CLUSTAL format seed alignment for MF_00948

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NUSG_BACSU            ------------------------------------------------------------
Q8YAA6_LISMO          ------------------------------------------------------------
A0A2B8IEH1_BACAN      ------------------------------------------------------------
Q81J54_BACCR          ------------------------------------------------------------
NUSG_STAA8            ------------------------------------------------------------
Q830P6_ENTFA          ------------------------------------------------------------
F9UL82_LACPL          ------------------------------------------------------------
NUSG_STRPQ            ------------------------------------------------------------
Q8DNB8_STRR6          ------------------------------------------------------------
NUSG_LACLA            ------------------------------------------------------------
A5I7L9_CLOBH          ------------------------------------------------------------
Q97EG4_CLOAB          ------------------------------------------------------------
Q2RFN4_MOOTA          ------------------------------------------------------------
A9WFP5_CHLAA          ------------------------------------------------------------
NUSG_MYCTU            ---------------------------MTTFDGD---------TSAGEAVDLTEANAFQ-
A0QS44_MYCS2          ---------------------------MTTFDGDETFADETAESEAVEAAETTESEAVES
NUSG_STRCO            -----MSDPNVNDAIEPVESVEDELGTVEGADNEDTEASAEAEAADDTVVAETDEDATDA
H7C6D0_CORGL          MSDENINEFEQDEDLNFGASFSDEFADDDFDAEADVEADAAAEASALEAEQDLEEETLDA
D1B6U2_THEAS          ------------------------------------------------------------
Q8G4T6_BIFLO          -----------MSDELNLENLDAVPAEEPVVEASEAAADEAAAPVEPVADLSAESDASVD
NUSG_DEIRA            ------------------------------------------------------------
NUSG_THET8            ------------------------------------------------------------
NUSG_SYNY3            ------------------------------------------------------------
Q8DM29_THEEB          ------------------------------------------------------------
Q7VDY4_PROMA          ------------------------------------------------------------
Q7NMD6_GLOVI          ------------------------------------------------------------
B8E0K4_DICTD          ------------------------------------------------------------
NUSG_CAMJE            ------------------------------------------------------------
NUSG_HELPY            ------------------------------------------------------------
NUSG_AQUAE            ------------------------------------------------------------
A6GYU5_FLAPJ          ------------------------------------------------------------
Q8A464_BACTN          ------------------------------------------------------------
Q2S1Q0_SALRD          ------------------------------------------------------------
Q8KG20_CHLTE          ------------------------------------------------------------
Q8F0R7_LEPIN          ------------------------------------------------------------
NUSG_ECOLI            ------------------------------------------------------------
Q32AF4_SHIDS          ------------------------------------------------------------
NUSG_SALTY            ------------------------------------------------------------
NUSG_YERPE            ------------------------------------------------------------
NUSG_VIBCH            ------------------------------------------------------------
Q5E230_ALIF1          ------------------------------------------------------------
NUSG_BUCAI            ------------------------------------------------------------
NUSG_HAEIN            ------------------------------------------------------------
Q8EK79_SHEON          ------------------------------------------------------------
NUSG_PSEAE            ------------------------------------------------------------
C1DKK0_AZOVD          ------------------------------------------------------------
E4PLX6_MARAH          ------------------------------------------------------------
H9L4N0_XANCP          ------------------------------------------------------------
Q83ET5_COXBU          ------------------------------------------------------------
NUSG_NEIMB            ------------------------------------------------------------
Q5F5R0_NEIG1          ------------------------------------------------------------
Q7W0S4_BORPE          ------------------------------------------------------------
Q63PZ8_BURPS          ------------------------------------------------------------
Q748Y1_GEOSL          ------------------------------------------------------------
Q89J68_BRADU          ------------------------------------------------------------
A9CIF8_AGRFC          ------------------------------------------------------------
Q9A3J9_CAUVC          ------------------------------------------------------------
Q2RQU8_RHORT          ------------------------------------------------------------
Q3J5T5_CERS4          ------------------------------------------------------------
Q727D2_DESVH          ------------------------------------------------------------
B5YFW3_THEYD          ------------------------------------------------------------
Q1IHG9_KORVE          ------------------------------------------------------------
Q5NID7_FRATT          ------------------------------------------------------------
NUSG_CHLTR            ------------------------------------------------------------
NUSG_RICPR            ------------------------------------------------------------
NUSG_THEMA            ------------------------------------------------------------
Q8RHI1_FUSNN          ------------------------------------------------------------
NUSG_BORBU            ------------------------------------------------------------
Q7UMY8_RHOBA          ------------------------------------------------------------
Q5FFE4_EHRRG          ------------------------------------------------------------
C0R546_WOLWR          -----------------------MECEYKWYIIKVDYGYEQGIRELVSNAVYFKEVFIPY
NUSG_MYCPN            ------------------------------------------------------------
NUSG_MYCGE            ------------------------------------------------------------
A0A014LZE0_MYCMC      ------------------------------------------------------------
Q5ZZQ0_MYCH2          ------------------------------------------------------------
Q9PPQ8_UREPA          ------------------------------------------------------------
                                                                                  

NUSG_BACSU            -----------------------------------------------------------M
Q8YAA6_LISMO          -----------------------------------------------------------M
A0A2B8IEH1_BACAN      -----------------------------------------------------------M
Q81J54_BACCR          -----------------------------------------------------------M
NUSG_STAA8            ------------------------------------------------------MSEEVG
Q830P6_ENTFA          --------------------------------------------------------METF
F9UL82_LACPL          -------------------------------------------------------MVESV
NUSG_STRPQ            -------------------------------------------------------MLDSF
Q8DNB8_STRR6          ---------------------------------------------------MKGNIMDSF
NUSG_LACLA            ---------------------------------------------------MEDNNLVSF
A5I7L9_CLOBH          ------------------------------------------------MSEE--------
Q97EG4_CLOAB          ------------------------------------------------MSE---------
Q2RFN4_MOOTA          -----------------------------------------------------------M
A9WFP5_CHLAA          ------------------------------------------------MSEEKEKEKEAD
NUSG_MYCTU            -------------------------------------DAAAPAE-EVDPAAALKAELRSK
A0QS44_MYCS2          DAAETEGADAAEEAGEAAEAS------EGVESSEGEGEAAPADE-DEDPAVALKKELRLK
NUSG_STRCO            EADETAEATDAEATEAEADAD------ADAAEAEESEEEPEAEEPELDPIEKLRQELRVL
H7C6D0_CORGL          PEEAAEEAPAAAESEAPVEEDEEADSLAQAAAALGDTDEQDADAEYKARLRKFTRELKKQ
D1B6U2_THEAS          --------------------------------------------------------MKDD
Q8G4T6_BIFLO          NADVESDAPAATESAPVASTQTETVSLDEDEEEVNESEQAEETDAGQQAVDEFSKSLRSL
NUSG_DEIRA            -----------------------------------------------------------M
