CLUSTAL format seed alignment for MF_00951

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RFAH_ECOLI            ----------------MQSWYLLYCKRGQLQRAQEHLERQAVNCLAPMITLEKIVRG-KR
Q32A17_SHIDS          ----------------MQSWYLLYCKRGQLQRAQEHLERQAVNCLAPMITLEKIVRG-KR
RFAH_ECO57            ----------------MQSWYLLYCKRGQLQRAQEHLERQAVNCLAPMITLEKIVRG-KR
RFAH_ECOL5            ----------------MQSWYLLYCKRGQLQRAQEHLERQAVNCLAPMITLEKIVRG-KR
RFAH_ECOL6            ----------------MQSWYLLYCKRGQLQRAQEHLERQAVNCLAPMITLEKIVRG-KR
Q9L6M1_SALTY          ----------------MQSWYLLYCKRGQLQRAQEHLERQAVSCLTPMITLEKMVRG-KR
D2TCU3_ERWP6          ----------------MESWYLLYCKRGQLLRAQEHLERQAVHCLSPMVALEKIVRG-KP
A0A0H2W6U9_YERPE      ----------------MKSWYLLYCKRGQILRAKEHLERQTVNCWTPIVAIEKIVRG-KR
D3UZ80_XENBS          ----------------MGSWYLLYCKRGQISRAIGHLERQDVICLTPTAKIEKIVRG-KR
E6WNR4_PANSA          ----------------MENWYVAQTKYAQEKRAQQQLQSQGVTCLLPVFSEVRLQNGGIR
Q9KTB3_VIBCH          ----------------MKRWYLLYCKRGEQQRAKMHLENQSVECFYPEVCVEKILRG-KR
B7VII2_VIBA3          ----------------MKRWYLLYCKRGDQKRAQQHLENQGVECFYPQIEVEKVVRG-KE
Q5E6P8_ALIF1          ----------------MKQWYLLYCKRGEQERAKLHLENQMVECFYPEIVVEKIVRG-KR
Q6LNV5_PHOPR          ----------------MKDWFLLYCKRSEQERAVINLDRQGVECYYPQVNVNKIVRG-KR
C4LAP4_TOLAT          ----------------MKHWYLAYCRPKEEERAKLHLRNQGVDSYYPLVLTRKIIRG-KA
A0A142E891_9GAMM      ----------------MKKWYLAYCKPKEEARARAHLDAQGIESYYPMVEIEKLRRG-KR
H2FYE9_OCESG          ----------------MQHWYLAHCRPREEERALLNLDNQHIETFCPFIEVRKIVRG-KR
Q3IFE9_PSET1          ----------------MESWYLVVCKPRQEERAQVNLKNQGIASFFPKLTTEKLVKG-RR
A1T084_PSYIN          ---------------MSLQWFVVYCKSREELRAQRNLENQGVYSFFPKICKEKILRS-KK
Q8ECE8_SHEON          ----------------MKAWYLLYCKPRSEVRAQQNLALQNLETYLPMVSEE-KSQRGQK
Q0HWX5_SHESR          ----------------MKAWYLLYCKPRSEARAQQNLALQNLETYLPMVSEE-KSQRGQK
A8H2D3_SHEPA          ----------------MKAWYLLYCKSRGESRAQQNLALQQIDTYLPTYPEE-KLVKGQS
B8CL13_SHEPW          ----------------MKAWYLLYCKPRGEARAQQNLALQEIETYIPTYPEE-KTHNGKV
D4ZID6_SHEVD          ----------------MKAWYLLYCKPRGEARAVHNLTLQEIETYLPTIGEE-KRVKGQI
A3QCR9_SHELP          ----------------MKSWYLVYCKPRGETRAQQNLALQQIETYLPTLPQQ-ITKSGKN
