CLUSTAL format seed alignment for MF_00931

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Q2JJ13_SYNJB      ---------MNVLPNTP-----QPLADEGGTTLDYGS--------------------AVY
Q2JX62_SYNJA      ------MAPANVLPNTP-----PSPTDGGGTALDYSS--------------------PRY
Q7NGM3_GLOVI      ------------MNRTA-----PSSA-----ALDYRS--------------------DTY
Q7U5G9_SYNPX      ---------MTTLNAPE-AAVVEGL----DALPDFTT--------------------EAY
Q3ALN2_SYNSC      ---------MTTLNAPE-APVLEGQ----DALPDFTT--------------------AAY
Q3AV61_SYNS9      ---------MPTLNAPE-VSVLEGQ----DALPDFTT--------------------AEY
A5GJG5_SYNPW      ---------MPTPVTSE-VAVLDGQAGSAQALPDFSS--------------------EAY
Q0I8M9_SYNS3      ---------MPTLDSTL-VAVLDDQQG-LAELPDFTT--------------------DAY
A5GUD0_SYNR3      -----------MASSLL-DPAVDGTPVLDVELPDFTT--------------------EAY
A2C7S0_PROM3      ---------MPTLEMPE-AAVLDSTVGSSEALPDFTS--------------------DAY
ALDEC_PROMM       ---------MPTLEMPV-AAVLDSTVGSSEALPDFTS--------------------DRY
A2BVJ4_PROM5      ---------MQTLESNKNIQIGSSPESDSANLPDFTT--------------------DAY
A8G3P7_PROM2      --MNKSLTDMQTLESKKDIQLEGSTDNDSANLPDFTT--------------------DAY
A3PBQ6_PROM0      MHNELKITDMQTLESNK-KTIEESTNSISLDLPDFTT--------------------DSY
A2BQ13_PROMS      MHNELKITDMQTLESNK-KTIEESINPISLDLPDFTT--------------------DSY
Q31C02_PROM9      MHNELKITDMQTLETNT-KTTEESIDTNSLNLPDFTT--------------------DSY
Q7V2E8_PROMP      ---------MQTLESNK-KTNLEN----SIDLPDFTT--------------------DSY
A9BEF6_PROM4      ---------MPTLESSE-VAVISDLEGRDGSLPDFTT--------------------EQY
Q7VD51_PROMA      ---------MQTL-TNQ-VASADELD----NLPDFSS--------------------SQY
A2C0Z0_PROM1      ---------MQAFASNNLTVEKEELS--SDSLPDFTS--------------------ESY
Q46GP5_PROMT      ---------MQAFASNNLTVEKEELS--SNSLPDFTS--------------------ESY
B7JUH1_RIPO1      ---------MQELVQRS-------------E-LDFTN--------------------PTY
B1WR71_CROS5      ---------MQELALRS-------------E-LDFNS--------------------ETY
D3EPA5_ATETH      ---------MQELALRS-------------E-LDFNS--------------------ETY
ALDEC_SYNY3       ---------MPELAVRT-------------E-FDYSS--------------------EIY
