CLUSTAL format seed alignment for MF_00946

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

HDEA_BRUSI            MIKALFNKNTALAAVAILALSGGAMAESAKTHKTDM-----AKKKVSELTCEDFNGLEES
HDEA_BRUSU            MIKALFNKNTALAAVTILALSGGAMAESAKTHKTDM-----AKKKVSELTCEDFNGLEES
HDEA_BRUO2            MIKTLFNKNTALAAVAILALSGSAMAESAKTHKTDM-----AKKKVSELTCEDFNGLEES
Q2KVV4_BORA1          MKKII---ISLSIAAATLSFSGTALADAKK--------------PMPLWQCSDYLQLNES
Q2KWS9_BORA1          MKKAM---LAVTMLGLA-SLAGAAHADTKK--------------PVQLWLCSDYLEVNET
G9IY85_ECO57          MKKVL---GVILGGL--LLLPVVSNAADAQKAAD-------NKKPVNSWTCEDFLAVDES
HDEA_ECO57            MKKVL---GVILGGL--LLLPVVSNAADAQKAAD-------NKKPVNSWTCEDFLAVDES
HDEA_ECOLI            MKKVL---GVILGGL--LLLPVVSNAADAQKAAD-------NKKPVNSWTCEDFLAVDES
Q3YWI4_SHISS          MKKVL---GVILGGL--LLLPVVSNAADAQKAAD-------NKKPVNSWTCEDFLAVDES
B2U4H5_SHIB3          MKKVL---GVILGGL--LLLPVVSNAADAQKAAD-------NKKPVNSWTCEDFLAVDES
A0A0A0FHD6_ECOLX      MKKVL---GVILGGL--LLLPVVSNAADAQKAAD-------NKKPVNSWTCEDFLAVDES
A0A029IJ45_ECOLX      MKKVL---GVILGGL--LLLPVVSNAADAQKAAD-------NKKPVNSWTCEDFLAVDES
B1LJ52_ECOSM          MKKVL---GVILGGL--LLLPVVSSAADAQKAAD-------NKKPVNSWTCEDFLAVDES
E3G1K5_ENTLS          MKKVS---GIILGSL--LLIPALSQAAEHQK-------------PVNNWTCEDFLALDSS
J2E3X2_KLEPN          -MKVK---SLVFGAIGALFLTSAAHAADHKK-------------PVNSWTCEDFLAVNED
A0A140NQL6_PROSM      MNKA-----LFAGIITMSLMATSAFATTDT-------------KPVSQWKCEDFLVIDDN
M7CYT7_MORMO          MKKL-----IIVGAIVAAMTSAFAMAADSTGPKHDV-----TQKPVSQWTCDDFLSIDES
B2Q5M6_PROST          MKKY-----FIVGIIAASLTSLSAMAEDKKN----------DTKPLAEWTCEEFLAIDDN
C1D607_LARHH          MQRSL---ALSGLAL--ALFATMSVAGTPPK------------KPVSQWTCEEFLTLDDQ
J7QPM2_METSZ          --MKP---VYVIAAAALSFYA-------TNGLADT-------KKPTSKWTCEDFLAVDDQ
C1D4E4_LARHH          MKTRS---ATVLAALALALGAGMAHAADAAGKTAS-------PKGYYKWTCQDFLDLDES
A9VXM9_METEP          MRTGS-SKTYLLSALAVVLSAGLVQAETTSGKSTDKNQEKLASKPLEKVTCEEFNGFEDT
                                          .                             *.::  .:. 

