CLUSTAL format seed alignment for MF_00952

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Q6F0G3_MESFL      ---------------------------------------------------MAKYLVLLE
F0V2L5_MYCS3      ----------------------------------------------------MRELMFVE
Q9PPP9_UREPA      ---------------------------------------------------MQKDLIVVE
TOP1_MYCGA        ------------------------------------------------MTNHSSKILVIE
TOP1_MYCPN        ---------------------------------------------------MSKNLVVIE
TOP1_MYCGE        ---------------------------------------------------MIKNLVVIE
Q3M6J7_TRIV2      ---------------------------------------------------MPKRLLVVE
Q4AA55_MYCHJ      ----------------------------------------------------MEKLIIVE
B3PMD8_MYCA5      ---------------------------------------------------MDQKVLIVE
TOP1P_MIMIV       ----------------------------------------------------MSILILLE
Q8F5G0_LEPIN      ----------------------------------------------------MSLLIIVE
TOP1_BORBU        --------------------------------------------------MQNKKLIIVE
H8H3H1_DEIGI      -----------------------------------------------------MPLLIVE
B1VAJ5_PHYAS      ---------------------------------------------------MKKKVIIVE
TOP1_FERIS        ----------------MAKSKVVEKDKKNELDNQSADIELKGQSKNEESKGGKKKVIIVE
TOP1_THEMA        ------------------------------------------------MSKKVKKYIVVE
B2V7T0_SULSY      --------------------------------------------------MSEKKIVIVE
TOP1_AQUAE        -----------------------------------------------------MELFIVE
D3SM80_THEAH      ----------------------------------------------------MMRLFLVE
G8QVT8_SPHPG      -------------------------------------------------MDDTKVLIIVE
TOP1_SYNE7        ----------------------------------------------------MPKLVIVE
TOP1_SYNY3        ----------------------------------------------------MSKLVIVE
TOP1_STRCO        ------------------------------------------MSPTSETAKGGRRLVIVE
TOP1_MYCTU        ------------------------------------MADPKTKGRGSGGNGSGRRLVIVE
TOP1_MYCLE        --------------------------------------MKGPRGSRSGRNGSPRRLVIVE
I0II60_PHYMF      -----------------------------------------------MKDAQGRHLVIVE
J9Z7K0_LEPFM      ------------------------------------------------------------
TOP1_BUCAI        ---------------------------------------------------MQKSLVIVE
TOP1_BUCAP        ---------------------------------------------------MCKSLVIVE
TOP1_PSEAE        ---------------------------------------------------MGKSLVIVE
TOP1_VIBCH        ---------------------------------------------------MGKSLVIVE
TOP1_ECOLI        ---------------------------------------------------MGKALVIVE
TOP1_SALTY        ---------------------------------------------------MGKALVIVE
TOP1_HAEIN        ---------------------------------------------------MSKSLVIVE
TOP1_PASMU        ---------------------------------------------------MSKSLVIVE
TOP1_CAMJE        ---------------------------------------------------MKKNLIIVE
TOP1_HELPY        ----------------------------------------------------MKHLIIVE
TOP1_HELPJ        ----------------------------------------------------MKHLIIVE
TOP1_TREPA        -------------------------------------MEVRGLQPKRQKTFARKHLVIVE
TOP1_LACLA        ----------------------------MPTSTKSKTKTTTKKKTTRKRVTPGKNLVIVE
TOP1_STAS1        ---------------------------------------------------MAENLVIVE
TOP1_STAAB        ---------------------------------------------------MADNLVIVE
TOP1_STAA8        ---------------------------------------------------MADNLVIVE
TOP1_STAAU        ---------------------------------------------------MADNLVIVE
TOP1_STAAM        ---------------------------------------------------MADNLVIVE
TOP1_STAHJ        ---------------------------------------------------MADNLVIVE
TOP1_STAES        ---------------------------------------------------MADNLVIVE
TOP1_BACSU        ---------------------------------------------------MSDYLVIVE
TOP1_BACHD        ---------------------------------------------------MADYLVIVE
A5CVH7_VESOH      ---------------------------------------------------MAKNLVIVE
Q28MI5_JANSC      -----------------------------------------------------MPVVVVE
TOP1_XYLFT        ---------------------------------------------------MPKHLLIVE
TOP1_XYLFA        ---------------------------------------------------MPKHLLIVE
TOP1_RICTY        -----------------------------------------------------MKLVIVE
TOP1_RICPR        -----------------------------------------------------MKLVIVE
TOP1_RICBR        -----------------------------------------------------MKLVIVE
TOP1_RICFE        -----------------------------------------------------MKLVIVE
TOP1_RICCN        -----------------------------------------------------MKLVIVE
B7J7I8_ACIF2      ----------------------------------------------------MTKLLIVE
Q7WXW8_PSEAI      -----------------------------------------------------MHIVIIE
C6XEP4_METGS      ---------------------------------------------------MSKTLIIVE
B1M9R9_METRJ      -----------------------------------------------------MKLMVVE
TOP1P_XYLFA       -----------------------------------------------------MKLMIIE
C8W7T0_ATOPD      -----------------------------------------------------MILVVTE
E1RJ15_METP4      -----------------------------------------------------MHLIIAE
C7P1M5_HALMD      -----------------------------------------------------MELIITE
TOP1_THEAC        --------------------------------------------------MDGFRIIIAE
TOP1_ARCFU        --------------------------------------------------MVMSWLIITE
B5IE55_ACIB4      ----------------------------------------------------MNILVIAE
B1L3G6_KORCO      ----------------------------------------------------MTTLILTE
TOP1_AERPE        --------------------------------------------------------MVAE
A3DP02_STAMF      MGDKAKKSIIDYILSYSEKQKKKPVKTKEKTSSKKAIEKTEIQITHNIWDLIGKIVVIAE
B8D5I1_DESA1      ----------------------------------------MVSKSIRIWDLKGRILVIAE
K0IBM4_NITGG      ----------------------------------------------------MYTLVVCE
TOP1_METTH        ---------------------------------------------MRSLSGKMHEVIICE
F6D5C7_METPW      ----------------------------------------------------MHEVIICE
TOP1_METJA        ------------------------------------------------MAEIMTALIICE
TOP1_PYRAB        -----------------------------------------------------MILVIAE
TOP1_PYRHO        -----------------------------------------------------MILIIAE
                                                                              

Q6F0G3_MESFL      SPSKVEKIKHYLEK-----------------NFQEDSFEVLASGG---HIN--RIADSGP
F0V2L5_MYCS3      SPAKIKSISKYLSG---------------------RNLKVFATYG---HIR--ELSK---
Q9PPP9_UREPA      SPNKIKSIQSYLGD----------------------SYNVIATCG---HLR--ELA----
TOP1_MYCGA        SPNKVKTIKKYLTD----------------------DYEIVATVG---HIR--DLPK---
TOP1_MYCPN        SPNKVKTLQKYLPN----------------------DFEIVSTIG---HIR--EMVH---
TOP1_MYCGE        SPNKVKTLKQYLPS---------------------DEFEIVSTVG---HIR--EMVY---
Q3M6J7_TRIV2      SPGKVKKLSQILGS----------------------EWIVRASCG---HIR--ELSDEGE
Q4AA55_MYCHJ      SPNKINTISSYLDS----------------------SYKVTACVG---HIT--NLAKTGQ
B3PMD8_MYCA5      SPNKVKTIQQYVGS----------------------DYNVVSSVG---HIL--KLSTSGV
TOP1P_MIMIV       SPGKISKISSILGK----------------------NYVVKASMG---HFR--DLDP---
Q8F5G0_LEPIN      SPSKAKTIAGYLGK----------------------EFRILATLG---HVA--DLPK---
TOP1_BORBU        SPTKAKTIKKFLDE----------------------SFLVEACIG---HVV--DLPNNAK
H8H3H1_DEIGI      SPKKAKQIASYLGR----------------------DWTVKACFG---HVR--DLPATKA
B1VAJ5_PHYAS      SPAKIKTLSRFFDD----------------------KVEILSSKG---HIR--DLSLSGK
TOP1_FERIS        SPAKAKTIERILGN----------------------DYQVISSKG---HIR--DLPQ---
TOP1_THEMA        SPAKAKTIKSILGN----------------------EYEVFASMG---HII--DLPK---
B2V7T0_SULSY      SPKKAKEISHFLGK----------------------DFIVKATVG---HFK--DLPE---
TOP1_AQUAE        SPTKAKTIQKFLGK----------------------GFLVKATLG---HVK--DLPE---
D3SM80_THEAH      SPTKAKTIQKYLGK----------------------DWKVLASMG---HIK--DLPE---
G8QVT8_SPHPG      SPTKAKTITKFLPK----------------------TCKVVASKG---HIR--DLPE---
TOP1_SYNE7        SPTKARTIRNYLPK----------------------DYRVEASMG---HVR--DLPQSAS
TOP1_SYNY3        SPTKARTIRNYLPQ----------------------DYRVEASMG---HVR--DLPASAE
TOP1_STRCO        SPAKAKTIKGYLGP----------------------GYVVEASVG---HIR--DLPSGAA
TOP1_MYCTU        SPTKARKLASYLGS----------------------GYIVESSRG---HIR--DLPRAAS
TOP1_MYCLE        SPTKARKLSGYLGS----------------------AYIVESSRG---HIR--DLPRTAA
I0II60_PHYMF      SPTKAKTINKYLGR----------------------DYHVMASVG---HVR--DLPKSAP
J9Z7K0_LEPFM      -------------------------------------------MG---HVK--DLPP---
TOP1_BUCAI        SPAKAKTINQYLGS----------------------EYIVKSSIG---HIR--DLTKGKL
TOP1_BUCAP        SPVKAKTISKYLGK----------------------QYIVKSSVG---HVR--DLINNKS
TOP1_PSEAE        SPAKAKTINKYLGS----------------------QYVVKSSIG---HIR--DLPTSGS
TOP1_VIBCH        SPAKAKTINKYLGK----------------------DFIVKSSVG---HVR--DLPTAGQ
TOP1_ECOLI        SPAKAKTINKYLGS----------------------DYVVKSSVG---HIR--DLPTSGS
TOP1_SALTY        SPAKAKTINKYLGN----------------------DYVVKSSVG---HIR--DLPTSGS
TOP1_HAEIN        SPAKAKTINKYLGS----------------------QYVVKSSVG---HIR--DLPTVGS
TOP1_PASMU        SPAKAKTINKYLGS----------------------NYVVKSSVG---HIR--DLPTVGS
TOP1_CAMJE        SPAKAKTIGNFLGK----------------------DYEVIASKG---HIR--DLPK---
TOP1_HELPY        SPAKAKTIKNFLDK----------------------NYEVIASKG---HVR--DLSK---
TOP1_HELPJ        SPAKAKTIKNFLDK----------------------NYEVVASKG---HVR--DLSK---
TOP1_TREPA        SPAKAQTIEKYLGT----------------------QYVVRASMG---HVI--DLPK---
TOP1_LACLA        SPAKAKTIEKYLGR----------------------NYKVVASVG---HIR--DLKK---
TOP1_STAS1        SPAKAKTIEKYLGK----------------------KYKVIASMG---HVR--DLPR---
TOP1_STAAB        SPAKAKTIEKYLGK----------------------KYKVIASMG---HVR--DLPR---
TOP1_STAA8        SPAKAKTIEKYLGK----------------------KYKVIASMG---HVR--DLPR---
TOP1_STAAU        SPAKAKTIEKYLGK----------------------KYKVIASMG---HVR--DLPR---
TOP1_STAAM        SPAKAKTIEKYLGK----------------------KYKVIASMG---HVR--DLPR---
TOP1_STAHJ        SPAKAKTIEKYLGK----------------------KYKVIASMG---HVR--DLPR---
TOP1_STAES        SPAKAKTIEKYLGK----------------------RYKVIASMG---HVR--DLPR---
TOP1_BACSU        SPAKAKTIERYLGK----------------------KYKVKASMG---HVR--DLPK---
TOP1_BACHD        SPAKAKTIGKYLGK----------------------KYTVKASMG---HVR--DLPK---
A5CVH7_VESOH      SPTKAKTIEKFLGK----------------------DFSVKSSIG---HIR--DMPK---
Q28MI5_JANSC      SPAKAKTINKYLGS----------------------DYTVLASYG---HVR--DLPS---
TOP1_XYLFT        SPAKAKTINKYLGK----------------------DFTVLASYG---HVR--DLVP---
TOP1_XYLFA        SPAKAKTINKYLGK----------------------DFTVLASYG---HVR--DLVP---
TOP1_RICTY        SPAKAKTINKYLGD----------------------EFKVIASFG---HIR--DLPS---
TOP1_RICPR        SPAKAKTINKYLGD----------------------EFKVIASFG---HIR--DLPS---
TOP1_RICBR        SPAKAKTINKYLGD----------------------EFKVIASFG---HIR--DLPS---
TOP1_RICFE        SPAKAKTINKYLGD----------------------EFKVIASFG---HIR--DLPS---
TOP1_RICCN        SPAKAKTINKYLGD----------------------EFKVIASFG---HIR--DLPS---
B7J7I8_ACIF2      SPTKAHHIQAMLGS----------------------GWSVKATVG---HIR--DLPIKGD
Q7WXW8_PSEAI      APGKLKKLRSLLPS-----------------IRPDVTWQVEATAG---HIR--DLPVHGQ
C6XEP4_METGS      SPTKAKKLSEYLGS----------------------EYLVKASFG---HVR--DLPTSN-
B1M9R9_METRJ      SPNKVASIQGYLGD----------------------DWKVVASSG---HIR--DLPQ---
TOP1P_XYLFA       SPGKIEKLSTILGD----------------------GWKIAASVG---HVR--DLPQ---
C8W7T0_ATOPD      KNDAAQQIARLLSESGKPEADKVYNTPVYRFRRGGEDYVAIGLRG---HILQPDFPLALK
E1RJ15_METP4      KNIAAQRIAGILAENKKPSVKREEGVNTY-------SFDDKVAIGLRGHVV--EID----
C7P1M5_HALMD      KENAARRIAEILSDGAATAERENGVNVY--------RWGTKRCMGLSGHVV--GVD----
TOP1_THEAC        KADAGRRIAYFLSG-GQVKSHRAKGTSYLEFEYNGSKTYLIPLSG---HIV--EAD----
TOP1_ARCFU        KDNTARRIASILFKD-VKTL-KKGRVSYY-HSPSNDAY-VVGLKG---HIV--ELD----
B5IE55_ACIB4      KRNAAQRIAKILSG-GRYETIKKGRNAYYSFTKGKDRYFVVPLRG---HIL--HMD----
B1L3G6_KORCO      KPNVAKRIASILSE--GAKAKREGKVYYYEFDTGGERYYVAPAAG---HLL--ELD----
TOP1_AERPE        KPKAAAKIAYALSDGRGVLRCSEYGVPYWIVRRDGAAIVVAPSAG---HLF--GPHT---
A3DP02_STAMF      KPKAANKIALALSR--NPIRKSMYGIPYYLIKNRHSSIIVASAAG---HLY--GLHT---
B8D5I1_DESA1      KPKAAKKIASALSP--THNAKRIGSITIYEVDSYSSSIIIASSVG---HLY--QLHT---
K0IBM4_NITGG      KPDAARRIAQALGD---PKESKPAGISVFDVANSDCHYKVCSALG---HLY--GLADSTK
TOP1_METTH        KPKSSEKIAGALFP--DAMKKKHGKVSYWEHVEGDKRVTIVSAVG---HLY--SLRPRQS
F6D5C7_METPW      KPKAAEKISSALSK--GAAKKHYKKVPYYEFEENGKKTTVLTAVG---HLY--SLAPKDK
TOP1_METJA        KPSVAKKIANALGK---AKKKSIDGVPYYELERDGKKIIVASAVG---HLF--TLVEKEN
TOP1_PYRAB        KPNVARKIAGALSE-RRPIRKTIFGVPYYEVFRDGKKLIVASAVG---HLY--GLAPKQ-
TOP1_PYRHO        KPNVARKIAGALSE-RRPIKKSLFGVPYYEIFREGKKLIVASAVG---HLY--GLAPKR-
                                                              *   *.          