B0JY93_MICAN      ---------MPELAVPL-------------E-LDFTS--------------------ETY
Q8YLL5_NOSS1      ---------MQQVAADL-------------E-IDFKS--------------------EKY
Q3MA38_TRIV2      ---------MQQVAADL-------------E-IDFKS--------------------EKY
D7E2W1_NOSA0      ---------MQQLVEEI-------------EKIDFQS--------------------EKY
ALDEC_NOSP7       ---------MQQLTDQS-------------KELDFKS--------------------ETY
Q112R8_TRIEI      ---------MPKLEIIP-------------T-MDSQSETKLEKVKSQSEGDQINFETETY
ALDEC_SYNE7       ---------MPQLEASL-------------E-LDFQS--------------------ESY
B0C9L0_ACAM1      ---------MPQTQAIS-------------E-IDFYS--------------------DTY
B8HSZ3_CYAP4      ---------MPQVQSPS-------------A-IDFYS--------------------ETY
Q8DJB4_THEEB      ---------MTTATATP-------------V-LDYHS--------------------DRY
B8HLW2_CYAP4      ---------MSDCATNP--------------ALDYYS--------------------ETY
A3Z6M0_9SYNE      -----------------------------MTQLDFAS--------------------AAY
                                                   *  .                      *

Q2JJ13_SYNJB      RQAYSRINGIVIEGEQEAHDNYLKLAEMLPEGAEELHKLAKMELRHMKGFQSCGKNLQVE
Q2JX62_SYNJA      RQAYSRINGIVIEGEQEAHDNYLKLAEMLPEAAEELRKLAKMELRHMKGFQACGKNLQVE
Q7NGM3_GLOVI      RDAYSRINAIVLEGEREAHANYLTLAEMLPDHAEALKKLAAMENRHFKGFQSCARNLEVT
Q7U5G9_SYNPX      KDAYSRINAIVIEGEQEAHDNYISLGSLIPDQKDELAKLARMEMKHMKGFTSCGRNLGVE
Q3ALN2_SYNSC      KDAYSRINAIVIEGEQEAHDNYISLGTLIPEQAEELKRLARMEMKHMKGFTSCGRNLGVE
Q3AV61_SYNS9      KDAYSRINAIVIEGEQEAHDNYISLGTLIPEQADELSRLARMEMKHMKGFTACARNLGVE
A5GJG5_SYNPW      KDAYSRINAIVIEGEQEAHDNYISLGTLIPEQADELARLARMEMKHMKGFMSCGRNLGVE
Q0I8M9_SYNS3      KDAYSRINAIVIEGEKEAHDNYLSLGTLIPEQAEELAKLAKMEMKHMKGFTACAKNLDVV
A5GUD0_SYNR3      KSAYSRINAIVIEGEQEAHDNYISLGTLIPDQADELAQLARMEMKHMKGFQACGKNLSVE
A2C7S0_PROM3      KDAYSRINAIVIEGEQEAHDNYIAIGTLLPDHVEELKRLAKMEMRHKKGFTACGKNLGVT
ALDEC_PROMM       KDAYSRINAIVIEGEQEAHDNYIAIGTLLPDHVEELKRLAKMEMRHKKGFTACGKNLGVE
A2BVJ4_PROM5      KDAYSRINAIVIEGEQEAYDNYISIATLLPNDSEELTKLAKMELKHKRGFTACGKNLGVE