A8FXR4_SHESH          ----------------MKAWYLLYCKPRGESRALQNLTIQNIETYLPTIAVK-KEQKGQV
Q12KS5_SHEDO          ----------------MKAWYLLYCKPKSELRAQQNLALQQVESYLPVIKEQ-KTARGKT
Q07Z81_SHEFN          ----------------MKSWYLLYCKPRHEVRAQQNLALQEVESYLPMITQQ-KMVRNKP
A1S7W4_SHEAM          ----------------MKAWYLIYCKPRNEMRAQQNLSMQNLETYLPKHRKQVKASGGAV
E1SUT6_FERBD          ----------------MLGWYLLYCKGKKEATARAYLEQRNLSCFLPEAEVE-CIKRGKR
Q3J8A9_NITOC          ---------MESSPSSKKFWYLIYCKPRQERLAQENLERQNFETYLPLVRQMRRRAY-RR
D8KB72_NITWC          ---------MESSPSSKKFWYLIYCKPRQERLAQENLERQSFETYLPLVRQMRRRAY-RR
D5BWZ3_NITHN          ---------MEHTPSSKRSWYLIWCKPRKEHLAQENLERQRFETYLPLVRQLRRRAH-RR
Q83DB2_COXBU          -------------MSTDSDWYLIYTKPRQERIAEENLERQGYRIYLPFIQVNRRRSG-CY
A1WZB7_HALHL          -----MQAEDFEEFGRSDAWYLVYSKPRQEERAWWNLDHQGFRCFLPMARFRRRRQR-RY
Q0ACI7_ALKEH          -----MGTVIVTEQQEHRAWYLIYTKPRQEEAARDNLGRQGFHAWLPRVRVVKRRGT-RR
D8IXD1_HERSS          -----------------MQWYLVHTKPRQEVCAQQNLEQQGYECYLPLLHKEKVRRG-AL
Q82X31_NITEU          -----------------MHWYLVHTKPKQEKCAFQNLQQQGYRCYLPMLPVEKLHLG-NL
Q4K6G2_PSEF5          --------MATYQPDSSTTWYLVQCKPRQDLRAEENLRRQGFHCYRPQRGCERVVQG-RR
Q3KCF2_PSEPF          --------MPVISSDQ-PNWYLLQCKPRQDERAHLNLLQQNYVVFHPQLVSERVIRG-KR
A4VKD4_PSEU5          -----------MTTNKTARWYLIQTKPRQEARAEEHLLRQHFECYRPLKASAATRSG-QG
F8H777_PSEUT          -----------MTTNATARWYLIQTKPRQEARAEEHLLRQHFECYRPIKGPSRTPN---S
Q4ZRG4_PSEU2          ----------MSHSDQDVRWYLIQTKPRQEARAEEHLRRQQFECYRPLQADAKKTG--TR
Q48H23_PSE14          ----------MALSAQEARWYLIQTKPRQEARAEEHLRRQHFQCYRPLQVDVKKTA--AR
Q87ZI5_PSESM          ----------MYLSDQDARWYLIQTKPRQEARAEEHLRRQDFECFRPLRAAAKKIA--AK
E1VBC8_HALED          MSDDSLCPTGIDD--AVPRWYVIQCKSGESFRAVEHLGNQGYEIFHPVLRVQKKRRG-KL
Q1QVL5_CHRSD          -MTDQLDPVASDDTAARPRWYVVQCKGGESFRAGEHLTNQGYRVFHPVLEVQKKRRN-KL
K0CBW7_ALCDB          ---------------------MVQCRANQNYRARENLENQGFTCFLPELSVERLRAG-RR
C7RAP1_KANKD          ------------MSECEKSWYLINSKPKQELRALEHLKNQEINCVLPVLEVERIIRG-KR
                                           :   :      *   *  :      *             

RFAH_ECOLI            TAVSEPLFPNYLFVEFDPEV--IHTTTINATRGVSHFVRFG-ASPAIVPSAVIHQLSVYK