NUSG_THET8            -----------------------------------------------------------M
NUSG_SYNY3            ----------------------------MSFTD---------DQSPVAEQNK----KTPS
Q8DM29_THEEB          --------------------------MVSEFTDHADLDDPLDDTVEVSEGEQ----AGKV
Q7VDY4_PROMA          ---------------------------MSEIDPTPQESSPVMDPPAPSQGEESTLIAKTS
Q7NMD6_GLOVI          ---------------------------MVIGTDF------LMDSARKPEQPE--------
B8E0K4_DICTD          ----------------------------------------------------------MA
NUSG_CAMJE            ----------------------------------------------------------MS
NUSG_HELPY            ------------------------------------------------------------
NUSG_AQUAE            ---------------------------------------------------MSEQQVQEL
A6GYU5_FLAPJ          -------------------------------------------------------MADVN
Q8A464_BACTN          -------------------------------------------------------MAEIE
Q2S1Q0_SALRD          ------------------------------------------------------MAEDTE
Q8KG20_CHLTE          ----------------------------------------------MSAKKKVVKEQHPP
Q8F0R7_LEPIN          ----------------------------------------------------------MG
NUSG_ECOLI            ----------------------------------------------------MSE---AP
Q32AF4_SHIDS          ----------------------------------------------------MSE---AP
NUSG_SALTY            ----------------------------------------------------MSE---AP
NUSG_YERPE            ----------------------------------------------------MSE---AP
NUSG_VIBCH            ----------------------------------------------------MSE---AP
Q5E230_ALIF1          ----------------------------------------------------MSE---AP
NUSG_BUCAI            ----------------------------------------------------MHE---SQ
NUSG_HAEIN            ----------------------------------------------------MTEETTVS
Q8EK79_SHEON          ----------------------------------------------------MTEAKEA-
NUSG_PSEAE            -----------------------------------------------------------M
C1DKK0_AZOVD          ------------------------------------------------------------
E4PLX6_MARAH          ------------------------------------------------------------
H9L4N0_XANCP          ------------------------------------------------------------
Q83ET5_COXBU          -------------------------------------MFLLIAPGVLRSLLKMTE----E
NUSG_NEIMB            -----------------------------------------------------------M
Q5F5R0_NEIG1          -----------------------------------------------------------M
Q7W0S4_BORPE          -----------------------------------------------------------M
Q63PZ8_BURPS          ---------------------------------------------------MSDTPASPS
Q748Y1_GEOSL          -----------------------------------------------------------M
Q89J68_BRADU          ---------------------------------------------------MATATAQLS
A9CIF8_AGRFC          -----------------------------------------------------------M
Q9A3J9_CAUVC          ---------------------------------------------------MSTETASNP
Q2RQU8_RHORT          -----------------------------------------------------------M
Q3J5T5_CERS4          -----------------------------------------------------------M
Q727D2_DESVH          ----------------------------------------------------MTETTTAS
B5YFW3_THEYD          -----------------------------------------------------------M
Q1IHG9_KORVE          --------------------------------------MDETNNNAEVQPTPDGQPLQNP
Q5NID7_FRATT          ------------------------------------------------------------
NUSG_CHLTR            ------------------------------------------------------------
NUSG_RICPR            --------------------------------------------MTEQTIDNILPASKNN
NUSG_THEMA            -----------------------------------------------------------M
Q8RHI1_FUSNN          -------------------------------------------------------MSIEN
NUSG_BORBU            -----------------------------------------------------------M
Q7UMY8_RHOBA          --------------MSDEDVQDVDSPETEASPAASEAPAPPPPAPVDPNAPPKPEVDDES
Q5FFE4_EHRRG          -----------------------------------------------------------M
C0R546_WOLWR          QTVCNSKSDIKELCEVYVYMHLCDESKNILNQTPGFCSGESGNFEMILDDEISLKCKEFN
NUSG_MYCPN            ------------------------------------------------------MEQVEL
NUSG_MYCGE            ------------------------------------------------------MQASEL
A0A014LZE0_MYCMC      --------------------------------------------MTYEEIKQLEDEILEA
Q5ZZQ0_MYCH2          ----------------------------------------------------------MK
Q9PPQ8_UREPA          --------------------------------------MAYKIKDLDSKLLSDLKIDFNH
                                                                                  

NUSG_BACSU            EKNWYVVHTYSGYENKVKANLEKRVESMGM---QDKIFRVVVPEEEETDIK-NGKKK---
Q8YAA6_LISMO          EKNWYVVHTYSGYENKVKANLEKRVESMGM---SDKIFRVIVPEEEETEVK-NGKTK---
A0A2B8IEH1_BACAN      EKSWYVVHTYSGYENKVKANLEKRVESMGM---QDKIFRVVVPEEVEVEMK-NGKEK---
Q81J54_BACCR          EKSWYVVHTYSGYENKVKANLEKRVESMGM---QDKIFRVVVPEEVEVEMK-NGKEK---
NUSG_STAA8            AKRWYAVHTYSGYENKVKKNLEKRVESMNM---TEQIFRVVIPEEEETQVK-DGKAK---
Q830P6_ENTFA          ERNWYVLHTYSGYENKVKANIESRAQSMGM---GDYIFRVVVPEETEKEVK-NGKEK---
F9UL82_LACPL          EKRWYVLHTYAGYENKVSSNLESRIQSMGM---EDNIFRVVVPEEEAHEVK-NGKDK---
NUSG_STRPQ            DKGWFVLQTYSGYENKVKENLLQRAQTYNM---LDNILRVEIPTQTVNVEK-NGQTK---
Q8DNB8_STRR6          DKGWFVLQTYSGYENKVKENLLQRAQTYNM---LDNILRVEIPTQTVQVEK-NGKRK---
NUSG_LACLA            DQGWFVIQTYAGYERKVKEDLLERAELYNM---ADKILRVEIPTETIRTEV-NGKMK---
A5I7L9_CLOBH          KAKWYVVHTYSGYENKVKVNLQKTVDNRNL---HHWIFDIQVPMEEQVEVK-DGKKK---
Q97EG4_CLOAB          KAKWYVVHTYSGYENKVKANIEKTIENRNL---QNLIMDIQVPLQEEVEEK-DGKKK---
Q2RFN4_MOOTA          EKAWYVIHTYSGYENKVKANLEKRVESMNM---GDKIFRVVVPMEDEVQIK-DGKRK---
A9WFP5_CHLAA          DRRWYVIHTYSGYENKVKKNLEHRIASMEM---QDQIFRVIVPTEEEIEIK-NGQRR---
NUSG_MYCTU            PGDWYVVHSYAGYENKVKANLETRVQNLDV---GDYIFQVEVPTEEVTEIK-NGQRK---
A0QS44_MYCS2          PGDWYVIHSYAGYENKVKANLETRVQNLDV---GDYIFQVEVPTEEVTEIK-NGQRK---
NUSG_STRCO            PGEWYVIHTYAGYENRVKTNLEQRAVSLNV---EDYIFQAEVPQEEVVQIK-NGDRK---
H7C6D0_CORGL          PGVWYIIQCYSGYENKVKANLDMRAQTLEV---EDDIFEVVVPIEQVTEIR-DGKRK---
D1B6U2_THEAS          KRRWYIVQTYSGYENKVKANLEQRIATMGM---EDRIFNVLVPVEEKVFVK-EGRAK---
Q8G4T6_BIFLO          DGKWYVLHTYSGYEKRVKTNIESRVASFGM---EDQIFQVEVPMEEVEKHT-EKGKK---
NUSG_DEIRA            SIEWYAVHTYVGQEDRVQDQLMDRARRLGMY--RTKIFQVLQPEEEAVEIQEGGKKV---
NUSG_THET8            SIEWYAVHTLVGQEEKAKANLEKRIKAFGL---QDKIFQVLIPTEEVVELREGGKKE---
NUSG_SYNY3            EGHWFAVQVASGCEKRVKLNLEQRIHTLDV---ADRILQVEIPKTPIVKIRKDGARV---
Q8DM29_THEEB          KRFWYAVQVASGCEKKVKSTIEQRLHTLDV---ADRIFRIEIPQTPVIKIKKDGSRQ---
Q7VDY4_PROMA          IARWYAIQVASSCEKKVKATLEQRAVTLGV---SNRILEIEIPQTPAVKLKKDGSRQ---
Q7NMD6_GLOVI          -PHWYFVQVASGCEKKVKTNLEQRIQTMEM---SERILKVEIPERQAVRIRQEGSRT---
B8E0K4_DICTD          EPKWFVVHTLAGHEHKVKAILERQVKLNHL---EDKVFEIVVPEEKVMTVK-GGKKR---
NUSG_CAMJE            THKWYAIQTYAGSEMAVKRAIENLVKDNGI---EEQLKEIVVPTEDVIEF-KNGKEK---
NUSG_HELPY            MMDWYAIQTYSGSEQSVKKAIENLANDHNI---RDRIQEIIVPTEDIIEVSKKSKTK---
NUSG_AQUAE            EKKWYALQVEPGKENEAKENLLKVLELEGL---KDLVDEVIVPAEEKVVIRAQGKEKYRL
A6GYU5_FLAPJ          VKKWYVVRAVSGQENKVKAYIEAEINRLEL---SDYVSQVLVPTEKVVTVKDGKKII---
Q8A464_BACTN          -KKWYVLRAISGKEAKVKEYLEADLKNSDL---GEYVSQVLIPTEKVYQVRNGKKIV---
Q2S1Q0_SALRD          TDTWYVLRTFSNHEKKVRRYLESEIERIGL---EDQVEEILIPTETVFEMKGGEKKT---
Q8KG20_CHLTE          QLHWYALRIYSGHERKVKESIEMEVERCGL---SESIKQVYIPYERFVEVKNGKKRS---
Q8F0R7_LEPIN          TKKWYALQTYSGHENKVQKNIEKLIQQKKL---EEKIFQVKIPTMDVAEMKNGKKKV---
NUSG_ECOLI            KKRWYVVQAFSGFEGRVATSLREHIKLHNM---EDLFGEVMVPTEEVVEIRGGQRRK---
Q32AF4_SHIDS          KKRWYVVQAFSGFEGRVATSLREHIKLHNM---EDLFGEVMVPTEEVVEIRGGQRRK---
NUSG_SALTY            KKRWYVVQAFSGFEGRVATSLREHIKLHNM---EELFGEVMVPTEEVVEIRGGQRRK---
NUSG_YERPE            KKRWYVVQAFSGFEGRVAQSLREHIKLHDM---EELFGEVMVPTEEVVEIRGGQRRK---
NUSG_VIBCH            KKRWYVVQAFSGFEGRVAQSLREHIKMHGM---EELFGEVLVPTEEVVEMRAGQRRK---
Q5E230_ALIF1          KKRWYVVQAFSGFEGRVSQSLREHIKMHNM---EELFGEVLVPTEEVVEMRAGQRRK---
NUSG_BUCAI            KKRWYVLQAFSGFESRVAQSIREHVKLNQM---EDLFGEVMVPSQEVVEIRGGQRRK---
NUSG_HAEIN            KKRWYVLQAFSGFESRVALTLREYIKQQQM---EDQFGEVLVPTEEVVENVAGKRRK---
