CLUSTAL format seed alignment for MF_00926

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DKSA_BUCAI            -----------MEKEKNKKTSSLNVLSIAGLQPYQKKIDEEYMNKDQILHFYKILETWKT
DKSA_BUCAP            -----------MEKEQNKKTSSLNVLAIAGLQPYQKKTDEEYMNEKQMLHFKKILETWKN
DKSA_BUCBP            -----------MQKEKNKKQSSLSILFMAGVQPYKNKKNEKYMNTKQIDHFKKILIAWKN
E8Q5R0_BLOVB          ----------MLKKSSKKKCSSLNVLIIAGVKPYIRKLDEEYMSVNQLLHFKSILKAWKN
DKSA_SALTI            -----------MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLSHFKRILEAWRN
DKSA_SALTY            -----------MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLSHFKRILEAWRN
DKSA_ECO57            -----------MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLAHFRRILEAWRN
DKSA_ECOL6            -----------MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLAHFRRILEAWRN
DKSA_ECOLI            -----------MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLAHFRRILEAWRN
DKSA_SHIFL            -----------MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLAHFRRILEAWRN
Q32JW2_SHIDS          -----------MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLAHFRRILEAWRN
A0A0T9MJ46_YERPU      -----------MQEGQKRKTSSLSILAIAGVEPYQEKPGEEYMNAAQLSHFKLILEAWRN
Q5E2T6_ALIF1          -----------MPESN--TKRTLGILAIAGVEPYQEKAGEEYMGPAQVEHFTKILEAWRN
Q9KUC6_VIBCH          -----------MTES---KKKTLGILAIAGVEPYQEKPGEEYMSPGQITHFTKILEAWRN
Q8EIG5_SHEON          -----------MPEG----TKKLGVLAIAGVSPYQEKPGEEYMNAKQLGHFKTILEAWRN
DKSA_HAEIN            -----------------MSRASLSLLDLAGVKPYQMKKDEEYMNEEQILHFRKILNAWHE
G3XD14_PSEAE          --------------MSTKAKQQSSQQMTRGFEPYQETKGEEYMSERMRAHFTAILNKWKQ
Q83AD5_COXBU          -----------MAVSKAMKTKTTDL----GFSPYKLTRGEEYMNEKQQEHFRKILSEWKK
Q31G85_HYDCU          --------------------MESSSDFIEDYPQYEMKPGEEYMSPEMLEHFKNKLLAWKK
A1K7B4_AZOSB          ------------------------------------------MSNRQTAHFRRVLDSLKQ
B5YK78_THEYD          --------------------------------------MKEKSRQKRILEIKKKLLQQKQ
O67865_AQUAE          --------------------------------------MKHLT-QEQVNELRAILLEMRR
Q74GG2_GEOSL          --------------------------------------ME----SEKLEYFRTILNEEMR
B5EG80_GEOBB          --------------------------------------MN----TEKLEYFRGILQEEKR
Q72A47_DESVH          --------------------------------------ME----QKDIEYFRQLLASMLD
B4UCC9_ANASK          --------------------------------------MN----VRETERFRRILAAQLE
DKSA_CAUVN            ---------------------MQTATVLVEKSDYRPSEDEPFMNDRQLEYFKQKLLAWKE
DKSA_CAUVC            ---------------------MQTATVLVEKSDYRPSEDEPFMNDRQLEYFKQKLLAWKE
Q2RQF1_RHORT          -------------------------MAVTFPPDYRPSDDEPFMNERHREYFRQKLIQWKI
Q3J325_CERS4          -----MTVNHISEPAGLQQRAAAMKAEIFLPEDYRPAENEPFMNERQLEYFRRKLLNWKQ
Q89I05_BRADU          ------------------------------------------MNDRQKEYFRLKLLAWKD