Q6F0G3_MESFL      ----------------------------------WGLG---IDLQT--M-----TPTFKI
F0V2L5_MYCS3      --------------------------------GWLNFG---PDNFEIKWSNIERKISYEN
Q9PPP9_UREPA      ----------------------------------KKSG---YDPKT--Y-----DLKWEI
TOP1_MYCGA        ----------------------------------YTLG---FNTED--F-----VPKWEI
TOP1_MYCPN        ----------------------------------KNFG---FNEAD--Y-----SPVWED
TOP1_MYCGE        ----------------------------------KNFG---FDENT--Y-----TPIWED
Q3M6J7_TRIV2      ----------------------------------DALG---FSMDGGSV-----QCHYVP
Q4AA55_MYCHJ      ----------------------------------FGLG---IDINT--W-----TPSYVL
B3PMD8_MYCA5      ----------------------------------DGLG---IDFTN--W-----EPMMIQ
TOP1P_MIMIV       ----------------------------------KKMS---IDFDND-F-----EPVYIV
Q8F5G0_LEPIN      ----------------------------------TTLG---LDLKNR-F-----EPEYVI
TOP1_BORBU        EIPK-----------------------EYKKYEWANIS---IDYNNG-F-----NPIYII
H8H3H1_DEIGI      DIPE-----------------------KYRDQAWARLG---INVDAG-Y-----APLYVS
B1VAJ5_PHYAS      ----------------------------------DRLG---IDIKNG-F-----IPKYEI
TOP1_FERIS        ----------------------------------KQFG---VDLNSL-------KLDFEI
TOP1_THEMA        ----------------------------------SKFG---VDLEKD-F-----EPEFAV
B2V7T0_SULSY      ----------------------------------NEMG---VDLNT--Y-----EPKFVI
TOP1_AQUAE        ----------------------------------KELG---VDLRT--L-----KAKYVY
D3SM80_THEAH      ----------------------------------DELG---VDLKT--L-----EPRYVF
G8QVT8_SPHPG      ----------------------------------DRMA---IDVANG-F-----ACDYKT
TOP1_SYNE7        DIPT-----------------------ELKGEKWSNLG---VDVENN-F-----APLYIV
TOP1_SYNY3        EVPA-----------------------AYKDKSWANLG---VNVEDH-F-----SPLYVI
TOP1_STRCO        EVPE-----------------------KYTGEV-RRLG---VDVEHD-F-----QPIYVV
TOP1_MYCTU        DVPA-----------------------KYKSQPWARLG---VNVDAD-F-----EPLYII
TOP1_MYCLE        DVPA-----------------------KFKSEPWARLG---VNVDAD-F-----EPLYII
I0II60_PHYMF      KGSS-----------------------KEDQ---VLPG---VDLARN-F-----EPTYEI
J9Z7K0_LEPFM      ----------------------------------SRLG---IDVDHD-F-----ALEFEV
TOP1_BUCAI        YNKE---------KNKKFLNENFIEKTNENKILIKQMG---IDPYQN-W-----KFEYHI
TOP1_BUCAP        KNKK--------------NIKKSNIKHNEKTALIQQMG---INPYKN-W-----KAEYHI
TOP1_PSEAE        SSSK---EPAAKGRKSASEAPALSPKEKARRQLVSRMG---VDPEHG-W-----KAKYEI
TOP1_VIBCH        TATPTGKAAAASTKKASTTDKEQQKREKERAALIKKMG---VDPYHG-W-----QANYQI
TOP1_ECOLI        AAKK--------SADSTSTKTAKKPKKDERGALVNRMG---VDPWHN-W-----EAHYEV
TOP1_SALTY        AAKK--------SADSTSTKTAKKPKKDERGALVNRMG---VDPWHN-W-----DAHYEV
TOP1_HAEIN        STGE--KAKPISTKGMDAEEKAKIKAEKERNALVKRMG---IDPYHD-W-----KANYQI
TOP1_PASMU        SNGE--KAKAISTKGLSAEEKSAIKQEKDRNALVKRMG---IDPYHQ-W-----KANYQI
TOP1_CAMJE        ----------------------------------SSFG---IKIEDDEF-----IPEYRI
TOP1_HELPY        ----------------------------------FALG---IKIDETGF-----TPNYVV
TOP1_HELPJ        ----------------------------------FALG---IKIDETGF-----TPNYVV
TOP1_TREPA        ----------------------------------SRLA---IDIEHD-F-----QPEYIT
TOP1_LACLA        ----------------------------------STMS---VDIEND-Y-----EPQYIN
TOP1_STAS1        ----------------------------------SQMG---VDAEND-Y-----EPKYIT
TOP1_STAAB        ----------------------------------SQMG---VDTEDN-Y-----EPKYIT
TOP1_STAA8        ----------------------------------SQMG---VDTEDN-Y-----EPKYIT
TOP1_STAAU        ----------------------------------SQMG---VDTEDN-Y-----EPKYIT
TOP1_STAAM        ----------------------------------SQMG---VDTEDN-Y-----EPKYIT
TOP1_STAHJ        ----------------------------------SQMG---VDVEDN-Y-----EPKYIT
TOP1_STAES        ----------------------------------SQMG---VDTEDN-Y-----EPKYIT
TOP1_BACSU        ----------------------------------SQMG---VDIEQN-F-----EPKYIT
TOP1_BACHD        ----------------------------------SQMG---VDIEDE-Y-----SPRYIT
A5CVH7_VESOH      ----------------------------------KNMG---IDIDNN-F-----TPTYEI
Q28MI5_JANSC      ----------------------------------KDGS---VDPEEG-F-----FMKWEI
TOP1_XYLFT        ----------------------------------KEGA---VDPENG-F-----AMRYDL
TOP1_XYLFA        ----------------------------------KEGA---VDPENG-F-----AMRYDL
TOP1_RICTY        ----------------------------------KKGS---VLPDKN-F-----AMEYDI
TOP1_RICPR        ----------------------------------KKGS---VLPDKN-F-----LMEYDI
TOP1_RICBR        ----------------------------------KKGS---VIPDEN-F-----SMKYDI
TOP1_RICFE        ----------------------------------KKGS---VLPDEN-F-----AMKYDI
TOP1_RICCN        ----------------------------------KKGS---VLPDEN-F-----AMKYDI
B7J7I8_ACIF2      A-----------------------------------AY---VRPPD--F-----KLNYEI
Q7WXW8_PSEAI      DP--------------------------------QMLT---VGVGQD-F-----KPHYQI
C6XEP4_METGS      ----------------------------------GEIG---YHPET--F-----EPIYEV
B1M9R9_METRJ      ----------------------------------REFG---ISKPD--F-----SLQYEY
TOP1P_XYLFA       ----------------------------------KEMG---VAAPD--F-----KPSYEL
C8W7T0_ATOPD      FDKEEGWYGETAEGEHLPADVPDGLERPPYKVKRKPFMADGVDLKG--WKIP--SLPYLI
E1RJ15_METP4      -----------------------------------------FEPGYSNWRSETHTPKSLI
C7P1M5_HALMD      -----------------------------------------FPPEYSDWR--DVEPAELV
TOP1_THEAC        -----------------------------------------FESGYSDWN--KIDLSDLI
TOP1_ARCFU        -----------------------------------------FPKELNNWT--K-TPLEKL
B5IE55_ACIB4      -----------------------------------------YPDEFKRWS--L-GDLQRL
B1L3G6_KORCO      -----------------------------------------YPPGK--WEYPSIVPPERL
TOP1_AERPE        ----------------------------------DSRG---FPVFDFEW-----RPIFEF
A3DP02_STAMF      ----------------------------------DQYG---YPVFKYEW-----KPLYQI
B8D5I1_DESA1      ----------------------------------SLRG---YPVYSYEW-----IPLHLT
K0IBM4_NITGG      ----------------------------------NRSV---YPVLDLEW-----APVDKN
TOP1_METTH        N---------------------------------EEHF---FDLE---W-----APIHEI
F6D5C7_METPW      KQ--------------------------------DKL----FDVE---W-----VPLYEK
TOP1_METJA        ----------------------------------KEFGF--YPVFDIKW-----VPASVD
TOP1_PYRAB        ----------------------------------DFFG---YPIFDIEW-----VPVYIA
TOP1_PYRHO        ----------------------------------DVFG---YPIFDIEW-----VPVYIA
                                                                              

Q6F0G3_MESFL      E-TT---------------------KKKNVSEIVKAGKSA-DKIILASDPDREGEAIAWH
F0V2L5_MYCS3      K------------------------KVSIIEAIKNEAKQA-SKIYLSTDPDREGEAIAWH
Q9PPP9_UREPA      IKTTNK------------KLS----KKQQIKTIIDLAKKS-NNIYLATDPDREGEAISWH
TOP1_MYCGA        IQEKKPAKGVSATKKAKTVKKAVKNKKEIIDELVDKAKKA-DEIYLATDPDREGEAISWH
TOP1_MYCPN        W-TKSKKKFSSLSFKGNLKGKKLLSKYDIIKSIKEKASKA-TNIYLATDPDREGEAISWH
TOP1_MYCGE        W-TKNKQK--------NPKQKHLLSKFEIIKSIKAKASDA-QNIFLASDPDREGEAISWH
Q3M6J7_TRIV2      RDQR---------------------SKETIQQLKSAAKQV-SEVVLATDPDREGETIAWH
Q4AA55_MYCHJ      D-KT---------------------KKKTIDEIKKLAKQA-KTVIIATDADREGEAIGAS
B3PMD8_MYCA5      D-RT---------------------KAKVIKALKDATKNA-KEVLIATDPDREGEAIAQN
TOP1P_MIMIV       T------------------------KPDVVKNLKSAMKNI-DLVYLAADEDREGEAIAQS
Q8F5G0_LEPIN      L-PG---------------------KKKILSEIIKTAKQS-QKVFLATDPDREGEFISAY
TOP1_BORBU        P-SN---------------------KKPIVSKLKKLVKTI-NEIYLATDQDREGETIAFH
H8H3H1_DEIGI      --RA---------------------RTGVLTDLRAATKAAGGDVYLASDPDREGESIAWH
B1VAJ5_PHYAS      I-KE---------------------KKTLVESLIKKTKN--KEIFLATDPDREGEAIAWH
TOP1_FERIS        I-PG---------------------KESVVEQIKKMTSG--KEVLLPSDQDREGEAIAWH
TOP1_THEMA        I-KG---------------------KEKVVEKLKDLAKK--GELLIASDMDREGEAIAWH
B2V7T0_SULSY      KSQN---------------------HKKILSEIKKLAEK--SEVIIATDPDREGYAIGFF
TOP1_AQUAE        K-RG---------------------KKKLVEQLKKLSRRS-SIVYLGTDPDREGEAIAYF
D3SM80_THEAH      V-RG---------------------KRKVWDQIKRTAQKC-ESIYIGTDPDREGEAIAYF
G8QVT8_SPHPG      V-EG---------------------KESLIRELKSSLKGV-DKLLLATDEDREGESISWH
TOP1_SYNE7        P-KD---------------------KKKIVKTLKDALKDA-DELILATDEDREGESISWH
TOP1_SYNY3        P-KS---------------------KKKVVKELQTALKNA-DEVILATDEDREGESISWH
TOP1_STRCO        N-AD---------------------KKSQVKKLKDLLKES-DELFLATDEDREGEAIAWH
TOP1_MYCTU        S-PE---------------------KRSTVSELRGLLKDV-DELYLATDGDREGEAIAWH
TOP1_MYCLE        T-PE---------------------KKSTVTELKGLLQGV-DELYLATDGDREGEAIAWH
I0II60_PHYMF      L-PD---------------------KKDTVSNLRKAAKVA-TDVYFATDLDREGEAIAWH
J9Z7K0_LEPFM      H-PD---------------------KKKVLSEIRSEARSA-REVYLASDPDREGEAIAYH
TOP1_BUCAI        L-PG---------------------KEKIISELKYIANQV-KHIYLATDLDREGEAIAWH
TOP1_BUCAP        L-PG---------------------KEKIISELKNIANKV-HYIYLATDLDREGEAIAWH
TOP1_PSEAE        L-PG---------------------KEKVIDELRRLAKDA-DTVYLATDLDREGEAIAWH
TOP1_VIBCH        L-PG---------------------KEKVVAELQKLAKDA-DSVYLATDLDREGEAIAWH
TOP1_ECOLI        L-PG---------------------KEKVVSELKQLAEKA-DHIYLATDLDREGEAIAWH
TOP1_SALTY        L-PG---------------------KEKVVSELKQLAEKA-DHIYLATDLDREGEAIAWH
TOP1_HAEIN        L-PG---------------------KEKVVSELKSLAKKA-DHIYLATDLDREGEAIAWH
TOP1_PASMU        L-PG---------------------KEKVVAELKSLAKKA-DHIYLATDLDREGEAIAWH
TOP1_CAMJE        T-SD---------------------HSALVKELKSKAKDA-KEVYLATDEDREGEAIAYH
TOP1_HELPY        D-KD---------------------HKELVKQIIELSKKA-SITYIATDEDREGEAIGYH
TOP1_HELPJ        D-KD---------------------HKELVKQIIELSKKA-SITYIATDEDREGEAIGYH
TOP1_TREPA        V-RG---------------------RAQCLKELRTLSKQS-LQVFLASDRDREGEAIAYH
TOP1_LACLA        I-RG---------------------KAPLINSLKKEAKAA-KAVYLASDPDREGEAISWH
TOP1_STAS1        I-RG---------------------KGPVVKELKKHAKKA-KKVFLASDPDREGEAIAWH
TOP1_STAAB        I-RG---------------------KGPVVKELKKHAKKA-KNVFLASDPDREGEAIAWH
TOP1_STAA8        I-RG---------------------KGPVVKELKKHAKKA-KNVFLASDPDREGEAIAWH
TOP1_STAAU        I-RG---------------------KGPVVKELKKHAKKA-KNVFLASDPDREGEAIAWH
TOP1_STAAM        I-RG---------------------KGPVVKELKKHAKKA-KNVFLASDPDREGEAIAWH
TOP1_STAHJ        I-RG---------------------KGPVVKDLKKYAKKA-KNVFLASDPDREGEAIAWH
TOP1_STAES        I-RG---------------------KGPVVKDLKKHAKKA-KKIFLASDPDREGEAIAWH
TOP1_BACSU        I-RG---------------------KGPVLKELKTAAKKA-KKVYLAADPDREGEAIAWH
TOP1_BACHD        I-RG---------------------KGPVLKELKSAAKKV-KRVYLAADPDREGEAIAWH
A5CVH7_VESOH      T-AD---------------------KKKVVTDLRKAVKVA-EKVYLATDEDREGEAIAWH
Q28MI5_JANSC      G-SD---------------------SKKHVKAIVDALKDD-NSLILATDPDREGEAISWH
TOP1_XYLFT        I-DK---------------------NEKHVEAITKAAKTA-DSIYLATDPDREGEAISWH
TOP1_XYLFA        I-DK---------------------NEKHVEAITKAAKTA-DSIYLATDPDREGEAISWH
TOP1_RICTY        S-DK---------------------ASKYVDAIVKYARKA-EAVYLATDPDREGESISWH
TOP1_RICPR        S-DK---------------------AGKYVDAIVKEARKA-EVVYLATDPDREGESISWH
TOP1_RICBR        S-EK---------------------AGKYVDAIIKDAKKA-ESVYLATDPDREGESISWH
TOP1_RICFE        S-DK---------------------AGKYVDAIVKDAKKA-DAVYLATDPDREGEAISWH
TOP1_RICCN        S-DK---------------------AGKYVDAIVKDAKKA-DAVYLATDPDREGESISWH
B7J7I8_ACIF2      T-ER---------------------ASKTVPALRAAARDA-ESVYIATDPDREGEAIAWH
Q7WXW8_PSEAI      L-SG---------------------KEKTVARLKELRQKA-VEIYVASDPDREGESIGWH
C6XEP4_METGS      T-EK---------------------ARTTIKVLKAAVKEC-DRVLLATDPDREGEAISWH
B1M9R9_METRJ      IPPQKV------------GNKTFPGAADRVARIKREVAKA-DAVYLATDPDREGEAISWH
TOP1P_XYLFA       TERG----------------------EGVVAKLKNLLKQA-DSVYLATDPDREGEAISWH
C8W7T0_ATOPD      WAPVDK------------QPA----EKEIIRALKNLAKKA-ESVIIGTDFDREGELIGSD
E1RJ15_METP4      D-AGTI------------KKPT---EKRIVQLIKRLAKKA-DHVIIATDFDREGELIGKE
C7P1M5_HALMD      AADVVK------------SAT----QENIVATLRKLARRA-DEATIATDYDREGELIGKE
TOP1_THEAC        DARIVK------------NIK----NKVAYQTLQAFRGKV-EEIVIATDYDREGELIGVE
TOP1_ARCFU        LQAELV------------KKVK---ERTISSILKEIAKKA-DRVTVATDYDREGELIGVE
B5IE55_ACIB4      VDEEPI------------KIIK---EKGIANILRTLAKDA-DMLIIATDYDREGELIGVE
B1L3G6_KORCO      VLKEIK------------G------KREYLKILEKLGKLS-NRIIVATDLDSEGSSIALE
TOP1_AERPE        D-RGAG------------Y------LSKFYRMLSRILPGA-SLYVNACDYDIEGSVIGFK
A3DP02_STAMF      D-PKAK------------H------TEKFIMVLSKLCSNA-DYYVNACDYDIEGSVIGYL
B8D5I1_DESA1      D-PSKK------------Y------IREYLEVLGKLCRGV-DYYVNACDYDIEGSVIGYL
K0IBM4_NITGG      --PR---------------------AARAIKVISELSKNA-SAFVHACDYDQEGEVIGHN
TOP1_METTH        DKKKGY-------------------VKDYLNVIRKFAAGA-DRYIHACDYDIEGTLIGFN
F6D5C7_METPW      DKKKKY-------------------VKNYIDAIKKLSKDA-DTFVHACDYDIEGTLIGYN
TOP1_METJA        KGKEY--------------------VNKYIKALKKLSKDA-DEFYIATDWDIEGELIGYH
TOP1_PYRAB        E-KNKD------------Y------AKDYIKALSVLAKRV-KEFIVACDYDTEGEVIGYT
TOP1_PYRHO        E-KGKE------------Y------AREYIKALSVLAKRV-REFIVACDYDTEGEVIGYT
                                                  :               * * **  *.  