A8G3P7_PROM2      KDAYSRINAIVIEGEQEAYDNYISIATLLPNDSEELTKLAKMELKHKRGFTACGKNLGVE
A3PBQ6_PROM0      KDAYSRINAIVIEGEQEAHDNYISIATLIPNELEELTKLARMEMKHKKGFTACGRNLDVV
A2BQ13_PROMS      KDAYSRINAIVIEGEQEAHDNYISIATLIPNEVEELTKLARMEMKHKKGFTACGRNLGVV
Q31C02_PROM9      KDAYSRINAIVIEGEQEAHDNYISIATLIPNELEELTKLARMELKHKKGFTACGRNLGVD
Q7V2E8_PROMP      KDAYSRINAIVIEGEQEAHDNYISLATLIPNELEELTKLAKMELKHKRGFTACGRNLGVQ
A9BEF6_PROM4      KDAYSRINAIVIEGEKEAHDNYVAIGTVIPEKADELKKLAIMELRHMKGFTACGKNLGVV
Q7VD51_PROMA      KDAYSRINAIVIEGEKEAHDNYMSIGTLIPDKADELKKLAVMELKHMRGFTACGKNLGVK
A2C0Z0_PROM1      KDAYSRINAVVIEGEQEAYSNFLDLAKLIPEHADELVRLGKMEKKHMNGFCACGRNLAVK
Q46GP5_PROMT      KDAYSRINAVVIEGEQEAYSNFLDLAKLIPEHADELVRLGKMEKKHMNGFCACGRNLAVK
B7JUH1_RIPO1      KDAYSRINAIVIEGEQEAHQNYIDMAQLLPEHQEELIRLSKMENRHKKGFEACGNNLSVT
B1WR71_CROS5      KDAYSRINAIVIEGEQEAYQNYLDMAQLLPEDEAELIRLSKMENRHKKGFQACGKNLNVT
D3EPA5_ATETH      KDAYSRINAIVIEGEQEAYQNYLDMVHMLPKNKDELVRLSKMENRHKTGFQACGKNLNVI
ALDEC_SYNY3       KDAYSRINAIVIEGEQEAYSNYLQMAELLPEDKEELTRLAKMENRHKKGFQACGNNLQVN
B0JY93_MICAN      KSAYSRINAIVIEGEYEANSNYIQLADILTDNKEELHRLAKMENRHMKGFQACGQNLKIT
Q8YLL5_NOSS1      KDAYSRINAIVIEGEQEAYENYIQLSQLLPDDKEDLIRLSKMESRHKKGFEACGRNLQVS
Q3MA38_TRIV2      KDAYSRINAIVIEGEQEAYENYIQLSQLLPDDKEDLIRLSKMESRHKKGFEACGRNLQVS
D7E2W1_NOSA0      KDAYSRINAIVIEGEQEAHENYITLAKLLPESKEELMRLSKMESRHKKGFEACGRNLQVT
ALDEC_NOSP7       KDAYSRINAIVIEGEQEAHENYITLAQLLPESHDELIRLSKMESRHKKGFEACGRNLAVT
Q112R8_TRIEI      KDAYSRINAIVIEGEQEAYKNYIKLAEMLPDEKDELIKLSKMENRHKKGFEACGRNLHVT
ALDEC_SYNE7       KDAYSRINAIVIEGEQEAFDNYNRLAEMLPDQRDELHKLAKMEQRHMKGFMACGKNLSVT
B0C9L0_ACAM1      KDAYSRIDGIVIEGEQEAHENYIRLGEMLPEHQDDFIRLSKMEARHKKGFEACGRNLKVT
B8HSZ3_CYAP4      QDAYSRIDAIVIEGEQEAHDNYLKLTELLPDCQEDLVRLAKMEARHKKGFEACGRNLKVT
Q8DJB4_THEEB      KDAYSRINAIVIEGEQEAHDNYIDLAKLLPQHQEELTRLAKMEARHKKGFEACGRNLSVT
B8HLW2_CYAP4      RNAYRRVNGIVIEGEKQAYDNFIRLAELLPEYQAELTRLAKMEARHQKSFVACGQNLKVS
A3Z6M0_9SYNE      REAYSRINGVVIVGEGLANRHFQMLARRIPADRDELQRLGRMEGDHASAFVGCGRNLGVV
                  :.** *::.:*: **  *  ::  :   :.     : :*. **  *  .* .*..** : 