Q32A17_SHIDS          TAVSEPLFPNYLFVEFDPEV--IHTTTINATRGVSHFVRFG-ASPAIVPSAVIHQLSVYK
RFAH_ECO57            TAVSEPLFPNYLFVEFDPEV--IHTTTINATRGVSHFVRFG-ASPAIVPSAVIHQLSVYK
RFAH_ECOL5            TAVSEPLFPNYLFVEFDPEV--IHTTTINATRGVSHFVRFG-ASPAIVPSAVIHQLSVYK
RFAH_ECOL6            TAVSEPLFPNYLFVEFDPEV--IHTTTINATRGVSHFVRFG-ASPAIVPSAVIHQLSVYK
Q9L6M1_SALTY          TSVSEPLFPNYLFVEFDPEV--IHTTTINATRGVSHFVRFG-AHPAIVPSSVIHQLSIYK
D2TCU3_ERWP6          TQVSEPLFPNYLFVEFDPES--IHTTTISATRGVSHFVRFG-NQPATVPQGVINALQVGP
A0A0H2W6U9_YERPE      IEVIEALFPNYLFAEFDPEN--IHTTTVSATRGGSHFVRFG-TQPAVIPATVIADMQAHA
D3UZ80_XENBS          TTVTEPLFPNYLFVNFDPEI--IHTTTINSTRGVNHFIRFS-TYPAVVPQTLIDELMSAT
E6WNR4_PANSA          RIAEQPLFPNYIFVRFDPEV--VHTTAIKATRGVSTLISFG-GLPSVVPDSVITRLNQGW
Q9KTB3_VIBCH          QMVQEPLFPSYMFVRFDFENG-PSFTTVRSTRGVVDFVRLG-PHPRELQGDLIYQLKQLD
B7VII2_VIBA3          KLVQEPLFPSYIFVRFDYEQG-PSFTTVRSTRGVVDFIKFG-ARPYEVQGDLVFELKEFE
Q5E6P8_ALIF1          KQVKEPLFPCYMFIYFDFEVG-PSFTSIRSTRGVSDFIRFG-AQPKVLQGDLIYSLKALD
Q6LNV5_PHOPR          VEISEPLFPSYIFVYFDPEH--LSYTTVRSTRGVADFIRQG-ARPQMVQQELVYGLMMNE
C4LAP4_TOLAT          MEKIEPMFPRYLFVHMDIEE--FSPLKVRSTRGIHHIVGHG-STWDKVPAELVYQLMRNE
A0A142E891_9GAMM      VPVREPMFPNYLFIFVDLEE--VTPVTLKSTRGISRIIHFG-SEWTPISSKLVYQLMSRD
H2FYE9_OCESG          VIRNEALFPGYVFLRTDLEV--TSCATLRSTRGIRNLVRFG-ELPCVVPEALILDLMCRT
Q3IFE9_PSET1          TVKQSALFPGYVFVCLEAEN--GNFFAVKNTRGVSGFVTYG-AAYQRVPVELINQLKAER
A1T084_PSYIN          KVVEEPLFPSYLFVNISKND--EKFSAIRSTRGINNFVKFG-LSIATIPDQQIKKIEQLC
Q8ECE8_SHEON          RICRVPLFPNYLFINFDPSQ--TSVKQVHSTRGVSRIVNCQ-EKMTPIDDRIIHAIRMKE
Q0HWX5_SHESR          RICRVPLFPNYLFINFDPSQ--TSVKQVNSTRGVSRIVNCQ-EKMTPIDDRIIHAIRMKE
A8H2D3_SHEPA          TVRRVLLFPSYLFVHFDPEI--TSVAKIHNTRGVIRIVGCK-ELMTPIDDSIIHAIKMRE
B8CL13_SHEPW          TVRRVSLFPSYLFIHFDPQV--TSVSRIHNTRGVIRIVGCK-ELMTPIDEGVIGAIKARE
D4ZID6_SHEVD          IVKRIPLFPGYLFIYFDPQI--TSVARIHSTRGVGRIVGCK-ELMTTVDDSIIHSIKMRE
A3QCR9_SHELP          SVKRLPLFPCYLFIYFDPLE--ISVSKIHSTRGVSRIIGCR-EEMTAIDDAIVHSIRMRE
A8FXR4_SHESH          SVVKTSLFPSYLFIKFDPKE--VSVSRINSTRGVVQVVGCK-ELMTPIDDGIIDAIRQQE
Q12KS5_SHEDO          KVVEVPLFPNYLFIHFDPTE--FSVNTIHSTRGASRIIGCK-ELMTPINDAIIAEIKHRV