Q6F0G3_MESFL      -LANLFA-----KDNKEIKRITFNEITESAVVKAFGE--MR-EI-DIDLVNAQLSRQMLD
F0V2L5_MYCS3      -IYSILG----KEHQKKCSRAVFNEITESAVKYSLEN--TR-QL-DQAQINSYLARVLLD
Q9PPP9_UREPA      -VYDLLP----KKDKERVKRITFNEITQKAILKSIDE--KH-DI-DFNLVDSQFARRILD
TOP1_MYCGA        -VYDVLK--EKGVNVNKCKRIIFNEISEKAVKNAIAN--PR-EI-QKDWVSSQITRRRLD
TOP1_MYCPN        -VYDVLD----EKDKSKCQRITFNEITKNAVLDALKN--PR-EI-DQSWVQSQFARQILD
TOP1_MYCGE        -VYDLLD----QKDKAKCKRITFNEITKKAVVDALKQ--PR-NI-DLNWVESQFARQILD
Q3M6J7_TRIV2      -LKEVLG-------LREPKRVVYTEITASAVQSAIAH--PR-KL-DLNLVGAGLCRDCLD
Q4AA55_MYCHJ      -LVEHLA------ITDKYQRIKYNEITKTAILEALEN--PG-EL-NQNLINSQQTRRMLD
B3PMD8_MYCA5      -LVDTLK------LSKIYRRIKYNEITAEAIKEALEN--PQ-MI-DDNLVKAQKTRRMLD
TOP1P_MIMIV       -LYDVLK-------PSNYKRLRFNAITKDAIMSAIKN--AG-DI-DKNLVDAQKARRVLD
Q8F5G0_LEPIN      -IRDRLQ------KKSNVFRIRFTEVTKQAILNSLQN--PD-TI-NEFLVDAQKTRRIGD
TOP1_BORBU        -LKEVLK-------IKNYKRMIFHEITETAITESLKN--TR-NI-DMNLVNAGEARRILD
H8H3H1_DEIGI      -LSVVLG-------LKDARRVTYQEVTKTAIQKALQN--PR-PI-NLALVAAQESRRILD
B1VAJ5_PHYAS      -LSKVLN-----LNPQMANRIVFREITKEVVLKALQN--PR-TV-DELLVFSQETRRMLD
TOP1_FERIS        -LSTILG-------VKGKNIITFTEITERAIKEAVKN--PR-EI-DMNKVNAQLARRVLD
TOP1_THEMA        -IARVTN------TLGRKNRIVFSEITPRVIREAVKN--PR-EI-DMKKVRAQLARRILD
B2V7T0_SULSY      -MYEELK-----KKAKEVKRAEFHEITKEHIKEKIKNAVPF-EKTNFGLFNAFLGRRVGD
TOP1_AQUAE        -LKKDLE-----KVNKNIKRAVFYEITPEAIRESIRN--AG-DV-NMNLVYAQFARRILD
D3SM80_THEAH      -LWNLLK-----PLGKKLYRVRFYEVSKEAITLSVQK--PE-DSPNMNLVRAQMARRVLD
G8QVT8_SPHPG      -LLEVLK------PKIPYQRMVFHEITKGAIQKALES--GR-DL-DLNLVQAQEGRRIVD
TOP1_SYNE7        -LLQLLQ------PRVPTKRMVFHEITQEAIQAALKN--CR-DV-DQRLVHAQETRRILD
TOP1_SYNY3        -LLQLLQ------PKVPIKRMVFHEITQEAIRSALEN--CR-DI-DENLVHAQETRRILD
TOP1_STRCO        -LQEVLK------PKIPVKRMVFHEITKDAIRAAVAN--PR-EL-NQKLVDAQETRRILD
TOP1_MYCTU        -LLETLK------PRIPVKRMVFHEITEPAIRAAAEH--PR-DL-DIDLVDAQETRRILD
TOP1_MYCLE        -LMQTLK------PRVPVKRMVFHEITEHAILAAAAH--PR-EL-DIDLVDAQETRRILD
I0II60_PHYMF      -LAEALK-----VPTDQAKRVVFNAITKSALEEAFAR--PR-GI-AIPRVDAQQTRRILD
J9Z7K0_LEPFM      -IASELE-----ALPVPPKRVLFHELTEGGIRSALSE--PG-EI-DVRKVEAQKARRALD
TOP1_BUCAI        -LKEVIG-----GDSSKFSRVVFNEITQHSIQKAFKN--VG-HI-NMNRVHAQQARRFMD
TOP1_BUCAP        -LKEVIG-----GNSLKFRRVVFNEITKKSIEKAFQN--IG-KI-NMNRVYSQQARRFMD
TOP1_PSEAE        -LREAIG-----GDESRYKRVVFNEITKKAIQEAFSQ--PG-EL-DINRVNAQQARRFLD
TOP1_VIBCH        -LREIIG-----GDEKRYKRVVFNEITKNAIQQAFKQ--PG-EL-NMDGVNAQQARRFMD
TOP1_ECOLI        -LREVIG-----GDDARYSRVVFNEITKNAIRQAFNK--PG-EL-NIDRVNAQQARRFMD
TOP1_SALTY        -LREVIG-----GDDARYSRVVFNEITKNAIRQAFEQ--PG-EL-NINRVNAQQARRFMD
TOP1_HAEIN        -LREVIG-----GNDDRFSRVVFNEITKNAIKQAFEK--PE-QL-NMDRVNAQQTRRFLD
TOP1_PASMU        -LREVIG-----GDDARFSRVVFNEITKNAIQQAFEK--PE-QL-NLDRVNAQQTRRFLD
TOP1_CAMJE        -IAKAIG-----KDENTLPRIVFHEITKSAIENALKN--PR-KL-NMHSVNAQQTRRLLD
TOP1_HELPY        -VACLIG-----GKLESYPRIVFHEITQNAILNALKT--PR-KI-DMSKVNAQQARRFLD
TOP1_HELPJ        -VACLIG-----GKLESYPRIVFHEITQNAILNVLKT--PR-KI-DMFKVNAQQARRLLD
TOP1_TREPA        -LAQSIQ----AYCDTPIKRIVFNEITPHAIRAAIGH--PV-PI-DTAKVNAQKARRVLD
TOP1_LACLA        -LAHILN-----LPLEEKNRVVFNEITKDAVKNAFKE--PR-QI-DVDLVDAQQARRVLD
TOP1_STAS1        -LANILN-----LEDSTENRVVFNEITKDAVKDSFKH--PR-GI-EMELVDAQQARRILD
TOP1_STAAB        -LSKILE-----LEDSKENRVVFNEITKDAVKESFKN--PR-EI-EMNLVDAQQARRILD
TOP1_STAA8        -LSKILE-----LEDSKENRVVFNEITKDAVKESFKN--PR-EI-EMNLVDAQQARRILD
TOP1_STAAU        -LSKILE-----LEDSKENRVVFNEITKDAVKESFKN--PR-EI-EMNLVDAQQARRILD
TOP1_STAAM        -LSKILE-----LEDSKENRVVFNEITKDAVKESFKN--PR-EI-EMNLVDAQQARRILD
TOP1_STAHJ        -LSKILE-----LDDSKENRVVFNEITKDAVKESFKH--PR-GI-EMDLVDAQQARRILD
TOP1_STAES        -LSKILE-----LEDSKENRVVFNEITKDAVKDSFKH--PR-GI-EMDLVDAQQARRILD
TOP1_BACSU        -LAHSLD-----LDLNSDCRVVFNEITKDAIKESFKH--PR-MI-NMDLVDAQQARRILD
TOP1_BACHD        -LAHSLD-----IDETSECRVVFNEITKQAIKDAFKS--PR-PI-NMDLVDAQQARRVLD
A5CVH7_VESOH      -LLEALN------LPKDTPRIVFHEITKNAITHAISE--PR-IV-NYRLVDAQQARRIID
Q28MI5_JANSC      -LQEALTSRKAIKTDTPVSRVTFNAITKDAVTKAMAE--PR-QV-DMELVEAYLARRALD
TOP1_XYLFT        -ISEILK-ERGLLKDKPMQRIVFTEITPRAIKEAIQK--PR-MI-ASDLVDAQQARRALD
TOP1_XYLFA        -ISEILK-ERGLLKDKPMQRIVFTEITPRAIKEAIQK--PR-MI-ASDLVDAQQARRALD
TOP1_RICTY        -VAEVIKEKNKVESDDFFKRVAFNEITKKAIIHAVEN--PR-KL-DTNLVNAQQARRALD
TOP1_RICPR        -VAEVIKEKNKVESDDFFKRVAFNEITKKAIMNAVAN--PR-KL-DTNLVNAQQARRALD
TOP1_RICBR        -IAEVIKEKNKVKSDDFFKRVAFNEITKKAITHAIEN--PR-KL-DNNLVNAQQARRALD
TOP1_RICFE        -VAEVIKEKNKVKSDDFFKRVAFNEITKKAIIHAVEN--PR-KL-DANLVNAQQARRALD
TOP1_RICCN        -VAEVIKEKNQVKSDDFFKRVAFNEITKKAIIHAVEN--PR-KL-DTNLVNAQQARRALD
B7J7I8_ACIF2      -VCQVLG-----IKPGAAKRVTYQEVTEPAIRKAIAA--PR-TV-NMPLVAAQEARRALD
Q7WXW8_PSEAI      -ILQAAG-------IKNYKRVAFKEITKSCITAELSS--PR-RL-DLPKVASQECRRVID
C6XEP4_METGS      -LAELLG-------LRKRERVKFHEITASAILKAINT--PS-AI-DTSLVRAQEARRIID
B1M9R9_METRJ      -LKEALQ-----LGEDDYERVTFTEITPKAIQAALRA--AR-RI-DMDLVHAQEGRRALD
TOP1P_XYLFA       -LQQCLK-------LSNPLRVTFNEITANAVKASLVA--PR-TI-DVKRVAAQEARRVLD
C8W7T0_ATOPD      ALAQVLS----VNPNLAVFRARYSAFTKTEIETAFNN--LV-DL-DYNLAAAGESRQYID
E1RJ15_METP4      -AYEIVR---AANKTVPIKRARFSAITKQEITSAFAN--PA-EL-DFNLAEAGEARQVVD
C7P1M5_HALMD      -AYELIR----EETDVPVDRVRFSSITDREVREAFAN--PD-EI-DFDLAAAGEARQVID
TOP1_THEAC        -ALDIIK-----EGKEEIRRAKFSALTKNEILDSFKN--LI-GV-NYSLADAADARESID
TOP1_ARCFU        -ALEIVK---SVNPTVKVDRVRYSAVTEKEIRSAFSK--PV-KV-DFNLANAALARQKID
B5IE55_ACIB4      -SLSITN------FKGPVKRAKFSALTEREIENAFSN--LV-DV-NYNLASAAETRQKID
B1L3G6_KORCO      -IIKALN-----WEGKEILRMEFSSLTKEEIRSSFRD--LK-PF-DYPRAYAGWVRRVID
TOP1_AERPE        -IIEAFG------DVNRARRMKFSTLAPQDIRRAYAR--ME-RL-DVEMIEAGMARSEMD
A3DP02_STAMF      -IIYFHG------DLEKSLRAKFSSLTIEELRESFRK--LT-SL-DWEMIEAGLCRHELD
B8D5I1_DESA1      -IIKFNG------DERKAFRARFSSLTIEELRKAFNN--LT-RL-DYEMIEAGLCRHELD
K0IBM4_NITGG      -ILQYAC----GGKYEKALRAKFSTLTDEEIRESFAS--LE-RP-SGGLAEAGRSRHMLD
TOP1_METTH        -ALKYGC---GEEALRKTSRMKFSTLTREEIQRAYKN--PI-EV-DYGQVDSGAARHILD
F6D5C7_METPW      -ALKYAC---GDESLKNVMRMKFSTLTDEDILKAYKK--PM-EL-DFKQVDSGIARHVLD
TOP1_METJA        -ALKYCC------GREKAKRMRFSSLTKKEIVRAFEN--PD-EI-DYGLVDAGESRHILD
TOP1_PYRAB        -ALKYAC----GVDPSRAKRMKFSALTKRDLLNAWRN--LEPTI-NFGMANAGIARHVLD
TOP1_PYRHO        -ALKYAC----GVDPRVAKRMKFSALTKRDLLNAWRN--LEPTI-NFGMANAGIARHILD
                                        :  .:   :                    :   *   *

Q6F0G3_MESFL      KIIGYMVSNSLQKST-----GLL---SAGRVQTPALKILVDRDKIIKAFVETI----YKK
F0V2L5_MYCS3      RWIGFNLSSYVRKKV-----GGQ---SAGRVQSIALKFLADRDEEIKSFQPKN----WFI
Q9PPP9_UREPA      RVIGYKLSGLVKKNL-----HGL---SAGRVQSIALLFVVERELERRSFVKEE----WYQ
TOP1_MYCGA        RLIGFKLSSLMKSKI-----NAD---SAGRVQSIALKFITEREELINKFVPRF----WWT
TOP1_MYCPN        RMIGFRLSRLLNNYL-----SAK---SAGRVQSVALRFLEEREQEIRSFVPRF----WWT
TOP1_MYCGE        RMIGFRLSRLLNSYL-----QAK---SAGRVQSVALRFLEEREKEIAKFVPRF----WWT
Q3M6J7_TRIV2      KLVGYKGSPLVWALNN----GAK---SVGRVQSSTLHLICQREREIQSFVPQD----YWS
Q4AA55_MYCHJ      RIIGFRLTALLKNKIK----NPPKNPAAGRVQSFALSLIFDREKEIREFIPEK----YFN
B3PMD8_MYCA5      RIIGFRLSQLMKRKVK----NAPSLPSAGRVQSIALKLVCDKEKEIKAFIPIK----YNK
TOP1P_MIMIV       RLFGYLISPILQRQIG----GKL---SAGRVQSVTVRIIIDKENEIKNFINKNADSSYFK
Q8F5G0_LEPIN      RLIGYFISPVLWKQIG----PGL---SAGRVQSVALKWICEREEEIRNFKIEI----YYN
TOP1_BORBU        RLYGYTISPLLWKKVA----YGL---SAGRVQSVGLKLLIEKEKTRINFKKAN----YYS
H8H3H1_DEIGI      RLAGYGVSPLLWDAIG----GPQ---SAGRVQSAALMLLAQREQSRLSFIPSA----YWR
B1VAJ5_PHYAS      RIIGFKLSRLV-RRI-----KSQ---SAGRVQSVALKLIVDLEKEINSFVPEE----YNL
TOP1_FERIS        RIVGYMISPLLWRIIK----DAR---SAGRVQSAALKIICERERERYRFVPQK----YFK
TOP1_THEMA        RIVGYSLSPVLWRNFK----SNL---SAGRVQSATLKLVCDREREILRFVPKK----YHR
B2V7T0_SULSY      RIVGYTLSPIASREIG----GRF---SVGRVQSPAVRLIVEREIEIQNFKPTP----YYV
TOP1_AQUAE        RLIGYLISPILWKEFK---NYKL---SAGRVQSPALRLIVEREREIQNFKVKK----YYY
D3SM80_THEAH      RLIGYLLSPKLWVYLK---NNRL---SVGRVQSPALRLIVERERQIRQFKKKK----FYY
G8QVT8_SPHPG      RLYGYTLSPTLWKKLA---NKRL---SAGRVQSVGLRLTVERERQRIAFTKSS----YFD
TOP1_SYNE7        RLVGYTLSPLLWKKIA----WGL---SAGRVQSVAVRLLVQRERARRAFRQGS----YWD
TOP1_SYNY3        RLVGYTLSPLLWKKIA----WGL---SAGRVQSVAVRLIVQRERARRAFKTAG----YWD
TOP1_STRCO        RLYGYEVSPVLWKKVM----PRL---SAGRVQSVATRLVVERERERIAFRSAE----YWD
TOP1_MYCTU        RLYGYEVSPVLWKKVA----PKL---SAGRVQSVATRIIVARERDRMAFRSAA----YWD
TOP1_MYCLE        RLYGYEVSPVLWKKVA----PKL---SAGRVQSVATRIIVQRERDRMAFCSAV----YWD
I0II60_PHYMF      RIVGYQVSPLLWRKVA----GGL---SAGRVQSVATRLVVERERAIEAFVPEE----FWK
J9Z7K0_LEPFM      RIVGYTISPLLWDRVR----RGL---SAGRVQSVAVRLVCDREDEIARFVREE----YWT
TOP1_BUCAI        RIVGYMISPLLWKKIA----RGL---SAGRVQSVAVRIIADRESIIKNFVPEE----YWK
TOP1_BUCAP        RIVGYMISPLLWKKIS----RGL---SAGRVQSAAVRLITDREYEIKNFIERE----HWK
TOP1_PSEAE        RVVGYMVSPLLWQKIA----RGL---SAGRVQSVAVKLVVEREREIRAFVPEE----YWE
TOP1_VIBCH        RVVGFMVSPLLWKKVA----RGL---SAGRVQSVAVKLLVEREREIKAFVPEE----FWD
TOP1_ECOLI        RVVGYMVSPLLWKKIA----RGL---SAGRVQSVAVRLVVEREREIKAFVPEE----FWE
TOP1_SALTY        RVVGYMVSPLLWKKIA----RGL---SAGRVQSVAVRLVVEREREIKAFVPEE----FWE
TOP1_HAEIN        RVVGFMVSPLLWKKVA----RGL---SAGRVQSVAVKLLVEREREIKAFQPEE----YWE
TOP1_PASMU        RVVGFMVSPLLWKKVA----RGL---SAGRVQSVAVKLVVEREREIKAFQPEE----YWE
TOP1_CAMJE        RIVGYKLSPLLGQKIQ----RGL---SAGRVQSAALKIIVDREKEIRAFVPLE----YFS
TOP1_HELPY        RIVGFKLSSLIASKIT----KGL---SAGRVQSAALKLVIDKEREIKAFKPLT----YFT
TOP1_HELPJ        RIVGFKLSSLIASKIT----KGL---SAGRVQSAALKLVIDREKEIRPFKPLT----YFT
TOP1_TREPA        RLVGYHLCPLLWHKVK----NGL---SAGRVQSVALRLICEREVEVKRFVPEE----YWT
TOP1_LACLA        RLVGYSISPILWKKVK----KGL---SAGRVQSIALKLIVDRENEINAFIPEE----YWS