Q2JJ13_SYNJB      PDREFARTFFAPLRNNFQKAAAAGDLVTCLVIQSLIIECFAIAAYNIYIPVADEFARKIT
Q2JX62_SYNJA      PDVEFARAFFAPLRDNFQSAAAAGDLVSCFVIQSLIIECFAIAAYNIYIPVADDFARKIT
Q7NGM3_GLOVI      PDDPFARAYFEQLDGNFQQAAAEGDLTTCMVIQALIIECFAIAAYNVYIPVADAFARKVT
Q7U5G9_SYNPX      ADMVFAKKFFEPLHGNFQAALKEGKVVTCLLIQALLIEAFAISAYHIYIPVADPFARKIT
Q3ALN2_SYNSC      ADLPFAKKFFEPLHGNFQAALKEGKVVTCLLIQALLIEAFAISAYHIYIPVADPFARKIT
Q3AV61_SYNS9      ADMPFAKDFFGPLHGNFQVALKEGKVVTCLLIQALLIEAFAISAYHIYIPVADPFARKIT
A5GJG5_SYNPW      ADMPFAKEFFGPLHGNFQTALKEGKVVTCLLIQALLIEAFAISAYHIYIPVADPFARKIT
Q0I8M9_SYNS3      ADMPFAQEFFAPLHGNFQSALKEGKVVTCLLIQALLIEAFAISAYHIYIPVADPFARKIT
A5GUD0_SYNR3      PDMVFAKEFFSDLHGNFRSALEENKVVTCLVIQALMIEAFAIAAYHIYIPVADPFARKIT
A2C7S0_PROM3      ADMDFAREFFAPLRDNFQTALEQGKTPTCLLIQALLIEAFAISAYHTYIPVSDPFARKIT
ALDEC_PROMM       ADMDFAREFFAPLRDNFQTALGQGKTPTCLLIQALLIEAFAISAYHTYIPVSDPFARKIT
A2BVJ4_PROM5      ADMSFAKEFFSKLHGNFQAALKNESLTTCLLIQAILIEAFAISAYHVYIRVADPFAKKIT
A8G3P7_PROM2      ADMPFAKEFFSKLHGNFQIALKDGNLTTCLLIQAILIEAFAISAYHVYIRVADPFAKKIT
A3PBQ6_PROM0      ADMEFAKKFFSKLHGNFQVALKKGNVTTCLLIQAILIEAFAISAYNVYIRVADPFAKKIT
A2BQ13_PROMS      ADMDFAKKFFSKLHGNFQVALEKGNLTTCLLIQAILIEAFAISAYNVYIRVADPFAKKIT
Q31C02_PROM9      ADMVFAKKFFSKLHGNFQIALEKGNLTTCLLIQAILIEAFAISAYNVYIRVADPFAKKIT
Q7V2E8_PROMP      ADMIFAKEFFSKLHGNFQVALSNGKTTTCLLIQAILIEAFAISAYHVYIRVADPFAKKIT
A9BEF6_PROM4      ADMEFAQRFFAPLHGNFQKALENGKITTCFLIQAILIEAFAISAYHVYIRVADPFAKKIT
Q7VD51_PROMA      ADIPFAEKFFSPLHGNFQKAFKEENLTTCFLIQAILIEAFAISAYHVYIRVADPFAKKIT
A2C0Z0_PROM1      PDMPFAKTFFSKLHNNFLEAFKVGDTTTCLLIQCILIESFAISAYHVYIRVADPFAKRIT
Q46GP5_PROMT      PDMPFAKTFFSKLHNNFLEAFKVGDTTTCLLIQCILIESFAISAYHVYIRVADPFAKRIT
B7JUH1_RIPO1      PDMQYAQEFFSSLHGNFQKAKAEGKIVTCLLIQSLIIEAFAIAAYNIYIPVADPFARKIT
B1WR71_CROS5      PDMDYAQQFFAELHGNFQKAKAEGKIVTCLLIQSLIIEAFAIAAYNIYIPVADPFARKIT
D3EPA5_ATETH      PDMQYAKEFFSQLHENFQIAKNEKKVVTCLLIQALIIEAFAIAAYNIYIPVADPFARKIT
ALDEC_SYNY3       PDMPYAQEFFAGLHGNFQHAFSEGKVVTCLLIQALIIEAFAIAAYNIYIPVADDFARKIT
B0JY93_MICAN      PDMDYAREFFSSLHNNFQIAYAEGKVVTCLLIQSLIIEAFAIAAYNIYIPVADPFARKIT