Q7CZF2_AGRFC          ------------------------MSEKIDLSKYVLSEDDEFMNASQRAYFRAKLIAWKN
Q9ZCE1_RICPR          -----------------------MLETPKLPIGYKPSKDEEYMCPNHLEYFRQKLLRWKE
A5CFM5_ORITB          ------------------------MSKIILPKGYKPSEEEEYMSPNQLEYFKQKLEKWKE
F2I0U1_PELSM          -------------------------MPTKLPKNYKPTSKEKYMCAKHKAYFKQMLFNWKK
Q8P8I6_XANCP          MTSKPSGSTPKAKYKVVDYKTDETTGRPILPQGYKPSADEEYMSKLQQEYFRQRLQRWRN
Q7VUK1_BORPE          -----MATKAATKKSSKSTSDTAIDLPSEQELLAM--PEADYMNDRQLAFFKERLKQLEQ
Q63YI2_BURPS          ----------MTKK-----------LLTEAEILKM--SDKDYMNEDQLAFFKNRLEQLQA
Q9K1N0_NEIMB          ----------MAKL-------------TEQDILNWSGPEDDYMNDDHLAFFRELLVKMQD
Q5F5L9_NEIG1          ----------MVKL-------------TEQDILNWIGPEDDYMNDDHLAFFRELLVKMQD
C7RSV0_ACCPU          --------MNVNKPAGGVG--------EESEATMLSASPEEYMSPGQLAFFRRRLLADEQ
Q9HT38_PSEAE          -------------M-------------TEQELLAQ--PDAAYMDEAQQDFFRDLLLRQRQ
A4Y118_PSEMY          --------MTLTVP-------------TEAELLAQ--PADDYMNDAQQRFFRELLLAQRA
                                                                        :   *     

DKSA_BUCAI            QLQDEINHTLLYIQDN----ATNFPDPIDRATQEEEFSLDLRNRDRSRKLIKKIEITLKK
DKSA_BUCAP            QLTIEINHTLLYIQDK----STNFPDPIDRAAQEEEFSLELRNRDRSRKLIKKIQETLKK
DKSA_BUCBP            QLRNDISQTRLNIQDK----ATNYPDPIDRAVQEEEFSFELRHRDRERKLIEKIEKTLKK
E8Q5R0_BLOVB          QLTTDIQCSILRMKDEV---SINFPDPVDRAVQEEEFNIELRNRDRERKLIEKIEKTLKK
DKSA_SALTI            QLRDEVDRTVTHMQDE----AANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLKK
DKSA_SALTY            QLRDEVDRTVTHMQDE----AANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLKK
DKSA_ECO57            QLRDEVDRTVTHMQDE----AANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLKK
DKSA_ECOL6            QLRDEVDRTVTHMQDE----AANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLKK
DKSA_ECOLI            QLRDEVDRTVTHMQDE----AANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLKK
DKSA_SHIFL            QLRDEVDRTVTHMQDE----AANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLKK
Q32JW2_SHIDS          QLRDEVDRTVTHMQDE----AANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLKK
A0A0T9MJ46_YERPU      QLRDEVDRTVSHMQDE----AANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLKK
Q5E2T6_ALIF1          QLREEVARTVNHMKDE----AANFPDPVDRAAQEEEFSLELRNRDRERRLIKKIEKTLTK
Q9KUC6_VIBCH          QLREEVDRTVHHMQDE----AANFPDPVDRASQEEEFSLELRNRDRERRLIKKIEKTLDK
Q8EIG5_SHEON          QLREEVDRTLSHMQDE----AANFPDPVDRAAQEEEFSLELRARDRERKLIKKIEKTLQK
DKSA_HAEIN            QIVEEASRTVAHMQDE----VTNFPDPADRATQEEEFSLELRNRDRERKLMKKIEATLKK
G3XD14_PSEAE          ELMEEVDRTVHHMQDE----AANFPDPADRASQEEEFSLELRARDRERKLIKKIDETLQL
Q83AD5_COXBU          QLMEEVDSTVVHLKEE----ASVYADPLDRASQEEGFNLELRTRDRERKLIKKIEQAADA