TOP1_STAS1        RLVGYNISPVLWKKVK----KGL---SAGRVQSVALRLVIDRENEIRNFKPEE----YWK
TOP1_STAAB        RLVGYNISPVLWKKVK----KGL---SAGRVQSVALRLVIDRENEIRNFKPEE----YWI
TOP1_STAA8        RLVGYNISPVLWKKVK----KGL---SAGRVQSVALRLVIDRENEIRNFKPEE----YWT
TOP1_STAAU        RLVGYNISPVLWKKVK----KGL---SAGRVQSVALRLVIDRENEIRNFKPEE----YWT
TOP1_STAAM        RLVGYNISPVLWKKVK----KGL---SAGRVQSVALRLVIDRENEIRNFKPEE----YWT
TOP1_STAHJ        RLVGYNISPVLWKKVK----KGL---SAGRVQSVALRLVIDRENEIRNFKPEE----YWS
TOP1_STAES        RLVGYNISPVLWKKVK----KGL---SAGRVQSVALRLVIDRENEIRNFKPEE----YWS
TOP1_BACSU        RLVGYKISPILWKKVK----KGL---SAGRVQSVALRLIIDREKEINDFKPEE----YWT
TOP1_BACHD        RLVGYNISPLLWKKVK----KGL---SAGRVQSVAVKMIIDREKEIQAFEPEE----YWS
A5CVH7_VESOH      RLVGFEISPILWRKIS----GAR---SAGRVQSPVVRLVVEREREISKHIDNS----TYK
Q28MI5_JANSC      YLVGFNLSPVLWRKLP----GAK---SAGRVQSVCLRLVVEREMEIEAFRPRE----YWS
TOP1_XYLFT        YLVGFNLSPVLWRKVQ----RGL---SAGRVQSPALRMIVEREEEIEAFITRE----YWS
TOP1_XYLFA        YLVGFNLSPVLWRKVQ----RGL---SAGRVQSPALRMIVEREEEIEAFITRE----YWS
TOP1_RICTY        YLVGFTLSPLLWRKLP----GCK---SAGRVQSVALRLICDREDEIERFKAEE----YWD
TOP1_RICPR        YLVGFTLSPLLWRKLP----GCK---SAGRVQSVALRLICDREDEIERFKSEE----YWD
TOP1_RICBR        YLVGFTLSPLLWRKLP----GCK---SAGRVQSVALRLICEREDEIERFKSEE----YWD
TOP1_RICFE        YLVGFTLSPLLWRKLP----GCK---SAGRVQSVALRLICEREDEIERFKSEE----YWD
TOP1_RICCN        YLVGFTLSPLLWRKLP----GCK---SAGRVQSVALRLICEREDEIERFKSEE----YWD
B7J7I8_ACIF2      RIVGWEVSGPLSNAIG----SRA---SAGRVQTPALSLVVAREQAIRQFKPTP----WFQ
Q7WXW8_PSEAI      RLVGYLVTPELRRVMG----RPT---TAGRVQSVAVYLVVLREREIRAFTAIK----HFG
C6XEP4_METGS      RQVGWLVSGPLTRKIG----QRA---SAGRVQSPALALVVEREREILAFKKEA----FFT
B1M9R9_METRJ      RFVGYMVSPLLSDMLG----MNL---SAGRVQSVAVRLVVDLERRIAAFKSTK----HFS
TOP1P_XYLFA       RLVGYMVSPELSRLTG----KRL---SAGRVQSPAVRLVVEREREIKAFKVTN----HFG
C8W7T0_ATOPD      LIWGAVLTRYLTTARFGGLGNTR---SAGRVQTPTLALVVERERERLAFKPED----YWV
E1RJ15_METP4      LIWGASLTRFISLAAKRGGNNIL---SVGRVQSPTLAMIVDREKEIEAFVPEP----YWM
C7P1M5_HALMD      LVWGAALTRFLSLSARQLGDDFI---SVGRVQSPTLKLIVDREREIQAFDPED----YWE
TOP1_THEAC        LIWGSVLTRFFSVTTGRLGKSFL---SAGRVQTPTLAIVVDREREIQSFRPER----YWT
TOP1_ARCFU        LIWGATLTRLISVHSGRMGKDFL---SVGRVQTPTLRLIVDRELEIQNFKPEK----YYE
B5IE55_ACIB4      LAWGASLTRFISLASSRRGKDYL---SVGRVQSPTLALIVKREKEIENFVPTP----YWN
B1L3G6_KORCO      LEWGANVSRGLTLSTR--RKGWVRVLSSGRVQGPTLSMIVKREREIREFVPKK----YYT
TOP1_AERPE        WLWGINVSRALMEAARRAAGRRV-ILSAGRVQSPTLVEAYRRWREINLHVPKA----SVA
A3DP02_STAMF      WIWGINISRALMSSVKIASGKRV-ILSAGRVQTPTLRYVVEKDIERRLFIPLP----QYS
B8D5I1_DESA1      WIWGINVSRALMKAVEDAVGERI-ILSAGRVQTPTLKYVVDKVVERNLFIPLP----QYN
K0IBM4_NITGG      FIYGVNLSRALAQSLK-MASNGYCNLSIGRVQGPTLAFAVDRELEIRLHVPDP----YWT
TOP1_METTH        FIFGVNISRSLMKSVKAATNRFI-KLSAGRVQTPTLAILVEREKEIRDFKPVP----YWI
F6D5C7_METPW      FFFGVNMSKHLTDSVMKATKRYI-QLSAGRVQTPTLSILVDREKEIKEFIPVP----YWL
TOP1_METJA        WYFGINLSRALMNAIR-AVNRWK-TMSVGRVQGPALAFLTERELEIKKFIPKP----YWV
TOP1_PYRAB        WYWGVNLSRALTHAIKRASGKWV-VLSTGRVQGPTLKFLVEREREIQSFVPKP----YWV
TOP1_PYRHO        WYWGVNLSRALTHAIKKASGKWV-VLSTGRVQGPTLKFLVEREREIQSFVPRP----YWV
                     *                      : ****                .           

Q6F0G3_MESFL      IFVMDS-KQNVK---------------------------------LFLYKDDNNLVVNDP
F0V2L5_MYCS3      LKVQLQ-VGLTITLFK-----------------------------LSEAAESQVVLSPHG
Q9PPP9_UREPA      IEGIIE-KNIFVSLRKIP---------------------------YDVELYNQKDNSDSD
TOP1_MYCGA        LDVILK-DGTELMLRKIDEK-------------------------LKDKLGFKELEEVSG
TOP1_MYCPN        LDVLLNPKAEGVREACANRS-------------------------IPIVLREINPALRAG
TOP1_MYCGE        VDVLLN-KENNQKVVCANKSIPLVLRE------------------INPELSASLKLDFEA
Q3M6J7_TRIV2      VWVDYV-EG------------------------------------FRAFYKG----AVNT
Q4AA55_MYCHJ      LEVKIN-DENGN---------------------------------FFDTIYCNQQNEAKK
B3PMD8_MYCA5      IQAKIS-ED------------------------------------VIADFYYPTNSDFKN
TOP1P_MIMIV       VSGTFN-GAKATLHESNDKKP------------------------FDLETA------YKG
Q8F5G0_LEPIN      ILLHGT-DQKG----------------------------------IVGIFSR-----TGD
TOP1_BORBU        ILLQCK-HEKKNLL-------------------------------LEAKLEE-----IDG
H8H3H1_DEIGI      VTASVG-TTPT----------------------------------FQASVQA-----IRG
B1VAJ5_PHYAS      ITAFFP-F-------------------------------------FQAEYQN-----PNN
TOP1_FERIS        VWIDIA-G-------------------------------------LKAYLTK-----VDG
TOP1_THEMA        ITVNFD-G-------------------------------------LTAEID------VKE
B2V7T0_SULSY      LSAVLRATSHVSPLT------------------------------FTAI--------YEN
TOP1_AQUAE        VKALLR-KGSEE---------------------------------FWAIYDY-----RYE
D3SM80_THEAH      IKAVFE-KNGHT---------------------------------FHLIWDY-----RFE
G8QVT8_SPHPG      AKVDLL-SSDGQ------Q--------------------------FEAKLFS-----YQE
TOP1_SYNE7        LKAQLT-VEAGQ---------------------------------FEAKLWT-----LAG
TOP1_SYNY3        LKAELE-QNKNP---------------------------------FQAKLMT-----LGG
TOP1_STRCO        LTGTFA-TGRAGDASDPSS--------------------------LVARLQT-----VDG
TOP1_MYCTU        ILAKLD-ASVSDPDAAPPT--------------------------FSARLTA-----VAG
TOP1_MYCLE        IVAKLD-ASVSDPTAQPLT--------------------------FVARLTA-----VDG
I0II60_PHYMF      LTGFFT-PKMDEAKKLGDAWRDFLKKSGEDVTIKNQNGFLSENGVLRAELDT-----VGG
J9Z7K0_LEPFM      IDARFR-PGDPRVPPT-----------------------------FLARLDR-----VSG
TOP1_BUCAI        LDVSLI-SQDKKK--------------------------------INMDVTH-----YNN
TOP1_BUCAP        ISLSLLSKENKK---------------------------------VTMDITH-----YRN
TOP1_PSEAE        VHADLG-TAKGAN--------------------------------VRFEVTR-----EKG
TOP1_VIBCH        INADTL-TADKQD--------------------------------FRLLVAQ-----KDG
TOP1_ECOLI        VDASTT-TPSGEA--------------------------------LALQVTH-----QND
TOP1_SALTY        IDANTT-TPSGEA--------------------------------LPLQVTH-----QND
TOP1_HAEIN        VAVLTN-NQNKQA--------------------------------IRLDVTD-----YKG
TOP1_PASMU        IDVLTQ-TQAKQA--------------------------------LRLAVTQ-----FKG
TOP1_CAMJE        IDMIFQ-KD------------------------------------LDAELVE-----FDK
TOP1_HELPY        LDAYFE-SH------------------------------------LEAQLIS-----YKG
TOP1_HELPJ        LDALFE-PH------------------------------------LEAQLIS-----YKG
TOP1_TREPA        VEGTFE-KDKKS---------------------------------FSALLIL-----IQG
TOP1_LACLA        IDGEFK-KGTKK---------------------------------FKASFWG-----IDG
TOP1_STAS1        IEGEFR-YKKTK---------------------------------FTAKFLH-----FKN
TOP1_STAAB        IEGEFR-YKKSK---------------------------------FNAKFLH-----YKN
TOP1_STAA8        IEGEFR-YKKSK---------------------------------FNAKFLH-----YKN
TOP1_STAAU        IEGEFR-YKKSK---------------------------------FNAKFLH-----YKN
TOP1_STAAM        IEGEFR-YKKSK---------------------------------FNAKFLH-----YKN
TOP1_STAHJ        IEGEFR-YKKSK---------------------------------FTAKFLH-----YKN
TOP1_STAES        IEGEFR-YKKSK---------------------------------FTAKFLH-----YKN
TOP1_BACSU        IDGTFL-KGQET---------------------------------FEASFFG-----KNG
TOP1_BACHD        IQGTFA-LDGEP---------------------------------FEAKFYG-----TNG
A5CVH7_VESOH      VKAELS-SESGEI--------------------------------FKVKLSK--------
Q28MI5_JANSC      VRAVLE-TPRGQT--------------------------------IEARLTV-----LGG
TOP1_XYLFT        IHAECT-HPAQH---------------------------------FSAKLIK-----LDG
TOP1_XYLFA        IHAECA-HPAQH---------------------------------FSAKLIK-----LDG
TOP1_RICTY        ISLKMQ-NSNNEL--------------------------------FTAKLTH-----VND
TOP1_RICPR        ISLKMQ-NSNNDL--------------------------------FTAKLTH-----VND
TOP1_RICBR        ISLKML-NSNNEL--------------------------------FTAKLTH-----IND
TOP1_RICFE        ISLKMQ-NSNNEL--------------------------------FTAKLTH-----VND
TOP1_RICCN        ISLKMQ-NSNNEL--------------------------------FTAKLTH-----VND
B7J7I8_ACIF2      VLAHVA-GKDAAPD-------------------------------WRAVWVD----GTQE
Q7WXW8_PSEAI      VELTFV-SPSDGRT-------------------------------WTAEWDPVPVFASEE
C6XEP4_METGS      VEAEFS-EE------------------------------------WGAVWPS------DE
B1M9R9_METRJ      AVVTFDAGAGAK---------------------------------WSAQWDTKPYV-TED
TOP1P_XYLFA       AMLFFA-DAKTSGE-------------------------------WSAEWLTKPKFVAED
C8W7T0_ATOPD      ISGVASPEDDDEAT-------------------------------FKMV--------HQT
E1RJ15_METP4      ISLDSE-TEEEK---------------------------------FEAR--------HTE
C7P1M5_HALMD      IFGDLQ-GDDAA---------------------------------FEAQYFY-----DDD
TOP1_THEAC        ISITFD-KDGQ----------------------------------FKARYPE--------
TOP1_ARCFU        IFAEFE------------------------------------------GFIA-----KHP
B5IE55_ACIB4      IKGLFF-KRRN----------------------------------FSGM--------HIS
B1L3G6_KORCO      VIVKVD-KG------------------------------------FSLELAP-----PKG
TOP1_AERPE        VKITAE-KGGGV---------------------------------FDARPHG-----WKP
A3DP02_STAMF      LSINIF-KNN-----------------------------------YEIHVE------YKG
B8D5I1_DESA1      INITVE-KNGEK---------------------------------IRLE--------YTG
K0IBM4_NITGG      IAAQFE-KNNQT---------------------------------FSAQYEK-----PKV
TOP1_METTH        IRAELG-EG------------------------------------IIAE--------SKR
F6D5C7_METPW      IKADLDVTGVKEG--------------------------------ITAD--------HKK
TOP1_METJA        IEALLK-DN------------------------------------LKAI--------HEK
TOP1_PYRAB        IKLVIE-KNGQK---------------------------------LVAN--------YEK
TOP1_PYRHO        IKLIFE-KNGQK---------------------------------FTAN--------YEK
                                                                              