Q8EK79_SHEON          KKRWYVVQAFSGYEGRVCKSLIEYIKMHGM---EQYFGEVLVPTEEVIEMRAGQRRK---
NUSG_PSEAE            AKRWYVVHAYSGYEKHVMRSLIERVKLAGM---EEEFGEILVPTEEVVEMRNGQKRK---
C1DKK0_AZOVD          -----------------MRSLIERVKLAGM---EDQFGEILVPTEEVVEMRNGQKRK---
E4PLX6_MARAH          -----------------MRTLRERVALHEM---EDRFGEILVPTEEVVEMREGKKRK---
H9L4N0_XANCP          MKRWYVVHAYSGFEKSVAQALRDRIARTEM---EERFGDVLVPTEEVIEMRAGQKRR---
Q83ET5_COXBU          KKRWYVIHTYSGDENYVVKVLKEHIHLKEL---DEFFGEIIVPTEEVVEMRSGRKRK---
NUSG_NEIMB            SKKWYVVQAYSGFEKNVQRILEERIAREEM---GDYFGQILVPVEKVVDIRNGRKTI---
Q5F5R0_NEIG1          SKKWYVVQAYSGFEKNVQRILEERIAREEM---GDYFGQILVPVEKVVDIRNGRKTI---
Q7W0S4_BORPE          SKRWYVVHVYSGMEKSVQKALNERIERAEL---QTSFGRILVPSEEVVEVKGGQKSI---
Q63PZ8_BURPS          GKRWYVVHAYSGMEKSVQRALQERIERAGM---QDKFGQILVPTEEVVEVKGGHKAV---
Q748Y1_GEOSL          SKKWYGVHTYSGFENKVRLSLQERVKNLGL---EEFFGEILIPSETVVELKKGEKKT---
Q89J68_BRADU          HKRWYIVHAYSNFEKKVAESIREQAKQRGL---EELFELVLVPTEKVTEVRRGRKID---
A9CIF8_AGRFC          AARWYIVHAYSNFEKKVAESIEEKARQKGL---SHLFEKILVPTEKVVEVRRGRKVD---
Q9A3J9_CAUVC          NHKWYIVHAYSNFEKKVAESIREQAKNQGL---EENFSEILVPTEDVVEIRRGRKVN---
Q2RQU8_RHORT          TARWYVIHVYSGFENKVAQSIREQAIQKGM---DSRIEEVLVPTEEIVEVRRGAKVN---
Q3J5T5_CERS4          AKRWYSVSVLSNFEKKVAEQIRTAVADAGL---EEEIDEVLVPTEEVIEVRRGKKVT---
Q727D2_DESVH          KARWYIVHTYSGFENRVEQTIREMIRTGQS---QDEIVEVVVPTEKVIELVKGEKRT---
B5YFW3_THEYD          AKQWYVVHTMSGFEEKVKASIEERVKTKGL---EDKISRILIPTEKIIEVKGKKKKE---
Q1IHG9_KORVE          NMKWYIIHSYSGFERKVKESLESRIHAFGL---EGKIGRVLIPTESVTEVRGGKKYT---
Q5NID7_FRATT          -MLWYVVQVHSGYEKRVKAQLEENIEIAGL---KNNFGRILVPTENVVEMKGGQKRK---
NUSG_CHLTR            MFKWYVVQVFTAQEKKVKKSLEDFKEASGM---SDFIQQIILPSENVMEVKKGEHKI---
NUSG_RICPR            VKQWYVVHTASGAEKRIKEDILRKIAKQKM---TDFFEDILIPVFGVSEVKRGKNVK---
NUSG_THEMA            KKKWYIVLTMSGYEEKVKENIEKKVEATGI---KNLVGRIVIPEEVVLDATSPSERLILS
Q8RHI1_FUSNN          VRKWFMIHTYSGYEKKVKTDLEQKMETLGF---KEVVTNILVPEEELTEIVRGKP-----
NUSG_BORBU            SRAWYVVQTYSQYEKKIEQDIRLLINEGVF---GGVVLDVKAPIEKVEEIRNGKK-----
Q7UMY8_RHOBA          PMDWYILKVAFNREDSIAEALRKKVRMEDM---GEYFGDIVVPSEDVATFTRDGKRR---
Q5FFE4_EHRRG          KYEWYIIQVSSGSEDKVCQTILDSSKVLGM---AESFHEVFVPYEEVTRIKH-NKKVL--
C0R546_WOLWR          RYKWYILRVASNCEEKVRQHILENSMRLGV---NDYFKEVFIPYEELSEVELKSKKIA--
NUSG_MYCPN            IPQWYVAPV-SVKDEAVVRNLKAKVKALGFD--NEILDVRVLKEREVIEEVFSLKSGKLP
NUSG_MYCGE            TPKWYVAPV-SIKDEAVVKNLKAKIQALGFN--HEIVDVKVLKEREVHEEVYSLKSGKLP
A0A014LZE0_MYCMC      KGQWFVISCQTGHEEKVLGDLQQKIKSASI---EDEVFSIKISKANLVSKSGKSS-----
Q5ZZQ0_MYCH2          IYKWYMISTISSKEDTAISLLKNRIKYENLEEHFQEITKFDVPYYEENPNKPGEKKL---
Q9PPQ8_UREPA          RHQWYIVTVVSGNEQKVIENIKDKLNGYGY---GDKLSDLKIIKEKIKEVKIYEPSE---
                                          :               .                       

NUSG_BACSU            ------------------------------------------------------------
Q8YAA6_LISMO          ------------------------------------------------------------
A0A2B8IEH1_BACAN      ------------------------------------------------------------
Q81J54_BACCR          ------------------------------------------------------------
NUSG_STAA8            ------------------------------------------------------------
Q830P6_ENTFA          ------------------------------------------------------------
F9UL82_LACPL          ------------------------------------------------------------
NUSG_STRPQ            ------------------------------------------------------------
Q8DNB8_STRR6          ------------------------------------------------------------
NUSG_LACLA            ------------------------------------------------------------
A5I7L9_CLOBH          ------------------------------------------------------------
Q97EG4_CLOAB          ------------------------------------------------------------
Q2RFN4_MOOTA          ------------------------------------------------------------
A9WFP5_CHLAA          ------------------------------------------------------------
NUSG_MYCTU            ------------------------------------------------------------
A0QS44_MYCS2          ------------------------------------------------------------
NUSG_STRCO            ------------------------------------------------------------
H7C6D0_CORGL          ------------------------------------------------------------
D1B6U2_THEAS          ------------------------------------------------------------
Q8G4T6_BIFLO          ------------------------------------------------------------
NUSG_DEIRA            ------------------------------------------------------------
NUSG_THET8            ------------------------------------------------------------
NUSG_SYNY3            ------------------------------------------------------------
Q8DM29_THEEB          ------------------------------------------------------------
Q7VDY4_PROMA          ------------------------------------------------------------
Q7NMD6_GLOVI          ------------------------------------------------------------
B8E0K4_DICTD          ------------------------------------------------------------
NUSG_CAMJE            ------------------------------------------------------------
NUSG_HELPY            ------------------------------------------------------------
NUSG_AQUAE            SLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEA
A6GYU5_FLAPJ          ------------------------------------------------------------
Q8A464_BACTN          ------------------------------------------------------------
Q2S1Q0_SALRD          ------------------------------------------------------------
Q8KG20_CHLTE          ------------------------------------------------------------
Q8F0R7_LEPIN          ------------------------------------------------------------
NUSG_ECOLI            ------------------------------------------------------------
Q32AF4_SHIDS          ------------------------------------------------------------
NUSG_SALTY            ------------------------------------------------------------
NUSG_YERPE            ------------------------------------------------------------
NUSG_VIBCH            ------------------------------------------------------------
Q5E230_ALIF1          ------------------------------------------------------------
NUSG_BUCAI            ------------------------------------------------------------
NUSG_HAEIN            ------------------------------------------------------------
Q8EK79_SHEON          ------------------------------------------------------------
NUSG_PSEAE            ------------------------------------------------------------
C1DKK0_AZOVD          ------------------------------------------------------------
E4PLX6_MARAH          ------------------------------------------------------------
H9L4N0_XANCP          ------------------------------------------------------------
Q83ET5_COXBU          ------------------------------------------------------------
NUSG_NEIMB            ------------------------------------------------------------
Q5F5R0_NEIG1          ------------------------------------------------------------
Q7W0S4_BORPE          ------------------------------------------------------------
Q63PZ8_BURPS          ------------------------------------------------------------
Q748Y1_GEOSL          ------------------------------------------------------------
Q89J68_BRADU          ------------------------------------------------------------
A9CIF8_AGRFC          ------------------------------------------------------------
Q9A3J9_CAUVC          ------------------------------------------------------------
Q2RQU8_RHORT          ------------------------------------------------------------
Q3J5T5_CERS4          ------------------------------------------------------------
Q727D2_DESVH          ------------------------------------------------------------
B5YFW3_THEYD          ------------------------------------------------------------
Q1IHG9_KORVE          ------------------------------------------------------------
Q5NID7_FRATT          ------------------------------------------------------------
NUSG_CHLTR            ------------------------------------------------------------
NUSG_RICPR            ------------------------------------------------------------
NUSG_THEMA            PKAKLHVNNGKDVNKGDLIAEEPPIYARRSGVIVDVKNVRKIVV----------------