HDEA_BRUSI            FKPTVVGWVVGFNK-KGKEEDAVIDVDGIETVTPAIIEACKQEPKASFWKKAEAELKKVF
HDEA_BRUSU            FKPTVVGWVVGFNK-KGKEEDAVIDVDGIETVTPAIIEACKQEPKASFWKKAEAELKKVF
HDEA_BRUO2            FKPTVVGWVVGFNK-KGKEEDAVIDVDGIETVTPAIIEACKQEPKASFWKKAEAELKKVF
Q2KVV4_BORA1          YRPVALGFAEAVNR-KGKPEDDVVDIEGIAQITPTLVTYCQENPKVALTDALAQTKANAA
Q2KWS9_BORA1          YRPTALGFAEAVNK-KGKVEDAVVDLEGIEKIKPSLLTYCKENPKIALRDALDNVRK---
G9IY85_ECO57          FQPTAVGFAEALNN-KDKPEDAVLDVQGIATVTPAIVQACTQDKQANFKDKVKGEWDKIK
HDEA_ECO57            FQPTAVGFAEALNN-KDKPEDAVLDVQGIATVTPAIVQACTQDKQANFKDKVKGEWDKIK
HDEA_ECOLI            FQPTAVGFAEALNN-KDKPEDAVLDVQGIATVTPAIVQACTQDKQANFKDKVKGEWDKIK
Q3YWI4_SHISS          FQPTAVGFAEALNN-KDKPEDAVLDVQGIATVTPAIVQACTQDKQANFKDKVKGEWDKIK
B2U4H5_SHIB3          FQPTAVGFAEALNN-KDKPEDAVLDVQGIATVTPAIVQACTQDKQANFKDKVKGEWDKIK
A0A0A0FHD6_ECOLX      FQPTAVGFAEALNN-KDKPEDAVLDVQGIATVTPAIVQACTQDKQANFKDKVKGEWDKIK
A0A029IJ45_ECOLX      FQPTAVGFAEALNN-KDKPEDAVLDVQGIATVTPAIVQACTQDKKASFKDKVKGEWDKIK
B1LJ52_ECOSM          FQPTAVGFAEALNN-KDKPEDAVLDVQGIATVTPAIVQACTQDKKASFKDKVKGEWDKIK
E3G1K5_ENTLS          FQPTAVGFAEALNN-KDKPEDAVMDVKGIETVTPAIVQACTENKKASFKSKVESEWEKFK
J2E3X2_KLEPN          FQPTAVGVAEALNS-KDKPEDAVLNVSGIEKVTPTIVQACQKDKKMSFKDKVRAEWDNLK
A0A140NQL6_PROSM      FYPTAIGAAEIVTQ-KGKVEDSTLNISGIETATPLIVDACKKAPKESFIQKVEEYLKKW-
M7CYT7_MORMO          FYPTAVGIAGIITG-KNKVEDSTIDVQGIMTATPAIIESCKKDPKSSFLQRVEEFGKSYS
B2Q5M6_PROST          FYPTAVGFGELLTK-KDKVEDAVLDVDGIQTLTPVVIDACKKDTKANFVEQVKNAKK---
C1D607_LARHH          FKPNAVYFSEGLNK-KHQPVDAVMDETGALKVTPMVVTECQKDRKASFWSKLKTTWQHIE
J7QPM2_METSZ          FQPKVIYWSSAQSK-KGKPLATDVDIEGTEKVIPIIIDDCKKAPQESFWSKLKDAWKKVE
C1D4E4_LARHH          FKPKVVYWAEGFNN-KGKPDAAMVDVQGVEKIIPVVVDQCKLKPTEKLMKIMKSAKMTAG
A9VXM9_METEP          FKPKVVAWAAGYKQGQKKPDVVAIDIAGVEKVTPLVAEECRKAPTASLWSKIDGELKKVF
                      : * .:      .  : :     ::  *     * :   *       : .          

HDEA_BRUSI            ---------------
HDEA_BRUSU            ---------------
HDEA_BRUO2            ---------------
Q2KVV4_BORA1          NTTSKTPPTSSTTAK
Q2KWS9_BORA1          ---------------
G9IY85_ECO57          KDM------------
HDEA_ECO57            KDM------------
HDEA_ECOLI            KDM------------
Q3YWI4_SHISS          KDM------------
B2U4H5_SHIB3          KDM------------
A0A0A0FHD6_ECOLX      KDM------------
A0A029IJ45_ECOLX      KDM------------
B1LJ52_ECOSM          KDM------------
E3G1K5_ENTLS          KHI------------
J2E3X2_KLEPN          KEIY-----------
A0A140NQL6_PROSM      ---------------
M7CYT7_MORMO          QISG-----------
B2Q5M6_PROST          ---------------
C1D607_LARHH          QKM------------
J7QPM2_METSZ          ADAKSLGKKL-----
C1D4E4_LARHH          H--------------
A9VXM9_METEP          ---------------