Q07Z81_SHEFN          QMVTAPLFPSYLFIYFDPLI--TSVSKIHNTRGANRIVGCR-EDMTPIDDRIISALKRRV
A1S7W4_SHEAM          SVSESVLFPNYLFVQFDPEV--TSVRSIHATRGVSRIVGCS-EQMTPIDDALIRALKRKE
E1SUT6_FERBD          TLVTAPLFPNYLFVRFDPFQ--TPITTVMSAPGVASVVRTD-GKIAPIETAIVVAIRERL
Q3J8A9_NITOC          IATVEPLFPRYLFIHLDTEK--DNWGSIRSTIGVISLVRFG-AQPAHVPDTLIRELQTHE
D8KB72_NITWC          IATVEPLFPRYLFVHLDAEK--DDWGSIRSTIGVISLVRFG-AQPAQVPDTLISELQAHD
D5BWZ3_NITHN          ITVVEPLFPRYLFIHLDKEK--DNWSSIRSTIGVTALVRFG-DQPAQVPDRLIKELQAHE
Q83DB2_COXBU          QLITEPLFPRYLFILLNIDK--DNWGPIRSTRGVSALVRFG-GIPAKVPPDFVQFLKNNE
A1WZB7_HALHL          QTVIEPMFPRYLFIRLAAGL--EDWSPIRSTTGVSGLVRFG-TWPARVPDGLVDTIRARI
Q0ACI7_ALKEH          VPVVEPMFPRYLFVELDSAY--QDWSPISSTLGVTSLVRFG-GVPAKVPGPLVAALQARA
D8IXD1_HERSS          TLSSEALFPRYLFIRLGAGLTSKSWAPIRSTKGVSRLVTFG-TEPAKISNDLVLALQAAQ
Q82X31_NITEU          TVVDEPLFPRYLFIQLEQGDSAKSWVPIRSTRGVNRLVCFG-SEPARIDDILIDLLRMQE
Q4K6G2_PSEF5          QSGTESLFPGYLFIALEH---DASWAPLRSTRGVNRLVAFN-GQPLAVPVSLIESLRQRV
Q3KCF2_PSEPF          QRVQESLFPGYLFIQLSR---DDNWAPLRSTRGVSRFVEFN-HGPATVAEHVIEHLRARC
A4VKD4_PSEU5          AKAGEPLFPGYLFIRLDST--HDNWYPIRSTRGVNRVVSFG-GQPTPVRDELIEQLRQRL
F8H777_PSEUT          PRTGEALFPGYLFIRLDCT--HDNWYPIRSTRGVSRVVTFG-GQPTPVRDELIEQLRQRL
Q4ZRG4_PSEU2          VQAGEPLFPGYLFIHMDQV--QDNWYPIRSTRGVSRIVTFG-GHPVPVRDHLIEQIRQRL
Q48H23_PSE14          VQADEPLFPGYLFIQMDQV--QDNWYPIRSTRGVSRIVTFG-GHPVPVRDHLIEQIRQRL
Q87ZI5_PSESM          AQVEEALFPGYLFIHMDQV--HDNWYPIRSTRGVSRIVTFG-GHPVPVRDHLIEQIRQRL
E1VBC8_HALED          VWAVEPLFPYYLFIRLDRL--DSNWRPIRSTRGVLKIVTFGLDTPVPVDDELVASL--RE
Q1QVL5_CHRSD          VWIAEPLFPHYLFIHLDRV--ASNWRPIRSTRGVLKLVGFG-DEPLPVPDALIETLAARA
K0CBW7_ALCDB          IQREEPLFPGYLFIRLDR---AGGWHTVRSTRGVQKLVTFG-NQPVPVPDRVVEELQTRT
C7RAP1_KANKD          QKAIEPLFPGYLFVELQTNG--QGWSKIRSTRGVRDFVRFG-GVPGRVPDSVLEHLLILD
                            :** *:*              :  : *   .:         :    :  :    

RFAH_ECOLI            P-------------------KDIVDPATPYPGDKVIITEGAFEGFQAIFTEPDGEARSML
Q32A17_SHIDS          P-------------------KDIVDPATPYPGDKVIITEGAFEGFQAIFTEPDGEARSML
RFAH_ECO57            P-------------------KDIVDPATPYPGDKVIITEGAFEGFQAIFTEPDGEARSML