Q8RHI1_FUSNN          ------------------------------------------------------------
NUSG_BORBU            ------------------------------------------------------------
Q7UMY8_RHOBA          ------------------------------------------------------------
Q5FFE4_EHRRG          ------------------------------------------------------------
C0R546_WOLWR          ------------------------------------------------------------
NUSG_MYCPN            RSLKNTAFTKWFVLDEDR---------------------------------------YLK
NUSG_MYCGE            RSLKNTTFNKWFVLDDYR---------------------------------------YLR
A0A014LZE0_MYCMC      ------------------------------------------------------------
Q5ZZQ0_MYCH2          ------------------------------------------------------------
Q9PPQ8_UREPA          ----------------------------------APRSMKNRANTKWETIVVDGATKYRC
                                                                                  

NUSG_BACSU            --VVKKKVFPGYVLVEIVM-----------------------------------------
Q8YAA6_LISMO          --TIKRKVFPGYVLVEIVM-----------------------------------------
A0A2B8IEH1_BACAN      --LMKRKVFPGYVLVELIM-----------------------------------------
Q81J54_BACCR          --LMKRKVFPGYVLVELIM-----------------------------------------
NUSG_STAA8            --TTVKKTFPGYVLVELIM-----------------------------------------
Q830P6_ENTFA          --EIVHKTFPGYVLVEMIM-----------------------------------------
F9UL82_LACPL          --VEMKKIFPGYVLVEMVM-----------------------------------------
NUSG_STRPQ            --EIEENRFPGYVLVEMVM-----------------------------------------
Q8DNB8_STRR6          --EVEENRFPGYVLVEMVM-----------------------------------------
NUSG_LACLA            --EVEENLFPGYVLVEMNM-----------------------------------------
A5I7L9_CLOBH          --ITLKKTFPGYVLVKMLM-----------------------------------------
Q97EG4_CLOAB          --VTLKKVFPSYVLIKMVM-----------------------------------------
Q2RFN4_MOOTA          --IVKRKVYPGYVMVEMVL-----------------------------------------
A9WFP5_CHLAA          --TVNKKIYPGYVLVQMRL-----------------------------------------
NUSG_MYCTU            --QVNRKVLPGYILVRMDL-----------------------------------------
A0QS44_MYCS2          --QVNRKVLPGYILVRMEL-----------------------------------------
NUSG_STRCO            --TIRQNKLPGYVLVRMDL-----------------------------------------
H7C6D0_CORGL          --LVKRKLLPGYVLVRMDM-----------------------------------------
D1B6U2_THEAS          --RVRRKVFPSYVLVEMIM-----------------------------------------
Q8G4T6_BIFLO          --VITRVRVPGYVLIRMWP-----------------------------------------
NUSG_DEIRA            --NVKRKLFPGYVFVQMDVEDDDAPGE---------------------------------
NUSG_THET8            --VVRKKLFPGYLFIQMDLGDEEEPN----------------------------------
NUSG_SYNY3            --QGEEKIFPGYVLIRMIM-----------------------------------------
Q8DM29_THEEB          --TIEEKVFPGYVLVQVRAQQSPETGEWQ-------------------------------
Q7VDY4_PROMA          --STEEKVFPGYVLVRMIL-----------------------------------------
Q7NMD6_GLOVI          --ASAEKIFPGYVLINMVM-----------------------------------------
B8E0K4_DICTD          --IQVKKVFPGYLFIRMIE-----------------------------------------
NUSG_CAMJE            --ISERSLYSGYVFALLD------------------------------------------
NUSG_HELPY            --VTERSLYPGYVFIKVD------------------------------------------
NUSG_AQUAE            KIVLDNKIFPGYILIKAH------------------------------------------
A6GYU5_FLAPJ          ---KDKVYFSGYVMVEAN------------------------------------------
Q8A464_BACTN          ---KERSYLPGYVLVEAA------------------------------------------
Q2S1Q0_SALRD          ---KEKTFFPGYILLNCT------------------------------------------
Q8KG20_CHLTE          ---LTKNAFPGYVLIEAV------------------------------------------
Q8F0R7_LEPIN          ---TKRKLMPGYVLIEME------------------------------------------
NUSG_ECOLI            ---SERKFFPGYVLVQMV------------------------------------------
Q32AF4_SHIDS          ---SERKFFPGYVLVQMV------------------------------------------
NUSG_SALTY            ---SERKFFPGYVLVQMV------------------------------------------
NUSG_YERPE            ---SERKFFPGYVLVQMV------------------------------------------
NUSG_VIBCH            ---SERKFFPGYVLVQMI------------------------------------------
Q5E230_ALIF1          ---SERKFFPGYVLVQMI------------------------------------------
NUSG_BUCAI            ---SEYKFFPGYVLIQMK------------------------------------------
NUSG_HAEIN            ---SERKFFPGYVLVEME------------------------------------------
Q8EK79_SHEON          ---SERKFFPGYVLVQME------------------------------------------
NUSG_PSEAE            ---SERKFFPGYVLVQME------------------------------------------
C1DKK0_AZOVD          ---SERKFFPGYVLVQME------------------------------------------
E4PLX6_MARAH          ---SERKFYPGYVLVQME------------------------------------------
H9L4N0_XANCP          ---SERKFFPGYVLVQIETHDEAGIP----------------------------------
Q83ET5_COXBU          ---SQRKFFPGYVLVQMV------------------------------------------
NUSG_NEIMB            ---SERKSYPGYVLVEME------------------------------------------
Q5F5R0_NEIG1          ---SERKSYPGYVLVEME------------------------------------------
Q7W0S4_BORPE          ---TERRIFPGYVLVEMD------------------------------------------
Q63PZ8_BURPS          ---TERRFFPGYVLVEME------------------------------------------
Q748Y1_GEOSL          ---SSRKFFPGYILVNME------------------------------------------
Q89J68_BRADU          ---AERKFFPGYVLVKMK------------------------------------------
A9CIF8_AGRFC          ---SERKFFPGYVLVRAN------------------------------------------
Q9A3J9_CAUVC          ---AERKFFPGYVLVKMN------------------------------------------
Q2RQU8_RHORT          ---AERKFFPGYVLVKMD------------------------------------------
Q3J5T5_CERS4          ---SERRFMPGYVLVHME------------------------------------------
Q727D2_DESVH          ---STRKFYPGYVMVKMF------------------------------------------
B5YFW3_THEYD          ---QEKKFYPGYILVEME------------------------------------------
Q1IHG9_KORVE          ---SERMFYPGYVLVEMD------------------------------------------
Q5NID7_FRATT          ---SERKYFPGYVLIEAD------------------------------------------
NUSG_CHLTR            ---VEKYIWPGYLLVKMH------------------------------------------
NUSG_RICPR            ---VEKKLMPSYILIKMN------------------------------------------
NUSG_THEMA            -ETIDRKYTKTYYIPESAGIEPGLRVGTKVKQGLPLSKNEEYICELDGKIVEIERMKKVV
Q8RHI1_FUSNN          -KKVYRKLFPAYVMLEMEATR---------------------------------------
NUSG_BORBU            -RIRERKIWPGYILIELDLPE---------------------------------------
Q7UMY8_RHOBA          --VSKRKLLPGYIMVYMSI-----------------------------------------
Q5FFE4_EHRRG          ---VKRKLSPGYVFLRMNLN----------------------------------------
C0R546_WOLWR          ---TRRKCFPGYVFLYVNLC----------------------------------------
NUSG_MYCPN            VKISEKNLLGRYIYIKMIY-----------------------------------------
NUSG_MYCGE            VKISEKNLLGRYIYIKMIY-----------------------------------------
A0A014LZE0_MYCMC      ----IKNKFPGYIFINMIM-----------------------------------------
Q5ZZQ0_MYCH2          ---KYRNLYKGYFFIKMNM-----------------------------------------
Q9PPQ8_UREPA          TKIKEGNKFNGYIFLKAEM-----------------------------------------
                                 *                                                

NUSG_BACSU            ------------------------------------------------------------
Q8YAA6_LISMO          ------------------------------------------------------------
A0A2B8IEH1_BACAN      ------------------------------------------------------------
Q81J54_BACCR          ------------------------------------------------------------
NUSG_STAA8            ------------------------------------------------------------
Q830P6_ENTFA          ------------------------------------------------------------
F9UL82_LACPL          ------------------------------------------------------------
NUSG_STRPQ            ------------------------------------------------------------
Q8DNB8_STRR6          ------------------------------------------------------------
NUSG_LACLA            ------------------------------------------------------------
A5I7L9_CLOBH          ------------------------------------------------------------
