3          SKS-----------
BAMC_XENNA            SKSTDK--------
BAMC_PHOAA            SQTAGL--------
J7TFW8_MORMO          SKSSVK--------
A0A2A2GVJ0_9GAMM      SKVSSN--------
C4K790_HAMD5          SETETEK-------
R8AU16_PLESH          DSQAVNQ-------
Q7MIL3_VIBVY          KKE-----------
BAMC_VIBTL            DQTKDKKEAKSE--
BAMC_VIBCH            DKK-----------
Q87MI3_VIBPA          KE------------
E3BG46_9VIBR          DDKNK---------
Q6LN86_PHOPR          ERANNQ--------
D0YWF8_PHODD          AHSN----------
BAMC_PASMU            AK------------
E1W3R7_HAEP3          AQ------------
BAMC_ACTSZ            SK------------
Q65VY6_MANSM          TK------------
BAMC_ACCPU            K-------------
BAMC_THIDA            K-------------
A0KGP4_AERHH          AKGLADQAAKTE--
BAMC_OCESG            ERTDLVR-------
BAMC_PSYIN            RDVLLLNENQSKAL
BAMC_KANKD            KSRGK---------