Q31G85_HYDCU          QLIWEATNTVQHLRTD----SSTPADPSDRASQEEEFALELRTRDRERKLISKIDKSLRD
A1K7B4_AZOSB          SLIDDIQRAADELQDG----PEALADPADRASAETELAVELRNRDREHKLIGKIDEALAR
B5YK78_THEYD          QILIDAGIMLSNLPSES---NL--SEIGDIASQEIDRSFLLRLRDRERKLLKKIEKTLEK
O67865_AQUAE          KILESAESQLKD-PSNV---KFEGGDEIDRADLETERFITFRIKDREAKLLHKIDYALMK
Q74GG2_GEOSL          TLLDEAGKTVSEMTSDS----TPFPDPNDRATQESDRNFELRIRDRERKLINKIREALER
B5EG80_GEOBB          SLLEEAGRTVSEMTSDT----TNFPDPTDRATQESDRTFELRIRDRERKLIVKIQEALAR
Q72A47_DESVH          EAQQKGDSTLEDLTDNN----EIFADPADRATAESDRAFTLRIRDRERRLIKKIRAAIQR
B4UCC9_ANASK          TLVGQGERAVHEMADAEGGGEVAIPDPNDRATAEERRNWALRLRDRDRRLLGKVQAALAR
DKSA_CAUVN            EILRESRETVSHLQKE----TENHADLADRASSETDRALELRTRDRQRKLISKIDQALRR
DKSA_CAUVC            EILRESRETVSHLQKE----TENHADLADRASSETDRALELRTRDRQRKLISKIDQALRR
Q2RQF1_RHORT          ELLREAEETLESLQEG----GMQEADLADRASAEMDRALELRTRDRARKLIAKIDAALMR
Q3J325_CERS4          ELLDQSAETIEGLQES----GRNVPDIADRASEETDRALELRTRDRQRKLVAKIDAALRR
Q89I05_BRADU          EILKESKLTLQALQEE----NVNHPDLADRASSETDRAIELRARDRQRKLIAKIDAALQR
Q7CZF2_AGRFC          DILREARETLGHLAEE----SANHPDLADRASSETDRAIELRARDRQRKLISKIDAALQR
Q9ZCE1_RICPR          DLLKESQETLNHLKEE----NLKESDLNDCATHETERAFELRSRNRYCKLMSKIEEALSR
A5CFM5_ORITB          ELIQESLETIDHLKDG----PLKEPDLNYQASREADTALELKTRSRYKKLIDKIETALKK
F2I0U1_PELSM          ELIEQNNRIMFNDMDD----NSASADIVDQATSVSGKTVEMRTVNRNKKLITKIDSAVNK
Q8P8I6_XANCP          EMVEESKQTIENLREE----VRDIGDEAERATRETENSLELRARDRARKLISKIDSTLKR
Q7VUK1_BORPE          DILANAGETTEHLRE-----TQFVPDPADRATIEEEHALELRTRDRERKLLKKVQQAIAR
Q63YI2_BURPS          EILRNAGQTTENLRE-----TVIVPDPADRATIEEEHALELRTRDRERKLLKKVQQSLAR
Q9K1N0_NEIMB          ELIENASATTGHLQE-----HESAPDPADRATQEEEYALELRTRDRERKLLSKIQATIRN
Q5F5L9_NEIG1          ELIENASVTTGHLQE-----HESAPDPADRATQEEEYALELRTRDRERKLLSKIQATIRN
C7RSV0_ACCPU          ALLSAVKETASHLQQ-----SETSSDWNDRASAEEEHTLELRVRDRERKLLQKIRESLKR
Q9HT38_PSEAE          ELQARIEGEFGELRD-----LERPSDEADLASREEQRQWQLRLLEREKKLLDKIDEALER
A4Y118_PSEMY          ELQARIDDEFTELRQ-----PEISSDVADIGAAEEQRQWQLRLLEREKKLLDKIDQALER
                                               :    .         ::  .*  :*: *:  :   

DKSA_BUCAI            IKEKDFGYCNSCSVEIGIRRLEARPTADLCIDCKTLAEIREKQMTG-----
DKSA_BUCAP            IKDKDFGYCNSCAVEIGIRRLEARPTANLCIDCKTLAEIREKQMAG-----
DKSA_BUCBP            VENKDFGYCESCGIEIGIKRLEARPTANLCIDCKTLSEIREKQILG-----
E8Q5R0_BLOVB          IEIKEFGFCILCDIEIGIRRLEANPIADLCIDCKTLEELKEKQMIG-----
DKSA_SALTI            VEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG-----
DKSA_SALTY            VEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG-----
DKSA_ECO57            VEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG-----
DKSA_ECOL6            VEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG-----