Q97EG4_CLOAB          ------------------------------------------------------------
Q2RFN4_MOOTA          ------------------------------------------------------------
A9WFP5_CHLAA          ------------------------------------------------------------
NUSG_MYCTU            ------------------------------------------------------------
A0QS44_MYCS2          ------------------------------------------------------------
NUSG_STRCO            ------------------------------------------------------------
H7C6D0_CORGL          ------------------------------------------------------------
D1B6U2_THEAS          ------------------------------------------------------------
Q8G4T6_BIFLO          ------------------------------------------------------------
NUSG_DEIRA            ------------------------------------------------------------
NUSG_THET8            ------------------------------------------------------------
NUSG_SYNY3            ------------------------------------------------------------
Q8DM29_THEEB          ------------------------------------------------------------
Q7VDY4_PROMA          ------------------------------------------------------------
Q7NMD6_GLOVI          ------------------------------------------------------------
B8E0K4_DICTD          ------------------------------------------------------------
NUSG_CAMJE            ------------------------------------------------------------
NUSG_HELPY            ------------------------------------------------------------
NUSG_AQUAE            ------------------------------------------------------------
A6GYU5_FLAPJ          ------------------------------------------------------------
Q8A464_BACTN          ------------------------------------------------------------
Q2S1Q0_SALRD          ------------------------------------------------------------
Q8KG20_CHLTE          ------------------------------------------------------------
Q8F0R7_LEPIN          ------------------------------------------------------------
NUSG_ECOLI            ------------------------------------------------------------
Q32AF4_SHIDS          ------------------------------------------------------------
NUSG_SALTY            ------------------------------------------------------------
NUSG_YERPE            ------------------------------------------------------------
NUSG_VIBCH            ------------------------------------------------------------
Q5E230_ALIF1          ------------------------------------------------------------
NUSG_BUCAI            ------------------------------------------------------------
NUSG_HAEIN            ------------------------------------------------------------
Q8EK79_SHEON          ------------------------------------------------------------
NUSG_PSEAE            ------------------------------------------------------------
C1DKK0_AZOVD          ------------------------------------------------------------
E4PLX6_MARAH          ------------------------------------------------------------
H9L4N0_XANCP          ------------------------------------------------------------
Q83ET5_COXBU          ------------------------------------------------------------
NUSG_NEIMB            ------------------------------------------------------------
Q5F5R0_NEIG1          ------------------------------------------------------------
Q7W0S4_BORPE          ------------------------------------------------------------
Q63PZ8_BURPS          ------------------------------------------------------------
Q748Y1_GEOSL          ------------------------------------------------------------
Q89J68_BRADU          ------------------------------------------------------------
A9CIF8_AGRFC          ------------------------------------------------------------
Q9A3J9_CAUVC          ------------------------------------------------------------
Q2RQU8_RHORT          ------------------------------------------------------------
Q3J5T5_CERS4          ------------------------------------------------------------
Q727D2_DESVH          ------------------------------------------------------------
B5YFW3_THEYD          ------------------------------------------------------------
Q1IHG9_KORVE          ------------------------------------------------------------
Q5NID7_FRATT          ------------------------------------------------------------
NUSG_CHLTR            ------------------------------------------------------------
NUSG_RICPR            ------------------------------------------------------------
NUSG_THEMA            VQTPDGEQDVYYIPLDVFDRDRIKKGKEVKQGEMLAEARKFFAKVSGRVEVVDYSTRKEI
Q8RHI1_FUSNN          --------------------------EENENG----------------------------
NUSG_BORBU            ------------------------------------------------------------
Q7UMY8_RHOBA          ------------------------------------------------------------
Q5FFE4_EHRRG          ------------------------------------------------------------
C0R546_WOLWR          ------------------------------------------------------------
NUSG_MYCPN            ------------------------------------------------------------
NUSG_MYCGE            ------------------------------------------------------------
A0A014LZE0_MYCMC      ------------------------------------------------------------
Q5ZZQ0_MYCH2          ------------------------------------------------------------
Q9PPQ8_UREPA          ------------------------------------------------------------
                                                                                  

NUSG_BACSU            ---------------------TDDSWYVVRNTPGVTGFVGSAGS--------GSKPTPLL
Q8YAA6_LISMO          ---------------------TDDSWYVVRNTPGVTGFVGSAGS--------GSKPTPLL
A0A2B8IEH1_BACAN      ---------------------TDDSWYVVRNTPGVTGFVGSSGS--------GSKPSPLL
Q81J54_BACCR          ---------------------TDDSWYVVRNTPGVTGFVGSSGS--------GSKPSPLL
NUSG_STAA8            ---------------------TDESWYVVRNTPGVTGFVGSAGA--------GSKPNPLL
Q830P6_ENTFA          ---------------------TDDSWYIVRNTPGVTGFVGSHGA--------GSKPAPLL
F9UL82_LACPL          ---------------------TDQAWYIVRNTPGVTGFLGSHGQ--------GSKPTPLL
NUSG_STRPQ            ---------------------TDEAWFVVRNTPNVTGFVGSHGN--------RSKPTPLL
Q8DNB8_STRR6          ---------------------TDEAWFVVRNTPNVTGFVGSHGN--------RSKPTPLL
NUSG_LACLA            ---------------------TDEAWFIVRNTPNVTGFVGSHGN--------RSKPTPLF
A5I7L9_CLOBH          ---------------------TDDSWYIVRNTRGVTGFVGP-----------GSKPVPLT
Q97EG4_CLOAB          ---------------------TDESWYVVRNTRGCTGFVGP-----------GSKPVPLT
Q2RFN4_MOOTA          ---------------------TDASWYVVRNTPGVTGFVGT-----------GNKPIPLR
A9WFP5_CHLAA          ---------------------TDDSWYVVRNTPGVTSFVGH-----------GNKPTPLD
NUSG_MYCTU            ---------------------TDDSWAAVRNTPGVTGFVGA-----------TSRPSALA
A0QS44_MYCS2          ---------------------NDESWGAVRNTPGVTGFVGA-----------TSRPSPLS
NUSG_STRCO            ---------------------TNESWGVVRNTPGVTGFVGN-----------AYDPYPLT
H7C6D0_CORGL          ---------------------NDRVWSVVRDTPGVTSFVGN-----------EGNATPVK
D1B6U2_THEAS          ---------------------DDQSWYVVRHTPGVTGFVGS-----------GNHPIPLT
Q8G4T6_BIFLO          ---------------------DENARRIVRETEGVTGFVGP-----------TKDPAPLS
NUSG_DEIRA            ---------------------LGESWEVVRGTSGVTGFVGTATR-----------PVPLS
NUSG_THET8            -----------------------EAWEVVRGTPGITGFVGAGMR-----------PVPLS
NUSG_SYNY3            ---------------------DDDAWQVVKNTPHVINFVGSEQKRHYGRGRGHVLPMPLS
Q8DM29_THEEB          --------------------IDDEAWQVIKNTPNVINFVGAEQRRSTGRGRGHVKPMPLS
Q7VDY4_PROMA          ---------------------DEDTMMAVRSTPNVINFVGAEDRRITGRGRGHIKPRPLS
Q7NMD6_GLOVI          ---------------------DDESWQVVKNTPNVINFVGTEERRRYGRGRGHVTPRPLG
B8E0K4_DICTD          ---------------------DEDVIRMIRNTTGVTGFVGTP-----------GRPSTLN
NUSG_CAMJE            --------------------LNTELWHRIQSLPKVGRFIG-----------ESKKPTPLT
NUSG_HELPY            --------------------LDTVLWHKIQSLPRVSRFIG-----------ENKKPTPLS
NUSG_AQUAE            --------------------MNDKLLMAIEKTPHVFRPVM-----------VGGKPVPLK
A6GYU5_FLAPJ          --------------------LAGEITHIIKSITSVIGFLGET---------KNGDPVPLR
Q8A464_BACTN          --------------------LVGEVAHHLRNTPNVIGFLGGS---------EK--PVPLR
Q2S1Q0_SALRD          --------------------LTSDLRDLAEDLPSVIGFLTTG---------TGDEPTQLR