Q6F0G3_MESFL      KNY------------------------YISEEQSKVIINNL-------------------
F0V2L5_MYCS3      KKG---------------------VVSFQKKEDLERIINDH-------------------
Q9PPP9_UREPA      LKF-------------------------LHKKDAQRVIDDL-------------------
TOP1_MYCGA        IDF-------------------------NTKEDAELVKQHL-------------------
TOP1_MYCPN        LKF--------------EEEKSVSGIDFLDEASAKKFGEQL-------------------
TOP1_MYCGE        AEN-------------------VSGIDFLNEASATRFANQL-------------------
Q3M6J7_TRIV2      RSDSPETEVEIHDDAAGNSTTAPESTRVLAEAEANRLVEEA-------------------
Q4AA55_MYCHJ      VNW------------------------INSEEELSEIIAEI-------------------
B3PMD8_MYCA5      DNT------------------------WILPEKIDSIVAEL-------------------
TOP1P_MIMIV       KTA--------------------QIALINSENPNSKVVNFM-------------------
Q8F5G0_LEPIN      RIF--------------------------SKEKADQILQNV-------------------
TOP1_BORBU        KNIAEGKDFVNETGKLKNIA----KTTIITQDLMIELEKEL-------------------
H8H3H1_DEIGI      LPLATAASFTAQGQLKEGI-----EVAQLDAQKAEGLRAYL-------------------
B1VAJ5_PHYAS      KKI--------------------------KSAEALGIVAKI-------------------
TOP1_FERIS        KKI---------------------KPTDITEEISKDVLQKV-------------------
TOP1_THEMA        KKF-------------------------FDAETLKEIQ----------------------
B2V7T0_SULSY      PKI-------------------------ENKEEAEKIYADI-------------------
TOP1_AQUAE        NP-----------------------------SDAKIIAKKL-------------------
D3SM80_THEAH      KP-----------------------------ENAKPYLEKL-------------------
G8QVT8_SPHPG      KSIAQSKDFDSVSGIYKGKA----SVLLLDKNQLHAIVQDL-------------------
TOP1_SYNE7        QRLATGNDFDESTGQIIAG----RQVCLLDQQEAEALRDRL-------------------
TOP1_SYNY3        TKLANGSDFDPNTGALLPD----KQVVVLDEAQAIALKERL-------------------
TOP1_STRCO        RRVAQGRDFD-SLGQLKSAN-----TLHLDEANARALAAAL-------------------
TOP1_MYCTU        RRVATGRDFD-SLGTLRKGD----EVIVLDEGSATALAAGL-------------------
TOP1_MYCLE        LRVATGRDFG-AMGTLR-GDCEVSKIIVLDDLTATTLAAGL-------------------
I0II60_PHYMF      RKW-----------------------KTDDREQALALAESLGFVLDDAVETEHPDEKGPA
J9Z7K0_LEPFM      EKP-----------------------VLPDEETAGRTVERI-------------------
TOP1_BUCAI        KKF-----------------------RPINENEVSFAVEKI-------------------
TOP1_BUCAP        KTF-----------------------LLNNKKEVNSTIEKI-------------------
TOP1_PSEAE        EAF-----------------------KPLNEAQAMAALEKL-------------------
TOP1_VIBCH        LAF-----------------------KPVNETEALAAVAAL-------------------
TOP1_ECOLI        KPF-----------------------RPVNKEQTQAAVSLL-------------------
TOP1_SALTY        KPF-----------------------RPVNREQTLAAVSLL-------------------
TOP1_HAEIN        KKF-----------------------DPKNQKEAQSAVDFL-------------------
TOP1_PASMU        KKF-----------------------EPKNATQAQSAVDFL-------------------
TOP1_CAMJE        AKI--------------------EKLTITNKDRAKLILEAC-------------------
TOP1_HELPY        NKL--------------------KAQELIDEKKAQEIKNEL-------------------
TOP1_HELPJ        NKL--------------------KAQELIDEKKAQEIKNEL-------------------
TOP1_TREPA        KKA-----------------------VFKSKQEATSAIGLF-------------------
TOP1_LACLA        KKH-----------------------PLKTNEDVIKVMERL-------------------
TOP1_STAS1        KPF-----------------------KLTEKADVEKITTQL-------------------
TOP1_STAAB        KPF-----------------------KLKTKKDIEKITAAL-------------------
TOP1_STAA8        KPF-----------------------KLKTKKDVEKITAAL-------------------
TOP1_STAAU        KPF-----------------------KLKTKKDVEKITTAL-------------------
TOP1_STAAM        KPF-----------------------KLKTKKDVEKITAAL-------------------
TOP1_STAHJ        KPF-----------------------KLKTKKDVEKVTAEL-------------------
TOP1_STAES        KPY-----------------------KLNNKDDVQRITEAL-------------------
TOP1_BACSU        KKL-----------------------PLNSEADVKEILSQL-------------------
TOP1_BACHD        KKV-----------------------ELKSEDDVNNVLAKL-------------------
A5CVH7_VESOH      --------------------------EFKSKKQVLAFANIL-------------------
Q28MI5_JANSC      KKL--------------------DRYDLPSAAEAGLAVQAV-------------------
TOP1_XYLFT        KKF--------------------EQFTITDSDTAAAAQRRI-------------------
TOP1_XYLFA        QKF--------------------EQFTITDSDTAAAAQRRI-------------------
TOP1_RICTY        QKL--------------------KKFSIINEKEAKDLTRKL-------------------
TOP1_RICPR        QKL--------------------KKFSIINEKEAKDLTQKL-------------------
TOP1_RICBR        QKL--------------------EKFSITNDKEAKDLTEKL-------------------
TOP1_RICFE        QKL--------------------EKFSIINEKDAKDLTEKL-------------------
TOP1_RICCN        QKL--------------------EKFSIINEKNAKDLTKKL-------------------
B7J7I8_ACIF2      GEY------------------------FQDKAHAKALADAL-------------------
Q7WXW8_PSEAI      FPY------------------------VQDRQLAELVGA---------------------
C6XEP4_METGS      QQC-------------------------KDRSVAETIAESK-------------------
B1M9R9_METRJ      SPY------------------------VLDEALAAKASQSR-------------------
TOP1P_XYLFA       NPY------------------------FMDRDFAAAVAQ---------------------
C8W7T0_ATOPD      ARF-------------------------WDQAEADTVYDVV-------------------
E1RJ15_METP4      GKF-------------------------WDKESAERSLKGT-------------------
C7P1M5_HALMD      GSE---------------------AERVWDEATAESVYEDL-------------------
TOP1_THEAC        --------------------------NIKDQDTAEKIYEAI-------------------
TOP1_ARCFU        KRY-------------------------GSKEEAEKLFAKI-------------------
B5IE55_ACIB4      NPF-------------------------WKEEEAMEVYEKV-------------------
B1L3G6_KORCO      EER------------------------IWDQDYARRAAESV-------------------
TOP1_AERPE        QSL----------------------------ETARSIKSEL-------------------
A3DP02_STAMF      KSV-------------------------ETKKNAKEIIDEI-------------------
B8D5I1_DESA1      NPV-------------------------EKERDARDIVEKI-------------------
K0IBM4_NITGG      GTL----------------------------AEAKSIVSAC-------------------
TOP1_METTH        GKI-------------------------FKRELVDSILEKC-------------------
F6D5C7_METPW      GKI-------------------------LEKKDADAILVEC-------------------
TOP1_METJA        EKF-------------------------WNEKEAKNVYEKI-------------------
TOP1_PYRAB        DKI-------------------------WSEEEAKKIVTEV-------------------
TOP1_PYRHO        DKI-------------------------WEEEEGKRIVLEV-------------------
                                                                              

Q6F0G3_MESFL      ------------GE---DYKCTKYKA-KEFEVRSFK-PYSTASLLQDGFSKLRMSAA---
F0V2L5_MYCS3      -----------LDD---HYILEEIGEKKLETSSPPE-VLKTSTLFELAINKLGLKAE---
Q9PPP9_UREPA      -----------SD----IFKVYSIDDLKITKGDVQL-PLTTDKLLQIASNNFGWSAN---
TOP1_MYCGA        -----------SD----KYRVYAIDTPKLKSSYPKE-VYKTSTLQQDAINKLKWRSM---
TOP1_MYCPN        -----------KG----VFEVYNIDETKHYSSSPNS-AYTTASLQKDAINKLGWSSK---
TOP1_MYCGE        -----------TG----EYEVYFIDEPKIYYSSPNP-VYTTASLQKDAINKLGWSSK---
Q3M6J7_TRIV2      -----------RRH---PHQIVQYEG-KIANRQPPP-PFITSTLQQAAGSKLKFAPE---
Q4AA55_MYCHJ      -----------KEN---PYLIFKKYS-KATRKDPKVIPLKQATIFKKMSQ---YSSA---
B3PMD8_MYCA5      -----------NKNK--SLLVKDFKV-SQRKESQIT-PFKQSVLYKEA----KYSAT---
TOP1P_MIMIV       -----------KRCLKSQFFIHSVED-KMTTRSPAP-PFTTSTLQQEANRKFGMSID---
Q8F5G0_LEPIN      -----------QKEK--EFRISEKKE-TLGKLFPPP-PFQTASLQQEAFKKLRFSSK---
TOP1_BORBU        ----------KNGQ---KIELISIET-KKIKIPPPK-PFTTSTLQQEINKRLKIGTK---
H8H3H1_DEIGI      -----------EGR---DAEITNIEV-SPITRRPPP-PFTTSSLQQAAGARLHLGVE---
B1VAJ5_PHYAS      -----------TNK---PFIVKKIKQ-TETFSKPKK-PLITSTLQQEAINNLYMTSN---
TOP1_FERIS        -----------K-----SVRLVDIDV-KEVRKNPPA-PFITSTLQQDAASKLGFPVS---
TOP1_THEMA        -----------SID---ELVVEEKKV-SVKKFAPPE-PFKTSTLQQEAYSKLGFSVS---
B2V7T0_SULSY      -----------KDEK--IATIKKVEK-KQVKQSPKP-PFTTSTLQQTASTVYRFAPE---
TOP1_AQUAE        -----------EKG---YFSVYKVEK-KKEKVSPPK-PFITSDLQSEANAKFGFSSE---
D3SM80_THEAH      -----------KSV---PFEVERVVR-GKVKKEPPK-PFHTANLQAVASQKLGVGVD---
G8QVT8_SPHPG      -----------NGA---PYEIVDIQR-KPFLTRPNI-PFTTSTLQQDAIKKLHFSAS---
TOP1_SYNE7        -----------QTQ---PWQVKSLEE-KPTTRKPAP-PFTTSTLQQESNRKLRLSAR---
TOP1_SYNY3        -----------TGK---PWAVVNTEE-KPGVRKPSP-PFTTSTLQQEANRKLGISAR---
TOP1_STRCO        -----------ENT---RFAVRSVES-KPYRRSPYA-PFRTTTLQQEASRKLGFGAK---
TOP1_MYCTU        -----------DGT---QLTVASAEE-KPYARRPYP-PFMTSTLQQEASRKLRFSAE---
TOP1_MYCLE        -----------RGA---QLTVASAEE-KLYTRRPYP-PFMTSTLQQEAGRKLRFSAE---
I0II60_PHYMF      QKQVRFLGGIGNAP---DYKIQSVET-KRTKRRPAP-PFITSTLQQRASSYLGFNLK---
J9Z7K0_LEPFM      -----------RRE---RFTVGEITR-ADKKRNPSP-PLTTSRLQQEAANRLRFSAK---
TOP1_BUCAI        -----------QKS---SCIVKNYEE-KISYLKAPA-PFITSTLQQSASLRLGFSVK---
TOP1_BUCAP        -----------KNL---SFIITDRKD-KIFKKKPPA-PLITSTLQQASNIDLGFSVK---
TOP1_PSEAE        -----------KAS---AYSVAKRED-RPTSSRPSA-PFITSTLQQAASNRLGFGVK---
TOP1_VIBCH        -----------NKA---QYEVCKRED-KPTTSKPSA-PFITSTLQQAASTRLGYGVK---
TOP1_ECOLI        -----------EKA---RYSVLERED-KPTTSKPGA-PFITSTLQQAASTRLGFGVK---
TOP1_SALTY        -----------EKA---RYSVLERED-KPTSSKPGA-PFITSTLQQAASTRLGFGVK---
TOP1_HAEIN        -----------NVS---DYVVTDLET-KPTSSRPRA-PFITSTLQQTASTRLGFGVK---
TOP1_PASMU        -----------QHA---DYVVSDLET-KPTHSRAKA-PFITSTLQQTASTRLGFGVK---
TOP1_CAMJE        -----------KNE---VYSISDIES-KERKIAPPP-PFMTSTLQQSASNRLGFNPK---
TOP1_HELPY        -----------EKE---SYAISSIVK-KSKKSPTPP-PFMTSTLQQSASSLLGFSPT---
TOP1_HELPJ        -----------EKE---SYIISSIIK-KSKKSPTPP-PFMTSTLQQSASSLLGFSPT---
TOP1_TREPA        -----------SQS---EARVSQIRS-FEKNVRPKQ-PFTTSTLQQCAANRLGFTSR---
TOP1_LACLA        -----------DGP---DFNVDKVEK-KERRRNAPL-PYTTSSMQQDAANKLNFRTR---