RFAH_ECOL5            P-------------------KDIVDPSTPYPGDKVIITEGAFEGFQAIFTEPDGEARSML
RFAH_ECOL6            P-------------------KDIVDPSTPYPGDKVIITEGAFEGFQAIFTEPDGEARSML
Q9L6M1_SALTY          P-------------------EGVVDPETPYPGDSVIITEGAFEGLKAIFTEPDGETRSML
D2TCU3_ERWP6          A-------------------LPLDDGELPQPGDTVMITEGAFEGLKAIFTEPDGEARSML
A0A0H2W6U9_YERPE      V-------------------DKIIAPEVPKPGDIVKIIDGVFAGLQAIYTEPDGEARSML
D3UZ80_XENBS          E-------------------QEYIAPETPITGDTVLITEGIFEGIQAIYNEPDGETRSIL
E6WNR4_PANSA          E-------------------SAPLTTDAPAHGDRVVIRDGVFEGLEAVWYEPDGMKRAML
Q9KTB3_VIBCH          --C---------------EQLKHATKQLPEKGQTVRVARGQFAGIEAIYLEPDGDTRSIM
B7VII2_VIBA3          KCC---------------SSEVEDCCVEFETGQVVKINSGQFAGVEAIYHQKDGEARSIM
Q5E6P8_ALIF1          E-----------------NNNKEKLECLPEAGQKVAIKEGPYSGIEAIYKEADGEKRSIL
Q6LNV5_PHOPR          N-C---------------EVHQAKLSSLPIPGECLQLKQGQFKGIEAIYQEADGEKRSFM
C4LAP4_TOLAT          D-S---------------DESRDVVSRLPKTGQMVIFNEGPFEGLQAIYQEPDGNQRAFL
A0A142E891_9GAMM      D-S---------------DEARASYASLPCSGDKVLIEEGPLAGFEAIYMEPDGEKRAIL
H2FYE9_OCESG          G-D---------------QRLSERLSDLPKCGDKVVIKDGPFAGMEAIYQEADGDSRAML
Q3IFE9_PSET1          SHS---------------HESQVP-----KNGDLVSVNNESFKNIDAIYKEPDGDMRSIL
A1T084_PSYIN          HVN---------------NKLAVNSEDVYQNGDKIEILSGPFKGLTAIFNIEDGLERSML
Q8ECE8_SHEON          LTP--------------SQSVLDTPLELK-TGEKIRFKDGPFADLEAIFQEKCPNKRCHV
Q0HWX5_SHESR          LTP--------------SQAVLDHELELK-TGEKIRFKDGPFIDLEGIFQEKCPNKRCQV
A8H2D3_SHEPA          HRLMSELSP--------IEAAPTIEPEME-RGDKVCFTEGPFAELEGIFDEANGEKRCFV
B8CL13_SHEPW          HKWINELLPE-------TRCKEELVCPVK-SGDKVKFVDGPFAELEGIFQEKNGEKRCYV
D4ZID6_SHEVD          HKLLSELLPELKLEGADAQELPATEVEFS-PGEKIRFTEGPFAELEGIFEEKNGDKRCHV
A3QCR9_SHELP          AKLLNALQLP-----SDDLLSGNAEPRLS-VGDKVKFVEGPFKELEGIFEEQSGDKRCHI
A8FXR4_SHESH          YELNSMTQGSTDIG---SSSNEEFEPKVINPGEKVRLTEGVFSTLEGIFQEKSGDKRCHV
Q12KS5_SHEDO          GNH-----------------QVELQPELV-KGDRVRFIQGPFADLDAIFEEHNGDKRCHV
Q07Z81_SHEFN          QGY-----------------VPEEVKPLG-KGDKVKFVDGPFKDLEAIFDENNPDKRCHV
A1S7W4_SHEAM          LQV----------------EKLACEKPLA-AGERVKFCAGPFSDLEAIFLESDGNKRCQV