Q8KG20_CHLTE          --------------------LDKQTRNLIMDIPSVMGFL--G---------VDDNPTPLR
Q8F0R7_LEPIN          --------------------MDDDTRFLIQSLPSVSTFVG-S---------KDGGPEPLS
NUSG_ECOLI            --------------------MNDASWHLVRSVPRVMGFIGG----------TSDRPAPIS
Q32AF4_SHIDS          --------------------MNDASWHLVRSVPRVMGFIGG----------TSDRPAPIS
NUSG_SALTY            --------------------MNDASWHLVRSVPRVMGFIGG----------TSDRPAPIS
NUSG_YERPE            --------------------MNDASWHLVRSVPRVMGFIGG----------TSDRPAPIS
NUSG_VIBCH            --------------------MNDESWHLVRSVPRVMGFIGG----------TSDRPAPIT
Q5E230_ALIF1          --------------------MNDESWHLVRSIPRVMGFIGG----------TSDRPAPIT
NUSG_BUCAI            --------------------MTDSTWHLIRNVPKVLGFIGG----------KSDKPSPIS
NUSG_HAEIN            --------------------MNDETWHLVKSVPRVMGFIGG----------TPDKPAPIS
Q8EK79_SHEON          --------------------MNDDSWHLVKSIPRVLGFIGG----------TSDRPAPIS
NUSG_PSEAE            --------------------MNEGTWHLVKDTPRVMGFIGG----------TADKPAPIT
C1DKK0_AZOVD          --------------------MNEATWHLIKDTPRVMGFIGG----------TADKPAPIT
E4PLX6_MARAH          --------------------MDDATWHLVKNTPRVLGFIGG----------TKDKPAPIT
H9L4N0_XANCP          -------------------RIDNESWHLVKETPKVMGFIGG----------TADRPLPIR
Q83ET5_COXBU          --------------------MNDKTSDLVRSIPQVVRFIGG-----------------IT
NUSG_NEIMB            --------------------MTDDSWHLVKSTPRVSGFIGG----------RANRPTPIS
Q5F5R0_NEIG1          --------------------MTDDSWHLVKSTPRVSGFIGG----------RANRPTPIS
Q7W0S4_BORPE          --------------------LTDETWHLVKNTNRVTGFLGG----------SGNRPTPIS
Q63PZ8_BURPS          --------------------MTDETWHLVKNTAKVTGFVGG----------ARNRPSPIS
Q748Y1_GEOSL          --------------------LNDETWHVVKETSKVTGFVGG------------NNPFAIP
Q89J68_BRADU          --------------------LTDEAFHLIKNTPKVTGFLGA----------E-NKPMPIS
A9CIF8_AGRFC          --------------------LTDEAYHLIKNTPKVTGFLGS----------D-SKPVPIP
Q9A3J9_CAUVC          --------------------LSDEAYHLIKNTPKVTGFLGS----------G-SKPMPVS
Q2RQU8_RHORT          --------------------LSDETWHLVKNTAKVTGFLGG----------R-GRPSPIS
Q3J5T5_CERS4          --------------------MSNRGYHLISSINRVTGFLGP----------Q-GKPMPMR
Q727D2_DESVH          --------------------MTDFSWHLVQSIPKVTGFVGG----------K-NRPTPMR
B5YFW3_THEYD          --------------------LNDDTWHLISTTQRVTGFVG------------GKKPAPIP
Q1IHG9_KORVE          --------------------MDDNVWHVVKSTPRVTGFVGT-----------GQQPTPLS
Q5NID7_FRATT          --------------------LSTDAWNLVKSVPRVLTVVGS----------K-GKPIPLS
NUSG_CHLTR            --------------------LTDESWSYVKKTQGVVEFLGG----------G--APVALS
NUSG_RICPR            --------------------MTDKSWHLVKNIPGVTGFLGS----------KI-VPKALT
NUSG_THEMA            RIYKTKRRKLFPGYVFVEMIMNDEAYNFVRSVPYVMGFVSS-----------GGQPVPVK
Q8RHI1_FUSNN          ----------------ISYKVDPRVWYEVRNTNGVTGFVGV-----------GSDPIPME
NUSG_BORBU            -------------------VGWKDIIANIIKVQGVINFVGVS---------KGQRPIPIN
Q7UMY8_RHOBA          ---------------------NDDTWFLVREVGGISDFTGSAG-----------KPQPME
Q5FFE4_EHRRG          ----------------------EDSINFVRSIPKVLN---FLNNDF-------GTPKVIS
C0R546_WOLWR          ----------------------DEVLNFINSIPKSLKVYGFLKNG--------NIPKVIL
NUSG_MYCPN            ---------------------SEDAWRIIRNFPGITGIVGSSGR--------GALPTPLD
NUSG_MYCGE            ---------------------SEDAWRIVRNFPGITGIVGSSGR--------GALPIPLD
A0A014LZE0_MYCMC      ---------------------SEKAWFLIRNTPGVTGFIGSSGR--------GAKPSPLT
Q5ZZQ0_MYCH2          ---------------------VDKAWFVVRNTQYVTGLVGSHGR--------GTKPTPIS
Q9PPQ8_UREPA          ---------------------TDQIWFLIRNTQMVTGLVGSSGK--------NVKPIPVP
                                                                                : 

NUSG_BACSU            PGEAETILKRMGMDER--------------------------------------------
Q8YAA6_LISMO          PEEADRILKSMGMVEK--------------------------------------------
A0A2B8IEH1_BACAN      EEEVVTIMKHMGMDNE--------------------------------------------
Q81J54_BACCR          EEEVVTIMKHMGMDNE--------------------------------------------
NUSG_STAA8            PEEVRFILKQMGLKEK--------------------------------------------
Q830P6_ENTFA          QEEINHILRSIGMSTR--------------------------------------------
F9UL82_LACPL          PEEAEQILHQLGMSAR--------------------------------------------
NUSG_STRPQ            EEEIRAILLSMGQTID--------------------------------------------
Q8DNB8_STRR6          EQEIRDILVSMGQTVQ--------------------------------------------
NUSG_LACLA            EQEIQDILVGMGKVVR--------------------------------------------
A5I7L9_CLOBH          EEEV----LSMGIKEK--------------------------------------------
Q97EG4_CLOAB          DDEV----KSMGIREK--------------------------------------------
Q2RFN4_MOOTA          EEEVDQILQQMGVEEP--------------------------------------------
A9WFP5_CHLAA          DEEVKAILRQMEGETP--------------------------------------------
NUSG_MYCTU            LDDVVKFLLPRGSTRKAAKGAASTA---AAAEAGG-------------------------
A0QS44_MYCS2          LDDVVKFLLPQGAAKKPGKAAAAAA---SAASTEA-------------------------
NUSG_STRCO            LDEIVKMLAPEAEEKAAREAAEAEG---KPAPQRK-------------------------
H7C6D0_CORGL          HRDVAKFLMPQEQAVVTGEAAAAAAEGEQVVAMPT-------------------------
D1B6U2_THEAS          DREVAEVMGKIGLPADR-------------------------------------------
Q8G4T6_BIFLO          RKEVVAMMAPMIASEALKAAGD----------KPA-------------------------
NUSG_DEIRA            PEEVQRLLTSVGVAAQPVV-----------------------------------------
NUSG_THET8            PDEVRHILEVSGLLGK--------------------------------------------
NUSG_SYNY3            HGEVERIFRHVD------------------------------------------------
Q8DM29_THEEB          PAEVERIFRKAQ------------------------------------------------
Q7VDY4_PROMA          RQEVNRIFKRAA------------------------------------------------
Q7NMD6_GLOVI          SAEVNRIFRAAE------------------------------------------------
B8E0K4_DICTD          PQEEHWIRRFLEQKEI--------------------------------------------
NUSG_CAMJE            EKDINLILEKVHNRAAPK------------------------------------------
NUSG_HELPY            EADIGHILEKMNNRAAPK------------------------------------------
NUSG_AQUAE            EEEVQNILNQIKRGVKP-------------------------------------------
A6GYU5_FLAPJ          IAEVNRMLGKV-DELAVTA-----------------------------------------
Q8A464_BACTN          QSEVNRILGTV-DELQETG-----------------------------------------
Q2S1Q0_SALRD          EEEIKRILGKM-DRAEEMG-----------------------------------------
Q8KG20_CHLTE          PDEVEKILVP--GGAIEHR-----------------------------------------
Q8F0R7_LEPIN          LEEVKNLFSESGDVASEEP-----------------------------------------
NUSG_ECOLI            DKEVDAIMNRLQ--QVGDK-----------------------------------------
Q32AF4_SHIDS          DKEVDAIMNRLQ--QVGDK-----------------------------------------
NUSG_SALTY            DKEVDAIMNRLQ--QVGDK-----------------------------------------
NUSG_YERPE            DKEVDAIMNRLQ--QVGDK-----------------------------------------
NUSG_VIBCH            DKEADAILNRLE--KASEA-----------------------------------------
Q5E230_ALIF1          DKEADAILNRLE--QASEA-----------------------------------------
NUSG_BUCAI            DKEVEIIINRLR--KIGNK-----------------------------------------
NUSG_HAEIN            KREADTILNRLE--QNTDK-----------------------------------------
Q8EK79_SHEON          DREADAILRRLQ--ETTAS-----------------------------------------
NUSG_PSEAE            DREADAILRRVA--DSGDK-----------------------------------------
C1DKK0_AZOVD          DKEAEAILRRVA--DSGDR-----------------------------------------
E4PLX6_MARAH          EKEAEAILRRVE--SGADK-----------------------------------------
H9L4N0_XANCP          DEEADAILQRVQ--DGVEK-----------------------------------------
Q83ET5_COXBU          DKDAAQILRRVE--EGETK-----------------------------------------
NUSG_NEIMB            QREAEIILQQVQ--TGIEK-----------------------------------------
Q5F5R0_NEIG1          QREAEIILQQVQ--TGIEK-----------------------------------------
Q7W0S4_BORPE          EREVEKILNQME--EGVEK-----------------------------------------
Q63PZ8_BURPS          PREVEKIMSQMQ--EGVEK-----------------------------------------
Q748Y1_GEOSL          DEEVAKITRRME--EGAEK-----------------------------------------
Q89J68_BRADU          EAEAMRILHQVQ--EGVER-----------------------------------------
A9CIF8_AGRFC          DYEADRILGQVQ--EGVER-----------------------------------------