TOP1_STAS1        -----------DGD---QFEVTKVTK-KEKTRYPAN-PFTTSTLQQEAARKLNFKAR---
TOP1_STAAB        -----------DGD---QFEITNVTK-KEKTRNPAN-PFTTSTLQQEAARKLNFKAR---
TOP1_STAA8        -----------DGD---QFEITNVTK-KEKTRNPAN-PFTTSTLQQEAARKLNFKAR---
TOP1_STAAU        -----------DGD---QFEITNVTK-KEKTRNPAN-PFTTSTLQQEAARKLNFKAR---
TOP1_STAAM        -----------DGD---QFEITNVTK-KEKTRNPAN-PFTTSTLQQEAARKLNFKAR---
TOP1_STAHJ        -----------DGD---KFEITNVNK-KEKTRNPAN-PFTTSTLQQEAARKLNFKAR---
TOP1_STAES        -----------NGD---QFEITNVNR-KEKTRYPAH-PFTTSTLQQEAARKLNFKAR---
TOP1_BACSU        -----------KGN---QYTVEKVTK-KERKRNPAL-PFTTSTLQQEAARKLNFRAK---
TOP1_BACHD        -----------KGD---QFHVDSVQK-KERKRNPVS-PFTTSSLQQEAARKLNFRAK---
A5CVH7_VESOH      -----------LLA---NLTITSIEK-KPFKRSPKP-PFITSTLQQEAFQKLGFSVK---
Q28MI5_JANSC      -----------SSR---KLSVSDVEA-KPANRNPSP-PFMTSTLQQEASRKLGMGAK---
TOP1_XYLFT        -----------QQAAQGRLHITDVTN-KERKRRPAP-PFITSTLQQEASRKLGFTTR---
TOP1_XYLFA        -----------QQVAQGRLHITDVTN-KERKRRPAP-PFITSTLQQEASRKLGFTTR---
TOP1_RICTY        -----------KLQ---KFYVEKIEK-KQQKRQPQP-PFITSSLQQEAARKLGFSAK---
TOP1_RICPR        -----------KLQ---KFYVEKIEK-KQQKRQPQP-PFITSSLQQEAARKLGFSAK---
TOP1_RICBR        -----------KSQ---NFHVDKIEK-KQQKRQPQP-PFITSSLQQEAARKLGFSAK---
TOP1_RICFE        -----------KSQ---NFHVDKIEK-KQQKRQPQP-PFITSSLQQEAARKLGFSAK---
TOP1_RICCN        -----------KSH---KFHVDKIEK-KQQKRQPQP-PFITSSLQQEAARKLGFSAK---
B7J7I8_ACIF2      -----------PSM---ALKVTKAET-KPVRKPPAP-PFTTSSMQMDGARALKAPVD---
Q7WXW8_PSEAI      ------------IR---NVIVETCID-SEETDAPPA-PFISSSLQMAAGNALKWSPD---
C6XEP4_METGS      -----------------QFSVLEYDL-SKLHEDPPP-PFRTSKLLQAASVVLGFDPK---
B1M9R9_METRJ      -----------------QFVVLESKT-EEKSERPPS-PLSTLGMLRAASTALKMSSA---
TOP1P_XYLFA       ------------VK---AVVVKSFDE-SEAKRSPPP-PFTTSTMQQAASVTLGVDPK---
C8W7T0_ATOPD      -----------KDQT--QATVVEIES-RSRKQQPPA-PFNTTSLQAAAAAE-GISPA---
E1RJ15_METP4      -----------KE----PLTVIDIKE-GTRADHAPT-PFDTTAYIVAAS-RLGLSAS---
C7P1M5_HALMD      -----------AALD--AATVTSVRE-RTRTDAPPE-PFNTTAFISAAGS-LGYSAQ---
TOP1_THEAC        -----------KGK---NGRVSSYTS-KEDHIRRPA-PFSTTEFLREAS-RIGIMPT---
TOP1_ARCFU        ------------GE---TAKVEEFTR-RRMEENRPT-PFNTTEFLREASKFM--SPH---
B5IE55_ACIB4      -----------KDTK--SAKVLDFIQ-EDRKIRPPI-PFNTTEFLSEAT-KLGFSAA---
B1L3G6_KORCO      -----------K-----DTLIARVKS-DERKLSPPP-PFDGTSLQVEVSAITGLTPRQIA
TOP1_AERPE        -----------RKN---PWLAVEEVRSERSILRPPP-AFNLGDLQKEANRILGLPPL---
A3DP02_STAMF      -----------KRTG--YLIVKKYEE-KIYTLNPPP-AFNLGDLQEEAARIYGFSPY---
B8D5I1_DESA1      -----------RGYK--YLIVSKVEK-KHHILHPPP-PFNLGDLQKEAARLYGFSPA---
K0IBM4_NITGG      -----------IGR---DGTVSDVVD-SKAVLGPPT-PFNIGDLQREAYRLFKLGPG---
TOP1_METTH        -----------QGS---DAEVKDVRV-RDTIRKPPV-PFDLGTLQSEAYRVFGFSPK---
F6D5C7_METPW      -----------KGK---DAVITEVNL-RKTTKTPPF-PFDLGSLQSEAYGVFGFSPR---
TOP1_METJA        -----------KDEK--SAKVVEIKK-TKRKLKPLP-PFDLGTLQREAYSYFKISPK---
TOP1_PYRAB        -----------KKS---KARVSNIEV-KRQKRNPPV-PFDLGTLQREAYSAFGFSPK---
TOP1_PYRHO        -----------KKS---IPRVSNVEI-KRQKRTPPH-PFDLGTLQREAYSAFGFSPK---
                                                                              

Q6F0G3_MESFL      -QITVAAQKLYE----------AGLVTYIRTDSNRYSS--DFVL--EAKNFIN--KNFKG
F0V2L5_MYCS3      -DVRRVAQSLYEGINLGGET--ISLITYPRTDRSSVSE--EFLK--LVKKFIL--KEYGE
Q9PPP9_UREPA      -KTTLIAQQMFEGLEINNQQ--LALITYPRTDSERLSD--DFLQ--EANAFIE--NNFGK
TOP1_MYCGA        -KITSVAQELYEGVTIDDEQ--IALISYPRTDSTRLSP--EYGK--TVLDFVA--KTYGK
TOP1_MYCPN        -KVTLIAQHLYEGVSINGEQ--TALISYPRTDSTRLSA--QFQQ--SCKEYIL--NHYGE
TOP1_MYCGE        -KVTMVAQRLYEGISVNGKQ--TALISYPRTDSIRISN--QFQS--ECEKYIE--KEFGS
Q3M6J7_TRIV2      -KTMQLAQKLYE----------AGLITYMRTDSVMLSP--EFCE--SARQWLE--QNDPQ
Q4AA55_MYCHJ      -SVSNALQKLYEGYGD------YGLISYPRTDSTRLSQ--TFIE--KGKEFII--KNFGP
B3PMD8_MYCA5      -TVQISAQKLFE----------MGLISYPRTDSTRMSD--TFIA--KAREYIK--EKFGE
TOP1P_MIMIV       -STMKTAQKLYE----------GGYITYMRTDSVEISA--EGHR--DIKKIIT--DQYGA
Q8F5G0_LEPIN      -KTMSLSQRLYEGMDL-GNGQRNGLITYMRTDSVRLSS--EFVE--RARSWIL--SELGE
TOP1_BORBU        -QIMQHAQKLYE----------HGYITYMRTDSHNIAK--IAKD--KITKIIK--NKYGK
H8H3H1_DEIGI      -TVTRAAQSLYE----------QGLITYIRTDSPALSD--EALQ--LARAAVA--ERFGE
B1VAJ5_PHYAS      -QTMRVAQKLYEGIDIEGES--IGLITYMRTDSPRFSE--VFVK--DAQKLIK--EKYGQ
TOP1_FERIS        -KTMKIAQELYEGVD--TKEGHTAFITYMRTDSTRVSD--VAKE--AAEKFIL--KNFGR
TOP1_THEMA        -KTMMIAQQLYEGVE--TKDGHIAFITYMRTDSTRVSD--YAKE--EARNLIT--EVFGE
B2V7T0_SULSY      -KTMMLAQDLFE----------SGLITYHRTDSVRISE--KAID--GIRNLIN--KEFGK
TOP1_AQUAE        -RTQKLAQELYE----------KGYITYPRTDSYRMNE--KKAK--EFMNYIE--KKYGK
D3SM80_THEAH      -KVQKLAQKLYE----------EGFITYPRTDSLRMDE--KKAQ--EFMNYIK--KTLGE
G8QVT8_SPHPG      -DTMRIAQKLYE----------NGFITYMRTDSPALSS--EGTQ--AARLLVK--QLYGP
TOP1_SYNE7        -ETMRVAQSLYE----------RGFITYMRTDSVHLSQ--QAIE--AARSCVE--QMYGK
TOP1_SYNY3        -DTMRVAQKLYE----------EGYITYMRTDSVHLSD--QAVT--AARNCVQ--QMYGK
TOP1_STRCO        -STMQVAQKLYE----------NGYITYMRTDSTTLSD--TAVS--AARAQVT--QLYGA
TOP1_MYCTU        -RTMSIAQRLYE----------NGYITYMRTDSTTLSE--SAIN--AARTQAR--QLYGD
TOP1_MYCLE        -RTMSIAQRLYE----------NGYITYMRTDSTTLSE--SAIN--AARTQAR--QLYGE
I0II60_PHYMF      -RTMRVAQQLYEGIDLKGSRGQTGLITYMRTDSTFLSG--EAIG--AARGYIE--DKLGK
J9Z7K0_LEPFM      -KTMTVAQKLYEGVDL-PGQGPVGLITYMRTDSVRVSP--EAAE--AARSWIR--QNHPD
TOP1_BUCAI        -KTMFLAQKLYE----------EGYITYMRTDSNYLSE--YAIK--KVRKYIK--SNYGS
TOP1_BUCAP        -KTMFLAQKLYE----------QGYITYIRTDSYFLSN--YAIE--KVRSYIE--NFYGS
TOP1_PSEAE        -KTMMMAQRLYE----------AGYITYMRTDSTNLSA--DAIG--MVRGFIE--DEFGQ
TOP1_VIBCH        -KTMMLAQRLYE----------AGYITYMRTDSTNLSA--EAVE--NLRGYIT--KHYGE
TOP1_ECOLI        -KTMMMAQRLYE----------AGYITYMRTDSTNLSQ--DAVN--MVRGYIS--DNFGK
TOP1_SALTY        -KTMMMAQRLYE----------AGYITYMRTDSTNLSQ--DAVN--MVRGYIG--DNFGK
TOP1_HAEIN        -KTMMLAQRLYE----------AGYITYMRTDSTNLSQ--DALN--MARTYIE--NHFGA
TOP1_PASMU        -KTMMLAQRLYE----------AGYITYMRTDSTNLSQ--DALK--MVRGYIQ--SHYGE
TOP1_CAMJE        -KTMMIAQKLYEGVN--THEGVMGVITYMRTDSLNLAK--EAVE--NARKFIQ--ANFGK
TOP1_HELPY        -KTMSIAQKLYEGVA--TPQGVMGVITYMRTDSLNIAK--EALE--EARNKIL--KDYGK
TOP1_HELPJ        -KTMSIAQKLYEGVA--TPQGVMGVITYMRTDSLNIAK--EALE--EARAKIL--KDYGK
TOP1_TREPA        -KTMQVAQQLYEGVSL-GTH-RVGLITYMRTDSVRVSE--AAVK--EVRAWIA--THFSD
TOP1_LACLA        -KTMMVAQQLYEGLTL-GSQGHQGLITYMRTDSTRISP--VAQS--AAHNYIA--DQFGE
TOP1_STAS1        -KTMMLAQQLYEGIDL-KKQGTVGLITYMRTDSTRISD--QAQS--EAKNYIQ--ETYGN
TOP1_STAAB        -KTMMVAQQLYEGIDL-KKQGTIGLITYMRTDSTRISD--TAKA--EAKQYIT--DKYGE
TOP1_STAA8        -KTMMVAQQLYEGIDL-KKQGTIGLITYMRTDSTRISD--TAKV--EAKQYIT--DKYGE
TOP1_STAAU        -KTMMVAQQLYEGIDL-KKQGTIGLITYMRTDSTRISD--TAKA--EAKQYIT--NKYGE
TOP1_STAAM        -KTMMVAQQLYEGIDL-KKQGTIGLITYMRTDSTRISD--TAKA--EAKQYIT--DKYGE
TOP1_STAHJ        -KTMMLAQQLYEGIDL-KRQGTVGLITYMRTDSTRISQ--TAKD--EAKQYIE--DKYGK
TOP1_STAES        -KTMMLAQQLYEGIDL-KRQGTVGLITYMRTDSTRIST--SAKS--EAQQYIN--DKYGE
TOP1_BACSU        -KTMMIAQQLYEGIDL-GREGTVGLITYMRTDSTRISN--TAVD--EAAAFID--QTYGK
TOP1_BACHD        -KTMMLAQQLYEGIDL-GKEGTVGLITYMRTDSTRISD--TAKA--ETKEYIE--SKFGK
A5CVH7_VESOH      -QTMILAQNLYR----------KGFITYMRTDSFILSE--TAIE--AVHKIIV--REFGS
Q28MI5_JANSC      -QAMSTAQRLYE----------AGHITYMRTDGIDMAP--EAVE--DARGAIK--TRYGV
TOP1_XYLFT        -KTMQIAQKLYEGIAL-GEEGSVGLITYMRTDSVNLSL--DALS--EIRDIIA--RDYGT
TOP1_XYLFA        -KTMQIAQKLYEGIAL-GEEGSVGLITYMRTDSVNLSL--DALS--EIRDIIA--RDYGT
TOP1_RICTY        -KTMQIAQKLYEGVDI-GKE-TIGLITYMRTDGVTLSN--DAIA--DIRKLID--KNYGN
TOP1_RICPR        -KTMQIAQKLYEGVDI-GKE-TIGLITYMRTDGVTLSN--DAIA--DIRKLID--KNYGN
TOP1_RICBR        -KTMQIAQKLYEGVDI-GKE-TIGLITYMRTDGVTLSN--DAVD--EIRKLIN--KDYGD
TOP1_RICFE        -KTMQIAQKLYEGVDI-GKE-TIGLITYMRTDGVTLSN--DAIA--DIRKLID--KNYGD
TOP1_RICCN        -KTMQIAQKLYEGVDI-GKE-TIGLITYMRTDGVTLSN--DAIA--DIRKLID--KSYGD
B7J7I8_ACIF2      -AIMKAAQSLFE----------HGHITYHRTDSPNLSE--EGEG--LLRAALK--KE-NL
Q7WXW8_PSEAI      -KTMKVAQRLYE----------QGLITYHRTDNPNISK--DSMP--DIRAVA---KALGL
C6XEP4_METGS      -RTMDLAQSLFQK---------HGAISYHRTDESNISD--DAYG--MIVEYGQE-RNYPM
B1M9R9_METRJ      -ATTKAAQKLFE----------DGHITYIRTDSVNLSP--DAAD--KVRSFAA--SQ-GM
TOP1P_XYLFA       -AAMDAAQKLYE----------QGHITYHRTDNPNVSD--ESLG--DIYAVSV---KLGL
C8W7T0_ATOPD      -RTMRLAESLYM----------DGLISYPRVDNTVYPSSLDLKD--CVRTLSAV-PQYAP
E1RJ15_METP4      -NAMRIAEELYM----------NGYISYPRTDNTIYPSSLDLKG--ILTELKK--SPFKR
C7P1M5_HALMD      -RAMSLAEELYT----------AGYMTYPRTDNTVYPEDLEPDE--LLDEFVGS-STFGE
TOP1_THEAC        -KAMSIAENLYM----------RGLISYPRTDNTVYPRSINLKS--VLKKLEN--TAYSK
TOP1_ARCFU        -KAMNIAETLYM----------NGYISYPRTDNTVYPPTINLIE--IVSALS---SVFPR
B5IE55_ACIB4      -RAMRLAEELYM----------GGYISYPRTDNTVYPKTLSINS--ILKSLEK--SKFKE
B1L3G6_KORCO      DRTSGIAQKLYE----------AGLISYIGTESQKYPKSWKKKDFVDMVKLIASYSPLKE
TOP1_AERPE        -RTQSIAEELYL----------EALISYPRTNSQKLPPSINYRA--ILDKLAH--GPLGR
A3DP02_STAMF      -KTQSIAEKLYL----------DALISYPRTNSQKLPPTLNYKA--IMNKLSRI-NNYKE
B8D5I1_DESA1      -ETQSIAEQLYL----------DALISYPRTNSQKLPPTLDYRR--ILENISSI-KSYRN
K0IBM4_NITGG      -YTLAIAEKLYL----------QALISYPRTSSQKLPPSIGYGK--IISSLSRI-GGYGQ
TOP1_METTH        -KTQTIAQNLYT----------EGYTSYPRTSSQKLPESIGYEK--ILKNLAKN-PRFGV
F6D5C7_METPW      -KTQQIAQNLYT----------EGYTSYPRTSSQKLPKSIGYDK--ILKKLSYS-SAFGN
TOP1_METJA        -ETQEIAQKLYE----------NALISYPRTSSQKLPKDRKYLE--DILNIIKNHPVYGK
TOP1_PYRAB        -KTLDIAQSLYE----------KGFTSYPRTESQKLPKNLNFRL--IIQNISRM-PQYRP
TOP1_PYRHO        -KTLDIAQSLYE----------KGFSSYPRTESQKLPRNINFRM--IIQNLAKM-PQYRP
                         : ::            .  :*  ..                            