Q8YLL5_NOSS1      PDMEFAKEFFAGLHGNFQKAAAEGKIVTCLLIQSLIIECFAIAAYNIYIPVADDFARKIT
Q3MA38_TRIV2      PDIEFAKEFFAGLHGNFQKAAAEGKVVTCLLIQSLIIECFAIAAYNIYIPVADDFARKIT
D7E2W1_NOSA0      PDMQFAKEFFSGLHQNFQTAAAAGNVVTCLLIQSLIIECFAIAAYNIYIPVADDFARKIT
ALDEC_NOSP7       PDLQFAKEFFSGLHQNFQTAAAEGKVVTCLLIQSLIIECFAIAAYNIYIPVADDFARKIT
Q112R8_TRIEI      PDMEFAKKFFEPLHENFQTAAATGNVVTCLLIQSLIIECFAIAAYNIYIPVADPFARKIT
ALDEC_SYNE7       PDMGFAQKFFERLHENFKAAAAEGKVVTCLLIQSLIIECFAIAAYNIYIPVADAFARKIT
B0C9L0_ACAM1      CDLDFARRFFSDLHKNFQDAAAEDKVPTCLVIQSLIIECFAIAAYNIYIPVADDFARKIT
B8HSZ3_CYAP4      PDMEFAQQFFADLHNNFQKAAAANKIATCLVIQALIIECFAIAAYNIYIPVADDFARKIT
Q8DJB4_THEEB      PDMEFAKAFFEKLRANFQRALAEGKTATCLLIQALIIESFAIAAYNIYIPMADPFARKIT
B8HLW2_CYAP4      PDLDFAAQFFAELHQIFASAANAGQVATCLVVQALIIECFAIAAYNTYLPVADEFARKVT
A3Z6M0_9SYNE      ADLPLARRLFQPLHDLFKRHDHDGNRAECLVIQGLIVECFAVAAYRHYLPVADAYARPIT
                   *   *   *  *   *       .   *:::* :::*.**::**. *: ::* :*: :*

Q2JJ13_SYNJB      EGVVKDEYLHLNFGERWLGEHFGEVKGQIEAANAQNLPLVWQMLQQVDQDVEAIYMDREA
Q2JX62_SYNJA      EGVVKDEYLHLNFGERWLGEHFAEVKAQIEAANAQNLPLVRQMLQQVEADVEAIYMDREA
Q7NGM3_GLOVI      EGVVKDEYTHLNFGQQWLKERFVTVREGIERANAQNLPIVWRMLNAVEADTEVLQMDKEA
Q7U5G9_SYNPX      EGVVKDEYTHLNYGQEWLKANFEASKDELFEANKANLPLIRSMLEEVASDAAVLHMEKED
Q3ALN2_SYNSC      EGVVKDEYTHLNYGQEWLKANFEASKNELFEANKANLPLIRSMLEDVAADAAVLHMEKED
Q3AV61_SYNS9      EGVVKDEYTHLNYGQEWLKANFEASKDEMFAANKANLPLIRSMLEGVAADAAVLHMEKED
A5GJG5_SYNPW      EGVVKDEYTHLNYGQEWLKANFEASREELMEANKVNLPLIRSMLEQVAKDAAVLKMEKED
Q0I8M9_SYNS3      EGVVKDEYTHLNYGQEWLKANFEASRDELMEANKVNLPLIRSMLEQVAADASVLHMEKED
A5GUD0_SYNR3      EGVVKDEYTHLNYGQEWLKANFDSSRDEIIEANKANLPIIRRMLEEVADDAAELKMEKES
A2C7S0_PROM3      EGVVKDEYTHLNYGEAWLKANLESCREELLEANRENLPLIRRMLDQVAGDAAVLQMDKED
ALDEC_PROMM       EGVVKDEYTHLNYGEAWLKANLESCREELLEANRENLPLIRRMLDQVAGDAAVLQMDKED
A2BVJ4_PROM5      QGVVNDEYLHLNYGEKWLKENLSTCKDELIAANKVNLPIIKKMLDQVADDAATLAMDKEE
A8G3P7_PROM2      QGVVNDEYLHLNYGEKWLKENLHTCKDELIAANKVNLPLIKKMLDQVAEDAATLSMDKEE