Q9A3J9_CAUVC          EKEVQRIIGTIE--EGVAA-----------------------------------------
Q2RQU8_RHORT          DREAERILHQVQ--EGIER-----------------------------------------
Q3J5T5_CERS4          DSEVNTILNRVE--EGEAQ-----------------------------------------
Q727D2_DESVH          DSEAERILAMME--SRQEQ-----------------------------------------
B5YFW3_THEYD          QEEVEMILQQLE--KGR-A-----------------------------------------
Q1IHG9_KORVE          EEEVQQIVYRVA--DSREK-----------------------------------------
Q5NID7_FRATT          KAEVDRILDFVEGSKSTVE-----------------------------------------
NUSG_CHLTR            EEEVKNILADLE--EKKSG-----------------------------------------
NUSG_RICPR            ESEIQNIFNNLE--AEAKV-----------------------------------------
NUSG_THEMA            DREMRPILRLAGLEEYEEKKKP--------------------------------------
Q8RHI1_FUSNN          EEEVKNIFNIIGVKTPKEN-----------------------------------------
NUSG_BORBU            DEEVKSVFMLTGEIKANKS-----------------------------------------
Q7UMY8_RHOBA          PEDVERFINRPAVDDEDET-----------------------------------------
Q5FFE4_EHRRG          DSEMESMRKKMCQSVVDDT-----------------------------------------
C0R546_WOLWR          DDEIHSMCNALYNAQETKK-----------------------------------------
NUSG_MYCPN            QADADNLEQMLKGISVNPKKRVLVTNTAIVEMDADKFDEKCQYILKHKQVKPEAIAQVNE
NUSG_MYCGE            EKDANNLEQMLKGISINPSKRIMLTNTAIIEMDSDKFDEKFQYILKQKQAIQKP--KEDE
A0A014LZE0_MYCMC      TEETLNMLVPNLEEIEQAHEQEQQEENLKNEAVNK-------------------------
Q5ZZQ0_MYCH2          PRQFERMRKKWDQQILNFQ-----------------------------------------
Q9PPQ8_UREPA          EDKILKLIADNDAKRALISLNEKVDHEENIEVIELHE-----------------------
                        .                                                         

NUSG_BACSU            --------------------------KTDIDFELKETVKVIDGPFANFTGSIEEIDYDKS
Q8YAA6_LISMO          --------------------------RAEADFEIGETVMVKEGPFADFSGKVDEMDNDKG
A0A2B8IEH1_BACAN      --------------------------VVDFDFELHETVRVNEGPFADYTGAIEEIDVEKK
Q81J54_BACCR          --------------------------VVDFDFELHETVRVNEGPFADYTGAIEEIDVEKK
NUSG_STAA8            --------------------------TIDVELEVGEQVRIKSGPFANQVGEVQEIETDKF
Q830P6_ENTFA          --------------------------QSDLEVALGDTVKIIEGAFSGLEGVVTEIDEEKQ
F9UL82_LACPL          --------------------------HTELDVEVGEQVTIIDGAFSGLSGEITEIDNEKM
NUSG_STRPQ            --------------------------VFDTNIKEGDVVQIIDGAFMGQEGRVVEIENN--
Q8DNB8_STRR6          --------------------------EFDFDVEIGQTVRIIDGAFADYTGKITEIDNN--
NUSG_LACLA            --------------------------EIDFDVFVGKRVRIVDGAFSGFEAPITEINGD--
A5I7L9_CLOBH          --------------------------QPEVDVEVGENVKVVSGPLEGFPATIQEINVEKG
Q97EG4_CLOAB          --------------------------VASIDIVVGENVKVISGPLMDQVALIQEINLEKG
Q2RFN4_MOOTA          --------------------------RPRIDVTVGENVRVTSGPFENFIGSIEEIMPDKG
A9WFP5_CHLAA          --------------------------KVRVSYQKGQAVKIIDGPFTDFEGIVDAIDHERG
NUSG_MYCTU            ----------------------LERPVVEVDYEVGESVTVMDGPFATLPATISEVNAEQQ
A0QS44_MYCS2          ---------------------TLERPEILVDFEVGESVTVMDGPFATLPASISEVNAEQQ
NUSG_STRCO            ------------------------VEVQVLDFEVGDSVTVTDGPFATLQATINEINADSK
H7C6D0_CORGL          ---------------------DTKKPQVAVDFTVGEAVTILTGAFASVSATISSIDPELQ
D1B6U2_THEAS          ------------------------KPKVELDIEVGDTVRVKSGPFEGCVGPVVEVDPDKG
Q8G4T6_BIFLO          ---------------------AAKKRRVEVSYAVGDQVTVTDGPFATMAAVVSDVEPTTQ
NUSG_DEIRA            ----------------------EEAPRIKVDLKAGDMVRVTSGPFADFSGVVSEVNAPQA
NUSG_THET8            ----------------------KEAPKAQVAFREGDQVRVVSGPFADFTGTVTEINPERG
NUSG_SYNY3            ----------------------EQEPVVKIDMEIGDHIMVLSGPFKDFEGDVIEVSPERS
Q8DM29_THEEB          ----------------------EQEPVHRIDLNSGDKIKVLNGPFKDFEGEVIEVSAERS
Q7VDY4_PROMA          ----------------------EKKTVVKLDLSEGDQILVTAGPFKDFQGEVIEVSGERN
Q7NMD6_GLOVI          ----------------------QEEPVIKVDLEPGHKIEVTAGPFQDFNGEVVEVNPERG
B8E0K4_DICTD          --------------------------RPELKVKKGDRVYIKSGPFMGYEGFVDEVYPEKG
NUSG_CAMJE            ---------------------------PKISFEEGENVRITEGPFANFTAIVEEYDMVRG
NUSG_HELPY            ---------------------------PKIFFEQGEVVRVVEGPFANFTATVEEYDVEHR
NUSG_AQUAE            ---------------------------SKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKR
A6GYU5_FLAPJ          -------------------------DHGSIPFTVGETVKVTDGPFNGFNGTVEKINEEKR
Q8A464_BACTN          -------------------------EELNIPYVVGETVKVTFGPFSGFSGIIEEVNSEKK
Q2S1Q0_SALRD          -------------------------EQPEMPFKVGDPVKVVDGPFDSFNGIVEDVYPDQM
Q8KG20_CHLTE          -------------------------AVVEAPFKVGDSVKVIDGPFSSLTGIVHEVCTERM
Q8F0R7_LEPIN          -------------------------VAPKILFKVGDSLKIIDGPFANFTGLVDEIFPDKG
NUSG_ECOLI            -------------------------PRPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKS
Q32AF4_SHIDS          -------------------------PRPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKS
NUSG_SALTY            -------------------------PRPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKS
NUSG_YERPE            -------------------------PRPKTLFEPGELVRVSDGPFADFNGVVEEVDYEKS
NUSG_VIBCH            -------------------------PRPKTMFEAGEVVRVNDGPFADFNGTVEEVDYEKS
Q5E230_ALIF1          -------------------------PRPKTLFEAGEVVRVTEGPFADFNGTVEEVDYEKS
NUSG_BUCAI            -------------------------PRPKTLFEPGEMIRVNDGPFADFNGVVEEVDYEKS
NUSG_HAEIN            -------------------------PRHRNEYHPGEEVRVTEGPFADFNGTVEEVDYEKG
Q8EK79_SHEON          -------------------------PTHRVIFEPGEVVRVCDGPFADFNGTVEEVDYDKS
NUSG_PSEAE            -------------------------PKPKTLFEPGETVRVIDGPFADFNGVVEEVNYEKS
C1DKK0_AZOVD          -------------------------PKPKTLFEPGEVVRVIDGPFADFNGVVEEVNYEKS
E4PLX6_MARAH          -------------------------PKPKTLFEPGEIVRVVEGPFADFNGVVEEVDYDKS
H9L4N0_XANCP          -------------------------PRPKVLFEPGQMVRVTDGPFNDFNGVVEEVNYEKS
Q83ET5_COXBU          -------------------------PKPKVLFEPGEVVRVIEGPFADFNGVVEDVNYEKN
NUSG_NEIMB            -------------------------PKPKVEFEVGQQVRVNEGPFADFNGVVEEVNYERN
Q5F5R0_NEIG1          -------------------------PKPKVEFEVGQQVRVNEGPFADFNGVVEEVNYERN
Q7W0S4_BORPE          -------------------------PRPKILFEVGEMVRVKEGPFADFNGNVEEVNYEKS
Q63PZ8_BURPS          -------------------------PRPKTLFEVGEMVRVKEGPFTDFNGTVEEVNYEKS
Q748Y1_GEOSL          -------------------------PRPKVEFEVGETVRVVDGPFLNFAGVVEDVKPDKG
Q89J68_BRADU          -------------------------PKASVSFEIGENVRVADGPFASFSGVVEEIDEARS
A9CIF8_AGRFC          -------------------------PKSSVSFEIGEQVRVSDGPFASFNGVVQDVDEERS
Q9A3J9_CAUVC          -------------------------PKAVVLYEVGENVRVTDGPFASFNGSVEYVDEEKA
Q2RQU8_RHORT          -------------------------PKPSITFDVGEQVRVCDGPFTSFNGMVEDVDEEKA
Q3J5T5_CERS4          -------------------------PRSLIRYDIGETVKVTDGPFEGFSGMVEDVDEEHS
Q727D2_DESVH          -------------------------PRPKFNFDRGDEVRVIDGPFGGFNGVVEDVNYDKG
B5YFW3_THEYD          -------------------------PQIKAHFEKGETVRITDGPFTNFTGYIDEVDSEHE
Q1IHG9_KORVE          -------------------------PKLKVKYEKNETVRISEGPFATFQGVVDEVNEDKE
Q5NID7_FRATT          -------------------------PRLRKSYHVGEVVRVLEGPFNDFTGVIEEVNYEKS
NUSG_CHLTR            -------------------------VVQKHKFEVGSQVKINDGVFVNFVGVVSEVFHDKG
NUSG_RICPR            -------------------------AKNSKLYEVGEIVTVTDGPFETFMGTVEAIDKARN
NUSG_THEMA            -------------------------VKVELGFKVGDMVKIISGPFEDFAGVIKEIDPERQ
Q8RHI1_FUSNN          ---------------------------VKIDFTEGDYVKILKGSFKDQEGQVAEIDHEHG
NUSG_BORBU            -------------------------IFMLYDFEEGERVRIKGGPFDSFEGLISSIDYERK
Q7UMY8_RHOBA          ------------------------PIKTAIPFKVGDRVRVKEGNFENQEGEVDVVDEANG
Q5FFE4_EHRRG          ---------------------------NVVNFDIGDEVVINDGLFQDFNGKVEYINEDKK
C0R546_WOLWR          ---------------------------LGYGYEKGEKVKINDGLFQNFTGKVNMVNDEKK
NUSG_MYCPN            SGEIIDTNQFAQALMEA-NKAEQDEWNEDVAIVKSEANKVDPSVLIPYLGKYEIVEGDTK
NUSG_MYCGE            DSEIVDAEKLKEAFKKLQNSQEQDEWKEKATIIQSEQTKLDPSVLVPFLGKYEILDTDNK
A0A014LZE0_MYCMC      ------------------------KELFTANFKVGDVVRVKSGIHENEEGTVKDMDFSKG
Q5ZZQ0_MYCH2          -----------------------QTNDGTINWEIGDWVKVTHGPFSDDFGKIIEMNETKT
Q9PPQ8_UREPA          -------------------------DENFTNFEVDQEVKIIADTFFGEIAKIAKIDQNKK
                                                             :  .      .          