E1SUT6_FERBD          KRA------------------AVSLMDAPTAGDTVEILDGPFANLQGIFREPDGDKRSLL
Q3J8A9_NITOC          GSDGI---------------QDLASPDFR-KGQQVLVEEGLLAGHEGIWLTSNGKKRAHI
D8KB72_NITWC          APDGI---------------QNLARPGFQ-KGQQVLVEEGLLAGHEGIWLTSNGKERAHI
D5BWZ3_NITHN          SPDGI---------------HDLPSRSFQ-QGQKIRIEEGPLAGHEGIWLASNGKERAQV
Q83DB2_COXBU          TSASV---------------PPKVSL-FQ-KGQRVQIIDGVMAGYEGVFEMHSGAKRVTL
A1WZB7_HALHL          -EDGH---------------CDLAPEPLQ-PGERVRVLDGPFQSYEGIFRASRSDERVMI
Q0ACI7_ALKEH          DEDDI---------------CDLSARQQPRAGDTVRVAHGAFAGYEAVFQARSGRERVLV
D8IXD1_HERSS          --QSE---------------AAPVERAFT-PGQRVQLVEGALSGIEGIFLEADGERRVMV
Q82X31_NITEU          --ASF---------------QHKPERLFK-PGERVRLTEGAFAGIEGIYQMAEGERRVMV
Q4K6G2_PSEF5          TDMDT-----------------SLP----YKGTRVCITEGCFADLEAIFESSIGDERVVL
Q3KCF2_PSEPF          LESTL-----------------SEPDEALKPGENLQIVSGPLAPLEGVFLGLHGTDRVMI
A4VKD4_PSEU5          AQDE------------------RAPAANFKPGERVQVSGGSFSDIEAIFVSSDGEERSVI
F8H777_PSEUT          AQAQ------------------DKPTVPFTPGERVQVSGGSFSEIEAIFVSSDGEERSVI
Q4ZRG4_PSEU2          ATP--------------------APKTQFAQGDAVLITHASWGDVEAIFLSKDGTQRAVI
Q48H23_PSE14          STP--------------------APKARFIQGDPVMITTGSWSDVEAIFLSEDGTERAVI
Q87ZI5_PSESM          CTP--------------------APALRFTQGDQVMITTGSWCDVEAIFLTTDGTERAVI
E1VBC8_HALED          HGSQE---------------AGETATVYFRAGEQVEITEGPFKDLQAVFATHKGEERAIV
Q1QVL5_CHRSD          HLDEA---------------SRTSGNAYFRPGEIVEITEGPFQALQAVFDTQQGDERAIV
K0CBW7_ALCDB          ESQD--------------------QEQAFAPGDTLRIENGPFKDLEAVFQRFDGQERVIV
C7RAP1_KANKD          TSFT------------------PIETNAPGAGDKVIITDGPFKDLEGVFKISNGEKRSIV
                                                     *  : .         .::       *  :

RFAH_ECOLI            LLNLINKEIKHSVKNTEFRKL--------
Q32A17_SHIDS          LLNLINKEIKHSVKNTEFRKL--------
RFAH_ECO57            LLNLINKEIKHSVKNTEFRKL--------
RFAH_ECOL5            LLNLINKEIKHSVKNTEFRKL--------
RFAH_ECOL6            LLNLINKEIKHSVKNTEFRKL--------
Q9L6M1_SALTY          LLNLLNKEVKQSVKNTGFRKI--------
D2TCU3_ERWP6          LLNLLNKQVVRSIANQQFRCCKPAP----
A0A0H2W6U9_YERPE      LLNMLNSQIKHSLDNRQFEKQ--------