Q6F0G3_MESFL      D---LF------KE----AVPVRTQANA---QEAHE-SIRPT-DLNQRPENISSQIE---
F0V2L5_MYCS3      T---YWVEEG--TL----KKKSIMGKKEIFIQGAHE-GIRPT-DVELTPQKLSKLLST--
Q9PPP9_UREPA      E---YLENF---KN----KKINRKEVNI---QDAHE-AIRPV-DINLKPEEIKDYVSL--
TOP1_MYCGA        D---YVATQSQLNG----ETKANKKQKA-KVQDAHE-AIHPI-DISITPDSVKNKISS--
TOP1_MYCPN        K---YLS-----NR----IVSAKGKKGEKIIQDAHE-AIHPT-DINITPEMVKNAIKK--
TOP1_MYCGE        H---YLADKN--KL----KRHKKDEKII---QDAHE-GIHPT-YITITPNDLKNGVKR--
Q3M6J7_TRIV2      N----VP-----KQ----VARHRSSKTA---QQGHE-AIRPT-DVFRPSAQLRIELST--
Q4AA55_MYCHJ      K---YFT-K---SI----KGF----AGD---QDAHE-AIRPT-NLELSPELAREKYHLGQ
B3PMD8_MYCA5      N---YVA-S---DI----KSF----SGA---QDAHE-AIRPT-DIYLIPQVAKTKYDLGE
TOP1P_MIMIV       D---YY------QK----NLYKNKAANS---QEAHE-AIRPTHPELLTLEGEIEDA----
Q8F5G0_LEPIN      T---FAS-P---LE----RKIRKSAKKI---QDAHE-AIRVT-DPFLTPKEIKKFLGK--
TOP1_BORBU        E---YIE-E---KD----RIYEKE-KMA---QNAHE-AIRPS-EIFI-PNETIEIESK--
H8H3H1_DEIGI      A---ALP-P---SP----RQYATRNANA---QEAHE-AIRPA-GAFLAPEAT--GLNG--
B1VAJ5_PHYAS      K---YLA-----------VFKQNQKNKA---QDAHE-AIKPT-DLSKTPESLMSYLDK--
TOP1_FERIS        E---YLNESSEVAS----KKGSKTKGKV---QDAHE-CIRPV-DVNITPEKAKELLDK--
TOP1_THEMA        E---YVG-----SK----RERRKSNAKI---QDAHE-AIRPT-NVFMTPEEAGKYLNS--
B2V7T0_SULSY      D---YLP-E---KI----RVYKSK-NTQ---ADAHE-AIRITHFVNLEEQKKLIKEKGLS
TOP1_AQUAE        E---YVG-----RL----RRFREK-ATA---QGAHE-CIRPTSLREEIPERE--------
D3SM80_THEAH      E---YVG-----TL----RKFKEK-PTS---QGAHE-CIRPV-SLDRSPTGGV-------
G8QVT8_SPHPG      D---FLS-P---TE----RHFAAKTAGA---QEAHE-AIRPSGERFRVPGET--GLSG--
TOP1_SYNE7        N---YLS-P---QP----RQFTTKSKNA---QEAHE-AIRPAGNTFRLPQET--GLSG--
TOP1_SYNY3        E---YLS-P---QP----KQYTTKSKGA---QEAHE-AIRPAGTEFRIPNQT--GLKD--
TOP1_STRCO        D---YLP-P---QP----RTYAGKVKNA---QEAHE-AIRPSGDRFRTPAET--GLTG--
TOP1_MYCTU        E---YVA-P---AP----RQYTRKVKNA---QEAHE-AIRPAGETFATPDAVRRELDGPN
TOP1_MYCLE        E---YVS-D---SP----RQYTRKVKNA---QEAHE-AIRPAGETFATPDAVCNELDG--
I0II60_PHYMF      N---YRPED---KP----RFYKSSNQDA---QEAHE-AIRPT-DVTITPSSIQNQLSE--
J9Z7K0_LEPFM      G---LPA-----RP----PAYKNR-KGI---QDAHE-AIRPS-DVRRTPESLQGAIDP--
TOP1_BUCAI        N---YLP-K---EP----NIYSNE-KHS---QEAHE-AIRPS-DIKIKNIDSDH-LNS--
TOP1_BUCAP        D---FLP-K---KS----NIYSNQ-KYS---QEAHE-AIRPS-DVQVVNIDNCDP-----
TOP1_PSEAE        K---YLP-G---KA----NVYSSK-EGA---QEAHE-AIRPS-DVNLKPTQLSG-MER--
TOP1_VIBCH        A---YLP-S---QP----NVYGSK-QNA---QEAHE-AIRPS-DVTVTADDLEG-MEA--
TOP1_ECOLI        K---YLP-E---SP----NQYASK-ENS---QEAHE-AIRPS-DVNVMAESLKD-MEA--
TOP1_SALTY        K---YLP-D---NP----NQYASK-ENS---QEAHE-AIRPS-DVAVMAESLKD-MEA--
TOP1_HAEIN        Q---YLP-E---KP----NFYSSK-ENA---QEAHE-AIRPS-DIRALPESLEG-MEK--
TOP1_PASMU        S---YLP-S---KP----VFYSSK-ENA---QEAHE-AIRPS-DVNTLAEQLTG-MDK--
TOP1_CAMJE        D---YLP-S---KA----NVYTTKTKGA---QEAHE-AIRPT-NLSFTPEIAAKFLDK--
TOP1_HELPY        D---YLP-P---KA----KVYSSKNKNA---QEAHE-AIRPT-SIILEPNALKDYLKP--
TOP1_HELPJ        D---YLP-P---KA----KVYSSKNKNA---QEAHE-AIRPT-SIILEPNALKDYLKP--
TOP1_TREPA        A---LPG-----TP----NRYAAKGKS----QDAHE-AIRPT-YVAHTPERIKAHLTR--
TOP1_LACLA        K---YS------KH----GSKVKNASGA---QDAHE-AIRPS-NVFNTPDAIAKYLDK--
TOP1_STAS1        D---YT------------SNRKSKGQGD---QDAHE-AIRPS-STLRTPNEMKNFLTR--
TOP1_STAAB        S---YTS-----------KRKASGKQGD---QDAHE-AIRPS-STMRTPDDMKSFLTK--
TOP1_STAA8        S---YTS-----------KRKASGKQGD---QDAHE-AIRPS-STMRTPDDMKSFLTK--
TOP1_STAAU        S---YTS-----------KRKASGKQGD---QDAHE-AIRPS-STMRTPDDMKSFLTK--
TOP1_STAAM        S---YTS-----------KRKASGKQGD---QDAHE-AIRPS-STMRTPDDMKSFLTK--
TOP1_STAHJ        D---YLS-----------NRTAKGKQGD---QDAHE-AIRPT-STLRTPYEMKAYLTR--
TOP1_STAES        Q---YVS-----------QRKSSGKQGD---QDAHE-AIRPT-STMRTPDDMKAFLTR--
TOP1_BACSU        E---FLG-----GK----RKPAKKNENA---QDAHE-AIRPT-SVLRKPSELKAVLGR--
TOP1_BACHD        E---YAQ-----NG----TKAVKKDKKS---QDAHE-AIRPT-SVERDPKSLKEYLSR--
A5CVH7_VESOH      E---YH------NT----RRYKSKESRA---QEAHE-AIRPT-DLTRSN---IFDIEE--
Q28MI5_JANSC      D---YVP-G---KP----RIYKNKAKNA---QEAHE-CVRPT-DMSKAANDLKLSED---
TOP1_XYLFT        N---ALP-D---KP----NVYTTKSKNA---QEAHE-AVRPT-SALRTPTQVAPYLSN--
TOP1_XYLFA        N---ALP-D---KP----NVYTTKSKNA---QEAHE-AVRPT-SALRTPTQVAPYLSN--
TOP1_RICTY        K---YLP-I---NP----RIYQSKVKNA---QEAHE-AIRPT-NITYTPDNLKQKLEK--
TOP1_RICPR        Q---YLP-I---KP----RIYQSKVKNA---QEAHE-AIRPT-NITYTPDSLKQKLEK--
TOP1_RICBR        K---YLP-S---SP----RIYKSKVKNA---QEAHE-AIRPT-NINYIPNDLKEKLEK--
TOP1_RICFE        K---YLP-N---SP----RIYKSKVKNA---QEAHE-AIRPT-NITYTPDSLKEKLEK--
TOP1_RICCN        K---YLP-T---SP----RIYKSKVKNA---QEAHE-AIRPT-NITYTPDSLKEKLDK--
B7J7I8_ACIF2      P---LVE-----TP----RRWRSK-GGA---QEAHE-AIRPTRPMVRQAGENDL------
Q7WXW8_PSEAI      K---CVE-----QQ----RMFKAD-QDA---QEGHP-AITPT-DWMAAAAGETA------
C6XEP4_METGS      S-----------SE----KRTWKGVVAA---QEAHE-AIRPS-DMNYQPDETMTA-----
B1M9R9_METRJ      A---LSP-----EV----RRWKEK-ASA---QGGHADAVRPT-HIEVEDAGADD------
TOP1P_XYLFA       D---IAE-----KP----RKFKAP-AGA---QVGHP-AVTPT-HWEVEEAGETS------
C8W7T0_ATOPD      TCKKLLG-----QP----KLHATRGKQE---STDHP-PIYPT--AAANPDSLQP------
E1RJ15_METP4      EVEWVSA-----NM----RPSPTRGKKS---STDHP-PIHPT------AAASKGDMDE--
C7P1M5_HALMD      DAESLLE-----QD----EIVPTEGDEE---TTDHP-PIHPT-GELPPRGELDD------
TOP1_THEAC        ----YVK-----EIETFDRILPSRGRIE---TTDHP-PIYPV---DSPKEQLKG------
TOP1_ARCFU        EAQIVLS-----QD----KITPSRGRRE---TKDHP-PIYPT-GVAKRGELSK-------
B5IE55_ACIB4      E---ALKLQK--ER----RRYPTRGKKE---STDHP-PIVPT-----RGANLEG------
B1L3G6_KORCO      EAEFVLG-----DM----REAAVEGKKD---DPAHP-TIHVV---GVPEERLEG------
TOP1_AERPE        EARELLKET---GG----VLRPVQGSKD---DPAHP-AIHPT------GEKPSQRLSK--
A3DP02_STAMF      LVSNLLVET---KG----VLKPVQGSKD---DPAHP-AIYPT---GVKPKDLGK------
B8D5I1_DESA1      LVESLISET---KG----VLTPVEGEKE---DPAHP-AIYPT---GVVPGRLTE------
K0IBM4_NITGG      LTSMLLS-----KG----RLVPNEGRMT---DPAHP-AIYPT---GVAPQQKLSSL----
TOP1_METTH        H---IERL----RG----PLKPHEGKKE---DDAHP-AIHPT---GLLPSELSK------
F6D5C7_METPW      H---VAQLK---KP-----YKPNEGKKT---DEAHP-AIHPT---GVLPKELST------
TOP1_METJA        W---AERIL---KE----NLKPVEGKKE---DPAHP-AIHIV---DIPKEELSE------
TOP1_PYRAB        YAHLLLG-----MP----ELKPVEGKKE---DPAHP-AIYPT-GEIPGPGDLSK------
TOP1_PYRHO        YAHILLG-----LP----ELKPVEGKKE---DPAHP-AIYPT-GEIPRPGDLTK------
                                                    *   :                     

Q6F0G3_MESFL      -DKNMIRLYNLIWWNTVKSLMKGPSGFYHNWTFWN-----N---G----YEFKQSWKEVL
F0V2L5_MYCS3      -SSLEFQLYRLIWSYTVASFFPSSRNEKRRYVFEN-----Q---G----NFFYASESSEV
Q9PPP9_UREPA      -D--IYKLYNLVWNKTLSALMKVPTFNKQVIRFIN-----N---E----YKFYTAYKTIR
TOP1_MYCGA        -D--QYSLYKLIWTRTVAHYMAAAVYELVNIRFIN-----N---N----NKFYAVNNTLK
TOP1_MYCPN        -D--EFLLYRLIWIRTVASLMADCKKSHTHIRFIN-----D---G----NKFYASSKSLV
TOP1_MYCGE        -D--EFLLYRLIWIRTVASLMADAKTSRTIVRFIN-----Q---K----NKFYTSSKSLL
Q3M6J7_TRIV2      -D--EFNLYVMIWKRAIASQCRPAQLRKTVVITQS-----G---Q----ILWQARGQVVE
Q4AA55_MYCHJ      -I--EFQIYQLIYQTTIQALMRSPERKITNLTFKT---PIK---D----HIFSYSYSEFT
B3PMD8_MYCA5      -V--ESYIYTIIYNKTMSSLMTPPVREIYRYELVN-----G---L----YYFKMSYSKVI
TOP1P_MIMIV       -Y--QIKLYKLIWQRTIASQMKPAKIKVTIIQISISKYVED---KLNPFYYFQSQIETVV
Q8F5G0_LEPIN      -E--EAALYDLIWKRTISSLLPAEEFIKIEYSIFA-----A---G----ECFQLETKKTI
TOP1_BORBU        -T--AKEIYKIIWDRTIISGMKDAIKENIKLTFKY-----K---N----LIFRSSFTKII
H8H3H1_DEIGI      -D--ELALYTLIYTRTVASQMQDALGEKTTITLQA-----G---V----VTLGATGTRLT
B1VAJ5_PHYAS      -Y--EYKLYDLIYKRSLASLMKPAIFQKNQVFFEV-----E---K----HSFLTEGLIKT
TOP1_FERIS        -D--HHKLYELIWKRFIASQMSSAIYKQYSYDFES-----G---K----YVFEASIRERI
TOP1_THEMA        -D--QKKLYELIWKRFLASQMKPSQYEETRFVLRT-----K---DGK--YRFKGTVLKKI
B2V7T0_SULSY      ED--HFKLLKLIYERTVASQMADAIFERTSAAVDI-----K---G----YTFKASGSILK
TOP1_AQUAE        -E--LRLLYDLIFRRTIASLMKEMLLEREKVTVEAITPELK---HP---VYLVAKGLKIV
D3SM80_THEAH      ----EEKLFTLIMKRTLASLASPALLEKTDVVVVP---LCE---PR---MEFKGQWQRIL
G8QVT8_SPHPG      -R--ELALYELIWKRTLASQMADAKKATTSVSIQA-----N---D----ALFTATGTQIV
TOP1_SYNE7        -A--EFALYDLIWKRTIASQMAEARQTMLSVLLEV-----D---N----AEFRASGKRID
TOP1_SYNY3        -R--ELALYELIWKRTVACQMADARITQLSVLLKV-----E---D----AEFRAAGKRID
TOP1_STRCO        -D--QFKLYELIWKRTVASQMKDATGNSVTVKIGGAASDGR---D----VEFSASGKTIT
TOP1_MYCTU        ID--DFRLYELIWQRTVASQMADARGMTLSLRITGMSGH-Q---E----VVFSATGRTLT
TOP1_MYCLE        -D--EFRIYELVWRRTVASQMADARGTTLSLRIEG-----R---AGEQHVVFSASGRTLT
I0II60_PHYMF      -E--QFRLYDLIWRRFVACQMVDAQFDSTSIIIAC-----E---KAE--ATFRASGSVLV
J9Z7K0_LEPFM      -D--LFRLYDLIWKSFVESQMSPALYLQTTVLVEG-----D---QG---DVFRASGRVLK
TOP1_BUCAI        -S--AKKLYELIWNQFLASQMKSVKYKSITVTVLA-----D---M----FKLQKSERIVM
TOP1_BUCAP        -D--AKKLYKLIWNYFIASQMKSERYKSIKTTVMA-----D---V----FKLQSNTKIVL