NUSG_BACSU            KVKVFV-NMFGRETPVE-LEFTQIDKL---------------------------------
Q8YAA6_LISMO          KAKVMV-NMFGRETPVE-VDFNQIEKL---------------------------------
A0A2B8IEH1_BACAN      KVSVLV-DMFGRETPVE-LDFHQIEKL---------------------------------
Q81J54_BACCR          KVSVLV-DMFGRETPVE-LDFHQIEKL---------------------------------
NUSG_STAA8            KLTVLV-DMFGRETPVE-VEFDQIEKL---------------------------------
Q830P6_ENTFA          KLKVNI-DMFGRETSTE-LDFEQVDNID--------------------------------
F9UL82_LACPL          KLKVNI-NMFGRETSTE-LDFDQVDQIR--------------------------------
NUSG_STRPQ            KVKLML-NMFGSETVAE-VELYQIAEL---------------------------------
Q8DNB8_STRR6          KVKMII-SMFGNDTVAE-VNLNQIAEL---------------------------------
NUSG_LACLA            KLTLTV-DMFGRATPVE-LDMHQIEDIQA-------------------------------
A5I7L9_CLOBH          KIKALV-NMFGRETPVE-LDFNQIEKLD--------------------------------
Q97EG4_CLOAB          KLKGLV-NMFGRETPVE-LDFNQIEKLD--------------------------------
Q2RFN4_MOOTA          KLRVLV-SMFGRETPIE-LDFNQIEKIG--------------------------------
A9WFP5_CHLAA          RVRVLV-SFFGREAPVE-LDFLQVTRLVE-------------------------------
NUSG_MYCTU            KLKVLV-SIFGRETPVE-LTFGQVSKI---------------------------------
A0QS44_MYCS2          KLKVLV-SIFGRETPVE-LTFNQVAKI---------------------------------
NUSG_STRCO            KVKGLV-EIFGRETPVE-LSFDQIQKN---------------------------------
H7C6D0_CORGL          KLEVLV-SIFGRETPVD-LSFDQVEKVS--------------------------------
D1B6U2_THEAS          RVRFSV-TVFGRETVAE-AGHEDLEKVL--------------------------------
Q8G4T6_BIFLO          KLTVLV-SIFGRDTPVE-LGFHQVQKLD--------------------------------
NUSG_DEIRA            KVKVLV-SIFGRETPVE-LDFSQVAK----------------------------------
NUSG_THET8            KVKVMV-TIFGRETPVE-LDFSQVVKA---------------------------------
NUSG_SYNY3            KLKALL-SIFGRETPVE-LEFTQVEKQN--------------------------------
Q8DM29_THEEB          KLKALL-SIFGRETPVE-LEVTQVEKVD--------------------------------
Q7VDY4_PROMA          KLKALL-SIFGRETPVE-LEFSQISKQN--------------------------------
Q7NMD6_GLOVI          TLKALI-SIFGRDTPVE-LGFNQVRRLDE-------------------------------
B8E0K4_DICTD          TVRVLL-SIFGRETPTE-IDHTQVEKTD--------------------------------
NUSG_CAMJE            LLKLNV-SIFGRSTPVE-ILYSQVEKII--------------------------------
NUSG_HELPY            KLKLNV-SIFGRNTPIE-ILHSQVEKII--------------------------------
NUSG_AQUAE            KLTVMI-SIFGRMTPVE-LDFDQVEKI---------------------------------
A6GYU5_FLAPJ          KLEVMV-KIFGRKTPLE-LSFMQVEKV---------------------------------
Q8A464_BACTN          KLKVMV-KIFGRKTPLE-LGFMQVEKE---------------------------------
Q2S1Q0_SALRD          KVKVMV-SIFGRKTPVE-LDYLQVEHEE--------------------------------
Q8KG20_CHLTE          KVKVMI-NFFGRSTPTE-LDFSQVKPVSQ-------------------------------
Q8F0R7_LEPIN          RLRVKV-EIFGRSTPVE-LDYLQVKTEN--------------------------------
NUSG_ECOLI            RLKVSV-SIFGRATPVE-LDFSQVEKA---------------------------------
Q32AF4_SHIDS          RLKVSV-SIFGRATPVE-LDFSQVEKA---------------------------------
NUSG_SALTY            RLKVSV-SIFGRATPVE-LDFSQVEKA---------------------------------
NUSG_YERPE            RLKVSV-SIFGRATPVE-LDFSQVEKG---------------------------------
NUSG_VIBCH            RLKVSV-SIFGRATPVE-LEFGQVEKLD--------------------------------
Q5E230_ALIF1          RLKVSV-SIFGRATPVE-LEFSQVEKN---------------------------------
NUSG_BUCAI            RLKVSV-SIFGRSTPVE-LDFRQVEKN---------------------------------
NUSG_HAEIN            RLKVSV-SMFGRATPVE-LEFGQVEKIH--------------------------------
Q8EK79_SHEON          RVKVSV-MIFGRSTPVE-LDFSQVEKG---------------------------------
NUSG_PSEAE            RIQVAV-LIFGRSTPVE-LEFSQVEKV---------------------------------
C1DKK0_AZOVD          RIQVAV-LIFGRSTPVE-LEFSQVEKA---------------------------------
E4PLX6_MARAH          RVKVAV-LIFGRSTPVE-LEFGQVEKD---------------------------------
H9L4N0_XANCP          RLRVAV-LIFGRSTPVE-LEFGQVEKG---------------------------------
Q83ET5_COXBU          RLRVSV-LIFGRSTPVE-LEFGQVEKS---------------------------------
NUSG_NEIMB            KLRVSV-QIFGRETPVE-LEFSQVEKIN--------------------------------
Q5F5R0_NEIG1          KLRVSV-QIFGRETPVE-LEFSQVEKIN--------------------------------
Q7W0S4_BORPE          KVRVSV-TIFGRATPVE-LDFSQVEKT---------------------------------
Q63PZ8_BURPS          RVRVSV-TIFGRATPVE-LEFGQVEKV---------------------------------
Q748Y1_GEOSL          KLRVMV-SIFGRATPVE-LEFMQVEKQ---------------------------------
Q89J68_BRADU          RVKVAV-SIFGRATPVE-LEFGQVEKV---------------------------------
A9CIF8_AGRFC          RLKVEV-SIFGRATPVE-LEYNQVEKV---------------------------------
Q9A3J9_CAUVC          RLRVTV-SIFGRATPVE-LEYNQVEKIA--------------------------------
Q2RQU8_RHORT          RLKVSV-SIFGRSTPVE-LEYSQVEKV---------------------------------
Q3J5T5_CERS4          RLKVTV-SIFGRATPVE-LEFTQVAKGA--------------------------------
Q727D2_DESVH          KLRVSV-SIFGRQTPVE-LDFVQVSKG---------------------------------
B5YFW3_THEYD          RVKVMV-SIFGRQTPVE-LAFSQVEKV---------------------------------
Q1IHG9_KORVE          TLKVMV-TIFGRSTPVE-LEFGQVEKVLT-------------------------------
Q5NID7_FRATT          RLRVAV-SIFGRSTPVE-LEFSQVEKES--------------------------------
NUSG_CHLTR            RLSVMV-SIFGRETRVDDLEFWQVEEVVPGQESE--------------------------
NUSG_RICPR            RLKVSV-SIFGKATPIE-LNFNQVKKSD--------------------------------
NUSG_THEMA            ELKVNV-TIFGRETPVV-LHVSEVEKIE--------------------------------
Q8RHI1_FUSNN          RVKVMV-DIFGRMTPVE-IEVDGVLKV---------------------------------
NUSG_BORBU            KLKVAV-QIFGRSTPVE-VDFQHIEKI---------------------------------
Q7UMY8_RHOBA          RVTVII-NIFGRSVPME-LDHWQVEPL---------------------------------
Q5FFE4_EHRRG          IAGVSV-MIFGRLTKIE-FKLEHIQKVEG-------------------------------
C0R546_WOLWR          IINVEV-SILGKPTIIE-LDLAQVEKIED-------------------------------
NUSG_MYCPN            VDQLQQ-FSVGNLVEVHLTGAIHIQGQIKALYQGTINKAVVEVELTTKTQLINLPLENLS
NUSG_MYCGE            VEQLFE-FSVGNLVEVHLTDTIHVQGQIKALYQGTVNKAVVEIELTSKTQLINLPLENLS
A0A014LZE0_MYCMC      VAFVAI-EMFGRWTTLE-VSFKNVEPIKEY------------------------------
Q5ZZQ0_MYCH2          LITVELESVFGRRTPAT-FEYKNLKKVDK-------------------------------
Q9PPQ8_UREPA          IATVEF-EFFGRINTLD-LNFNDIQLYDEESDKLEN------------------------
                               .*            :                                    

NUSG_BACSU            --------
Q8YAA6_LISMO          --------
A0A2B8IEH1_BACAN      --------
Q81J54_BACCR          --------
NUSG_STAA8            --------
Q830P6_ENTFA          --------
F9UL82_LACPL          --------
NUSG_STRPQ            --------
Q8DNB8_STRR6          --------
NUSG_LACLA            --------
A5I7L9_CLOBH          --------
Q97EG4_CLOAB          --------
Q2RFN4_MOOTA          --------
A9WFP5_CHLAA          --------
NUSG_MYCTU            --------
A0QS44_MYCS2          --------
NUSG_STRCO            --------
H7C6D0_CORGL          --------
D1B6U2_THEAS          --------
Q8G4T6_BIFLO          --------
NUSG_DEIRA            --------
NUSG_THET8            --------
NUSG_SYNY3            --------
Q8DM29_THEEB          --------
Q7VDY4_PROMA          --------
Q7NMD6_GLOVI          --------
B8E0K4_DICTD          --------
NUSG_CAMJE            --------
NUSG_HELPY            --------
NUSG_AQUAE            --------
A6GYU5_FLAPJ          --------
Q8A464_BACTN          --------
Q2S1Q0_SALRD          --------
Q8KG20_CHLTE          --------
Q8F0R7_LEPIN          --------
NUSG_ECOLI            --------
Q32AF4_SHIDS          --------
NUSG_SALTY            --------
NUSG_YERPE            --------
NUSG_VIBCH            --------
Q5E230_ALIF1          --------
NUSG_BUCAI            --------
NUSG_HAEIN            --------
Q8EK79_SHEON          --------
NUSG_PSEAE            --------
C1DKK0_AZOVD          --------
E4PLX6_MARAH          --------
H9L4N0_XANCP          --------
Q83ET5_COXBU          --------
NUSG_NEIMB            --------
Q5F5R0_NEIG1          --------
Q7W0S4_BORPE          --------
Q63PZ8_BURPS          --------
Q748Y1_GEOSL          --------
Q89J68_BRADU          --------
A9CIF8_AGRFC          --------
Q9A3J9_CAUVC          --------
Q2RQU8_RHORT          --------
Q3J5T5_CERS4          --------
Q727D2_DESVH          --------
B5YFW3_THEYD          --------
Q1IHG9_KORVE          --------
Q5NID7_FRATT          --------
NUSG_CHLTR            --------
NUSG_RICPR            --------
NUSG_THEMA            --------
Q8RHI1_FUSNN          --------
NUSG_BORBU            --------
Q7UMY8_RHOBA          --------
Q5FFE4_EHRRG          --------
C0R546_WOLWR          --------
NUSG_MYCPN            FIEVEQSH
NUSG_MYCGE            FVEFE---
A0A014LZE0_MYCMC      --------
Q5ZZQ0_MYCH2          --------
Q9PPQ8_UREPA          --------