D3UZ80_XENBS          LLNILNKEVSKILDNKQFIKI--------
E6WNR4_PANSA          LLTLMNRQVPVPVNSHMRFHITARGAAA-
Q9KTB3_VIBCH          LVKMISQQVPMSIENTDWEVT--------
B7VII2_VIBA3          LVKMISQVVPISIENEALQAHV-------
Q5E6P8_ALIF1          LITLINKKVEIKIPNSDIEY---------
Q6LNV5_PHOPR          LINLLGKPVKVSVENEDIVKD--------
C4LAP4_TOLAT          LLSILNQDICSSFDNKSFRCITG------
A0A142E891_9GAMM      LVSLLNRETTSSFDNHTFRRLD-------
H2FYE9_OCESG          LLTLLQSQTRASFANTDYRRLDE------
Q3IFE9_PSET1          FINLLNKQIEISVSNQAISKI--------
A1T084_PSYIN          LLKILNQDNNISFKNSALKKVES------
Q8ECE8_SHEON          LFNIMGQINILTVPEQSVERV--------
Q0HWX5_SHESR          LFNIMGQIKTLTVPMQSVERV--------
A8H2D3_SHEPA          LFDLMGKQQRVAIKKDSIKPVK-------
B8CL13_SHEPW          LFDIMGKQQRVSVDRSTVKLAG-------
D4ZID6_SHEVD          LFDIMGQQKRVSVSKRIIKPI--------
A3QCR9_SHELP          LFEIMGQQKRVSVSRVSIKGI--------
A8FXR4_SHESH          LFEIMGEMKSVKIPMSIVKPSD-------
Q12KS5_SHEDO          LFTIMGQQKSLQVNLD--QIAPNGEE---
Q07Z81_SHEFN          LFNIMGQQKRILVELTNLQAVPNNDQTT-
A1S7W4_SHEAM          LFEFMGQQKQLDVESSSIVRICA------
E1SUT6_FERBD          LLEILGQQKPISMENQMFRRL--------
Q3J8A9_NITOC          LLEIMGKQIKTEVNENWLKRLEP------
D8KB72_NITWC          LLEIMGKQIKTEVNENWLKRLEP------
D5BWZ3_NITHN          LLEIMGKQIKTEMNQNWLGHS--------
Q83DB2_COXBU          LLDMVGKVTRVEVPLDSVTGT--------
A1WZB7_HALHL          LLDVAGQHTTLTVSQHQIERA--------
Q0ACI7_ALKEH          LLEVAGKQSRVTLPADDIDPV--------
D8IXD1_HERSS          LIEMLSKPVSVAVAPGSLRKIL-------
Q82X31_NITEU          LIELLSKPVAMRVSPTSLRKTN-------
Q4K6G2_PSEF5          LLTLLNQQRRIELPLSSIRKI--------
Q3KCF2_PSEPF          LLQFLNREQPVCLPLSVIERQQPGFHPYN
A4VKD4_PSEU5          LLNLLQREQKVRVPTRYLQCHS-------
F8H777_PSEUT          LFNLLQREQKVRVPTRYLQCYS-------
Q4ZRG4_PSEU2          LLNMLQRQQKVVLPISSLSRIEARA----
Q48H23_PSE14          LLNMLQRQQKMGLPISSLSRVEARA----
Q87ZI5_PSESM          LLNMLQRQQKVVLPISSLSRIEATA----
E1VBC8_HALED          LLNMLHKRQRLEMSVSQLKRCE-------
Q1QVL5_CHRSD          LLNMLHHQQRLELPVGHLRRST-------
K0CBW7_ALCDB          LMGMLHKQHQLTLSIKDVSRH--------
C7RAP1_KANKD          LLTILGKVTEMELENKQLRKA--------
                      :. .        .