A3PBQ6_PROM0      EGVVKDEYLHLNYGQQWLKENLSTCKDELMEANKVNLPLIKKMLDEVADDASVLAMDREE
A2BQ13_PROMS      EGVVKDEYLHLNYGQEWLKENLSTCKEELMEANKVNLPLIKKMLDEVADDASVLAMDKEE
Q31C02_PROM9      EGVVKDEYLHLNYGQEWLKKNLSTCKEELMEANKVNLPLIKKMLDEVAEDASVLAMDREE
Q7V2E8_PROMP      QGVVKDEYLHLNYGQEWLKENLATCKDELMEANKVNLPLIKKMLDQVSEDASVLAMDREE
A9BEF6_PROM4      EGVVKDEYLHLNYGQEWLKANLATCKDELIAANKENLPLINSMLDQVANDAQVLYMEKEE
Q7VD51_PROMA      ENVVKDEYLHLNYGQQWLKANLDTCKEELMKANKENLPLIKSMLDQVADDACSLSMDKEE
A2C0Z0_PROM1      EGVVQDEYLHLNYGQEWLKANLETVKKDLMRANKENLPLIKSMLDEVSNDAEVLHMDKEE
Q46GP5_PROMT      EGVVQDEYLHLNYGQEWLKANLETVKKDLMRANKENLPLIKSMLDEVSNDAEVLHMDKEE
B7JUH1_RIPO1      EGVVKDEYTHLNFGEVWLQEHFEESKAELEEANKANLPIVWEMLNQVEGDAKVLGMEKEA
B1WR71_CROS5      EGVVKDEYTHLNFGEVWLKEHFEASKAELEDANKENLPLVWQMLNQVEKDAEVLGMEKEA
D3EPA5_ATETH      ENVVKDEYKHLNFGEVWLGENFESSKIELEEANKTNLPIVWKMLNEVEQDASILGMEKEA
ALDEC_SYNY3       EGVVKDEYTHLNYGEEWLKANFATAKEELEQANKENLPLVWKMLNQVQGDAKVLGMEKEA
B0JY93_MICAN      EGVVKDEYLHLNFGEEWLKANFETAKEELEAANRANLPIVWRMLNQVENDARVLGMEKEA
Q8YLL5_NOSS1      EGVVKDEYSHLNFGEVWLQKNFAQSKAELEEANRHNLPIVWKMLNQVADDAAVLAMEKEA
Q3MA38_TRIV2      EGVVKDEYSHLNFGEVWLQKNFAQSKAELEEANRHNLPIVWKMLNQVADDAAVLAMEKEA
D7E2W1_NOSA0      EGVVKEEYSHLNFGEVWLKEHFAESKAELDDANRQNLPIVWQMLNQVADDARVLAMEKEA
ALDEC_NOSP7       EGVVKEEYSHLNFGEVWLKEHFAESKAELELANRQNLPIVWKMLNQVEGDAHTMAMEKDA
Q112R8_TRIEI      ESVVKDEYSHLNFGEVWLKEYFEDSKQELQKANRQNLPLVWKMLNQVEKDAKTLEMEKEA
ALDEC_SYNE7       EGVVRDEYLHRNFGEEWLKANFDASKAELEEANRQNLPLVWLMLNEVADDARELGMERES
B0C9L0_ACAM1      ESVVKDEYQHLNYGEEWLKAHFDDVKAEIQEANRKNLPIVWRMLNEVDKDAAVLGMEKEA
B8HSZ3_CYAP4      ENVVKDEYTHLNFGEEWLKANFDSQREEVEAANRENLPIVWRMLNQVETDAHVLGMEKEA
Q8DJB4_THEEB      ESVVKDEYSHLNFGEIWLKEHFESVKGELEEANRANLPLVWKMLNQVEADAKVLGMEKDA
B8HLW2_CYAP4      ASVVQDEYSHLNFGEVWLQNAFEQCKDEIITANRLALPLIWKMLNQVTGELRILGMDKAS
A3Z6M0_9SYNE      AAVMNDESEHLDYAETWLQRHFDQVKARVSAVVVEALPLTLAMLQSLAADMRQIGMDPVE
                    *:.:*  * ::.: **   :   :  :  .    **:   **: :  :   : *:   

Q2JJ13_SYNJB      IVEDFMIAYGEALANIGFSTREVMRLSAQGLRAA---
Q2JX62_SYNJA      IVEDFMIAYGEALASIGFNTREVMRLSAQGLRAA---