DKSA_ECOLI            VEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG-----
DKSA_SHIFL            VEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG-----
Q32JW2_SHIDS          VEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG-----
A0A0T9MJ46_YERPU      VEDDDFGFCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG-----
Q5E2T6_ALIF1          IEEEEFGFCDSCGIEIGIRRLEARPTADLCIDCKTLAEIKEKQMAG-----
Q9KUC6_VIBCH          IKEEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIKEKQMLG-----
Q8EIG5_SHEON          IEEDDFGFCDSCGIEIGIRRLEARPTADQCIDCKTLAEIKEKQMAG-----
DKSA_HAEIN            LDTDDFGYCDCCGEEIGIRRLEARPTADLCIDCKTLAEIREKQVAG-----
G3XD14_PSEAE          IEDEEYGWCDSCGVEIGIRRLEARPTATLCIDCKTLAEIREKQLGS-----
Q83AD5_COXBU          LDNGDYGFCEDCGAEIGIRRLEARPTATKCIDCKTFEEIREKQSGG-----
Q31G85_HYDCU          IEDGDYGYCKMSGEEIGLARMEARPTATLTVEMKTKQEMREKQGIA-----
A1K7B4_AZOSB          IDAGEYGYCDNCGVEIGLKRLEARPTATLCIDCKTLAEIRERQVAS-----
B5YK78_THEYD          INNGTYGICEACGAEIPIERLEARPVTDLCIECKTEQEEAEKLKES-----
O67865_AQUAE          MEMGTYGICENCGAQIPFERLKARPVTTMCIECKELEEEMEND--------
Q74GG2_GEOSL          IDDGTFGTCEVCGEEIGEGRLKARPVTTLCIDCKMEQERKEKHP-------
B5EG80_GEOBB          IEAGTFGICEVCEEDISEARLKARPVTTLCIDCKMEQEKKERFR-------
Q72A47_DESVH          IDDGSFGVCDECGEEIGVPRLKARPVTKLCINCKSKQEEDEHLRGD-----
B4UCC9_ANASK          LDAGTFGTCTSCGAPISAARLRARPVTDLCIACKTEAERVERPR-------
DKSA_CAUVN            VEDGSYGYCEETGEPIGLARLEARPTATMSVEAQERHERRERVHRDD----
DKSA_CAUVC            VEDGSYGYCEETGEPIGLARLEARPTATMSVEAQERHERRERVHRDD----
Q2RQF1_RHORT          IEDGSYGFCEETGEPIGLRRLEARPIATLSLEAQERHERMERTHRQD----
Q3J325_CERS4          IEAGEYGYCEVTGEPISLKRLDARPIATMTLEAQERHERRERVHRDE----
Q89I05_BRADU          IEDNTYGYCEDTGEPISLKRLEARPIATLSVEAQERHEKREKVYRDE----
Q7CZF2_AGRFC          IDDGTYGYCEETGEPIGLKRLDARPIATLSIEAQERHERREKVYRDE----
Q9ZCE1_RICPR          IKNGEYGYCEETGAPIGIKRLEARPIAALCIEAQERHENYERSHLDEPGN-
A5CFM5_ORITB          IELKQYGYCEESGEKIGLKRLEARPIATLCIESQERHEKYEKQHNDDYDAD
F2I0U1_PELSM          IEEGTYGYCEETGEEIGLKRLVARPIASLTVEAQEKHEKQEKIFADN----
Q8P8I6_XANCP          LEDGDYGYCVDTGEEIGLDRLEARLTAERTIDAQERWEHLQKQQGD-----
Q7VUK1_BORPE          IDSGEYGWCEETGEPIGVPRLLARPTATLSLEAQERREMRQKLYGD-----
Q63YI2_BURPS          IESGDYGWCEETGEPIGIPRLLARPTATLSLEAQERRELRQKLFGD-----
Q9K1N0_NEIMB          IDEGDYGFCADTGEPIGLKRLLARPTATLSVESQERRERMKKQFAD-----
Q5F5L9_NEIG1          IDEGDYGFCADTGEPIGLKRLLARPTATLSVEAQERRERMKKQFAD-----
C7RSV0_ACCPU          IDDGNYGWCEETGEPIGIARLLARPTAALCLEAQERREQSKRLFG------
Q9HT38_PSEAE          LARGDYGWCQETGEPIGLRRLLLRPTATLCIEAKERQEKRERHVRHN----
A4Y118_PSEMY          LARGEYGWCAETGEPIGLKRLLLRPTATLCIEAKERQEQREKHQRDRD---
                      :    :* *      *   *:  .  :   :  :   *  :.