Q7NGM3_GLOVI      IVEDFMIAYGEALGDIGFSMRDVMKMSARGLASAPRQ
Q7U5G9_SYNPX      LIEDFLIAYQEALGEIGFTSRDIARMAAAALAV----
Q3ALN2_SYNSC      LIEDFLIAYQEALGEIGFTSRDIARMAAAALAV----
Q3AV61_SYNS9      LIEDFLIAYQEALNEIGFSSRDIAKMAAAALAI----
A5GJG5_SYNPW      LIEDFLIAYQEALEEIGFTSRDIARMAAAALSI----
Q0I8M9_SYNS3      LIEDFLIAYQEALNEIGFSSRDIARMAAAALSI----
A5GUD0_SYNR3      LIEDFLIAYQEALMDIGFNSRDLARMSAAALVA----
A2C7S0_PROM3      LIEDFLIAYQESLTEIGFNTREITRMAAAALVS----
ALDEC_PROMM       LIEDFLIAYQESLTEIGFNTREITRMAAAALVS----
A2BVJ4_PROM5      LMEEFMIAYQDALLEMGLDNREIARMAMAAIV-----
A8G3P7_PROM2      LMEEFMIAYQDALLEMGLDNREIARMAMAAIV-----
A3PBQ6_PROM0      LMEEFMIAYQDTLMEIGLDNREIARMAMAAIV-----
A2BQ13_PROMS      LMEEFMIAYQDTLMEIGLDNREIARMAMAAIV-----
Q31C02_PROM9      LMEEFMIAYQDTLLEIGLDNREIARMAMAAIV-----
Q7V2E8_PROMP      LMEEFMIAYQDTLLEIGLDNREIARMAMAAIV-----
A9BEF6_PROM4      LMEEFMIAYQDSLMEIGLDAREIARMALAAIA-----
Q7VD51_PROMA      LMEEFMIAYQDSLLEIGLDSREIARMALAALV-----
A2C0Z0_PROM1      LMEEFMIAYQDSLLEIGLDNREIARMALAAVI-----
Q46GP5_PROMT      LMEEFMIAYQDSLLEIGLDNREIARMALAAVI-----
B7JUH1_RIPO1      LVEDFMISYGEALSNIGFSTRDIMRMSSHGLVAA---
B1WR71_CROS5      LVEDFMISYGEALSNIGFSTREIMKMSAYGLRAA---
D3EPA5_ATETH      LVEDFMISYGEALGNIGFSTREIMRMSSHGLRAS---
ALDEC_SYNY3       LVEDFMISYGEALSNIGFSTREIMRMSSYGLAGV---
B0JY93_MICAN      LVEDFMISYGEALSNIGFSTRDIMRMSAYGLTAV---
Q8YLL5_NOSS1      LVEDFMIQYGEALSNIGFTTRDIMRMSAYGLTAA---
Q3MA38_TRIV2      LVEDFMIQYGEALSNIGFTTRDIMRMSAYGLTAA---
D7E2W1_NOSA0      LVEDFMIQYGEALSNIGFTTRDIIRLSAYGLATV---
ALDEC_NOSP7       LVEDFMIQYGEALSNIGFSTRDIMRLSAYGLIGA---
Q112R8_TRIEI      LIEDFMIAYGEALNNIGFTTGEIMRMSAYGLIAA---
ALDEC_SYNE7       LVEDFMIAYGEALENIGFTTREIMRMSAYGLAAV---
B0C9L0_ACAM1      LVEDFMIQYGEALSNIGFSTGEIMRMSAYGLVAA---
B8HSZ3_CYAP4      LVESFMIQYGEALENIGFSTREIMRMSVYGLSAA---
Q8DJB4_THEEB      LVEDFMIQYSGALENIGFTTREIMKMSVYGLTGA---
B8HLW2_CYAP4      LVEDFSTRYGEALGQIGFKLSEILSLSVQGLQAVTP-
A3Z6M0_9SYNE      TLASFSELFREALESVGFEAVEARRLLMRAAARMV--
                   : .*   :  :* .:*:   :   :   .