TOP1_PSEAE        -D--AERLYDLIWRQFVACQMTPAEYLSTSVSVTA-----G---D----FELRAKGRILK
TOP1_VIBCH        -D--AHKLYALIWNQFVACQMTPAQYDSTTVSVKA-----A---E----YTLKAKGRILK
TOP1_ECOLI        -D--AQKLYQLIWRQFVACQMTPAKYDSTTLTVGA-----G---D----FRLKARGRILR
TOP1_SALTY        -D--AQKLYQLIWRQFVACQMTPAQYDSTTLTVGA-----G---E----FRLKARGRILR
TOP1_HAEIN        -D--AVRLYDLIWCQFLACQMPPAQYDSSTLTVTA-----G---D----YTLKAKGRILR
TOP1_PASMU        -D--AVRLYDLIWRQFVACQMPAAQYDSTTVTVRA-----G---E----YELKAKGRILR
TOP1_CAMJE        -D--ELKLYTLIYNRFLACQMSPAISQTQNVFVKN-----D---R----VVFKISGRKIL
TOP1_HELPY        -E--ELRLYTLIYKRFLASQMQDALFESQSVVVAC-----E---K----GEFKASGRKLL
TOP1_HELPJ        -E--ELKLYTLIYKRFLASQMQDALFESQSVVVAC-----E---K----GEFKASGRKLL
TOP1_TREPA        -D--QIRLYTLIWERFVASQMTDARVRSLTFEITA-----G---P----AVFSATETQVI
TOP1_LACLA        -D--QLKLYTLIWNRFVASQMVAAIFDTVKVNLSQ-----N---G----VIFIANGSQVK
TOP1_STAS1        -D--QHRLYKLIWERFVASQMAPAILDTVAMDLTQ-----N---D----IKFRANGQTIK
TOP1_STAAB        -D--QYRLYKLIWERFVASQMAPAILDTVSLDITQ-----G---D----IKFRANGQTIK
TOP1_STAA8        -D--QYRLYKLIWERFVASQMAPAILDTVSLDITQ-----G---D----IKFRANGQTIK
TOP1_STAAU        -D--QYRLYKLIWERFVASQMAPAILDTVSLDITQ-----G---D----IKFRANGQTIK
TOP1_STAAM        -D--QYRLYKLIWERFVASQMAPAILDTVSLDITQ-----G---D----IKFRANGQTIK
TOP1_STAHJ        -D--QHRLYKLIWERFVASQMAPAILDTVALDVTQ-----N---N----IKFRANGQTIK
TOP1_STAES        -D--QHRLYKLIWERFVASQMAPAILDTVALDVTQ-----N---D----IKFRANGQTIK
TOP1_BACSU        -D--QMRLYKLIWERFVASQMAPAVLDTMSVDLTN-----N---G----LTFRANGSKVK
TOP1_BACHD        -D--QLRLYKLIWERLVASQMAPAIMDTMTVDLSN-----E---G----VLFRATGSKVK
A5CVH7_VESOH      -Q--AAKLYILIYKRTLSCQMSDAQLQKTKIKINI-----E---GLD--EIFIANGEVLV
Q28MI5_JANSC      -D--QRKLYDLIWKRTIASQMEAARLERTTVTIAS-----D---DRE--VELRATGQVML
TOP1_XYLFT        -E--EHRLYELVWKRTVASQMIPAILNTTSVDLAA-----G---NE---HVFRATGTTVV
TOP1_XYLFA        -E--EHRLYELVWKRAVASQMIPAILNTTSVDLAA-----G---NE---HVFRATGTTVV
TOP1_RICTY        -D--YYKLYELIWQRTIACQMENVIMDLVIANLAS-----E---NKE--YLAKANGSIIA
TOP1_RICPR        -D--YYKLYELIWHRTIACQMENVIMDLVIANLAS-----E---NKE--YLAKANGSIIA
TOP1_RICBR        -D--YYKLYELIWKRTIACQMENVIMDLVNATLAS-----E---NKE--YLARANGSTIA
TOP1_RICFE        -D--YYKLYELIWKRTIACQMENVIMDLVVASLAS-----E---NKE--YLAKANGSTIA
TOP1_RICCN        -D--YYKLYELIWKRTIACQMENVIMDLVVANLAS-----E---NKE--YLAKANGSTIA
B7J7I8_ACIF2      ----EQALYDLIRKRALASQMPDAVYQQTSCTLDGGMFQGR---P----AVFRAVGSVLK
Q7WXW8_PSEAI      -D--EQALYQLIRVRALASQIEAAVYAVRTITLLGVGPDKK---P----LRFGAKGKLLN
C6XEP4_METGS      -D--EAALYRLIHSRAVASQMEPAEYTVATATLSN-----E---QG---IKFKAQSKSLC
B1M9R9_METRJ      -A--QRALYRLIRLRTLVSQMADARYTVNTVRLRA-----TDRDG----FEYVARGRKMI
TOP1P_XYLFA       -D--QKALYKLIRLRAIACQLADARYAVRTVRLEAAQPVGG---KN---VEFEARGRTLI
C8W7T0_ATOPD      -A--AWKLYNLIARRFLATLMGPATMSGTKITLDV-----A---G----QPFVANGTVLA
E1RJ15_METP4      -T--AWKVYELVVRRFLATLSPDARWKTLKYTFDA-----G---G----EPYASTGQRLD
C7P1M5_HALMD      -D--EWEIYELVVRRFFATVAEPAKWAHLRVVAEA-----A---G----HSLKANGKRLL
TOP1_THEAC        -D--YGRVYDLILRHFLSTLYRDGKKTVAEAEIYV-----N---G----YTFKAAGQHTT
TOP1_ARCFU        -D--EWTIYELVVRRFLATLAPKAVWDVRRVVLDS-----N---G----VKFVANGRQLV
B5IE55_ACIB4      -D--KGKIYELVVRRFMATLAPDLEYRESKVKLAV-----K---D----EIFEAKGKELV
B1L3G6_KORCO      -K--YREVYEIIARRNLATLAQDALIKRIRVESNV-----D---G----FIFRASGLSVL
TOP1_AERPE        -E--HMAVYELIVRRFLAAFSREAIVSKSSVLLRDF----Q---G----RVWRAEGLRVE
A3DP02_STAMF      -D--EWKIYDLIVRRFLAAFASKARISHRIVYLEY-----PKDPS----MVFQASGQKIL
B8D5I1_DESA1      -K--QWAIYDLIVKRFLAVFAPPAKIVYYVVKATT-----P---SHE--YVFETKGQVIE
K0IBM4_NITGG      ----EFKVYDLVVKRFLATFGDPAISRHTDVSIDV-----N---S----HTFKAQGRSPV
TOP1_METTH        -D--EKKVYDLIVHRFISVFGEDAILQTMKVELEI-----G---E----EEFSFSRKRVS
F6D5C7_METPW      -D--YRKLYELIVYRFISVFGENATLETMKTTLTI-----G---K----EEFNFSRKRMS
TOP1_METJA        -K--EKEIYDLIARRTLAAFWDNAEREYLNVKIDI-----K---G----EKFKLSGSRTV
TOP1_PYRAB        -D--EEKLYDMIVRRFLALFMEPAVRESVKVTILA-----G---P----HKFMLSGARTV
TOP1_PYRHO        -D--EEKLYDMIVRRFLAVFMEPAIRESVKVTIRA-----G---P----HKFFLSGGRTV
                         :  ::    .                                           

Q6F0G3_MESFL      DLGYNKLDKFETDEDVELDENDDEISNDDEIKPP-FEFKENYVFS---------------
F0V2L5_MYCS3      FDGYKYI--LRENGLL----ESRE--KSEFDFKQLIKNNKYLSKE---------------
Q9PPP9_UREPA      TLGYWILDFYKKQRDE----------LEF-QPPI-INVGDEFKKE---------------
TOP1_MYCGA        FDGYKKI--YTHY-------DDKDHLRKL-DLNH-FAIDKEFEAK---------------
TOP1_MYCPN        FDGYRKI--YEHFENKESN-------DLYIDLDK-IRVGDRFMAK---------------
TOP1_MYCGE        FDGYQRL--YEEIKP-----NTKD--ELYIDLSK-LKIGDKFSFE---------------
Q3M6J7_TRIV2      FLGYTRY--WPNLS------------KDT-LLPT-LQQGQMVTLE---------------
Q4AA55_MYCHJ      FDGYYKA-----TEKP----------SLK-FKPE-FSDIESLISK---------------
B3PMD8_MYCA5      FDGYYRV--LNFE-------------EPK-PLPK-YEIGEAIPVL---------------
TOP1P_MIMIV       FPGFMKV--YVESIDDPDTDNQITKNFTG-KIPT---VGSKVTME---------------
Q8F5G0_LEPIN      FPGYKIL--------------NEA--DVK-TNPS-WEKGELFILQ---------------
TOP1_BORBU        FDGFLKH--TKE--------QDEH--LNI-NFDL-IKKGDTFSIV---------------
H8H3H1_DEIGI      QRGFTAL--YDDD-------QKDE--DDQ-ALPA-LTTGQRAPLS---------------
B1VAJ5_PHYAS      FDGYQKI--LKDNL------------QDK-IIPT-FNLNESYFPE---------------
TOP1_FERIS        FDGFEKV--YTIDN------------EPSEKHKE-LKVDQEYLV----------------
TOP1_THEMA        FDGYEKV--WKTE-------------RNTGEFP--FEEGESVKPV---------------
B2V7T0_SULSY      FKGYKAV--YDLEEE-----EDKE--ENQ-KLPD-LKNKDVLTLE---------------
TOP1_AQUAE        FDGWSRV--YPSEI------------TEE-KLPE-LYEGDLLDLV---------------
D3SM80_THEAH      FDGWLRI--------E----EEEL--DLQ-EPPP-LSEGEILLPK---------------
G8QVT8_SPHPG      FPGFLRA--YVEGSDD-PDAALED--KES-LLPP-LSVGEICPLV---------------
TOP1_SYNE7        FPGFFRA--YVEGSDD-PDAALED--REI-LLPA-LKVGDRPTCQ---------------
TOP1_SYNY3        FPGYFRA--YVEGSDD-PDAALEN--QEV-ILPP-LKVGDRPNCR---------------
TOP1_STRCO        FHGFLKA--YVEGADD-PNAELDD--RER-RLPQ-VAEGDALTAE---------------
TOP1_MYCTU        FPGFLKA--YVETVDELVGGEADD--AER-RLPH-LTPGQRLDIV---------------
TOP1_MYCLE        FPGFLKA--YVETVDELAGGEADD--AER-RLPH-LTSGQLLDVI---------------
I0II60_PHYMF      FDGFMRISGVPKS-------------DEV-LLPKGLEENKPIAPI---------------
J9Z7K0_LEPFM      APGFLALRGLSVSQDE-DGGDGEG--EDR-LLPP-LETGESVHLE---------------
TOP1_BUCAI        FQGWNKV--LIEEK------------NVFSQFPI-LQTGSQLFIN---------------
TOP1_BUCAP        FSGWTKI--LKKSNN-----------VNF-KFPV-LDIGTTLILD---------------
TOP1_PSEAE        FDGYTRV--LPQQ-------SKPG--EDD-VLPE-MKEGENLKLI---------------
TOP1_VIBCH        FDGWTRV--QRPLGKN----------EDQ-ILPP-VKVGDSLKLV---------------
TOP1_ECOLI        FDGWTKV--MPAL-------RKGD--EDR-ILPA-VNKGDALTLV---------------
TOP1_SALTY        FDGWTKV--MPAL-------RKGD--EDR-TLPA-VNKGDALTLL---------------
TOP1_HAEIN        FDGWTKV--LPQI-------GKNP--EDQ-ELPS-VTVSEKLALK---------------
TOP1_PASMU        FDGWTKV--LPTM-------SKNA--EDQ-VLPD-VQLNEKLHLE---------------
TOP1_CAMJE        FDGYYKV--YGDMD------------KDK-ILPN-FKIGQNLKVQ---------------
TOP1_HELPY        FDGYYKI--LGNDD------------KDK-LLPN-LKENDPIKLE---------------
TOP1_HELPJ        FDGHYKI--LGNDD------------KDK-LLPN-LKENDPIKLE---------------
TOP1_TREPA        EQGFYRV--L--KMLS----PKDL--SKA-VLPP-TKEGEVVALH---------------
TOP1_LACLA        FDGYLRI--Y----------NDSD--KSN-MLPE-MEENETVKKA---------------
TOP1_STAS1        FKGFMTL--YVETKDD----SEDG--KDN-KLPN-IGEGEMVTAT---------------
TOP1_STAAB        FKGFMTL--YVETKDD----IDSE--KEN-KLPK-LEQGDKVTAT---------------
TOP1_STAA8        FKGFMTL--YVETKDD----SDSE--KEN-KLPK-LEQGDKVTAT---------------
TOP1_STAAU        FKGFMTL--YVETKDD----SDSE--KEN-KLPK-LEQGDKVTAT---------------
TOP1_STAAM        FKGFMTL--YVETKDD----SDSE--KEN-KLPK-LEQGDKVTAT---------------
TOP1_STAHJ        FKGFMTL--YVEAKDD----KDNE--KEN-KLPN-LSKGDEVTAT---------------
TOP1_STAES        FKGFMTL--YVEAKDD----KEND--KEN-KLPQ-LDKGDKVTAT---------------
TOP1_BACSU        FSGFMKV--YVEGKDD----QMEE--KDR-MLPD-LQEGDTVLSK---------------
TOP1_BACHD        FPGFMKV--YIEGNDE----GKKE--EDR-LLPN-LQEGQTVTKE---------------
A5CVH7_VESOH      FPGFLRI--YDYLLS-----------EDK-LLPR-LNKGNALNLV---------------
Q28MI5_JANSC      FDGFLKV--YEEGRDD---AGDDE--DSK-RLPQ-VSAGDPLKPSADAMADDYAKYSGDD
TOP1_XYLFT        VQGFLAV--YEEGKDN-KNAEDDD--EGR-KLPV-MKTGENVPLE---------------
TOP1_XYLFA        VQGFLAV--YEEGKDN-KNAEDDD--EGR-KLPV-MKTGENVPLE---------------
TOP1_RICTY        FDGFYKV--YRESLDD----EDEE--DNK-MLPP-LKAQEHIKTK---------------
TOP1_RICPR        FDGFYKV--YRESLDD----EDEE--DNK-MLPP-LKEQEHIKTK---------------
TOP1_RICBR        FDGFYKV--YRESIDD----EAEE--ENK-MLPP-LKEQEHLKTK---------------
TOP1_RICFE        FDGFYKV--YRESVDD----EAEE--ENK-MLPP-LKEQEPLKTK---------------
TOP1_RICCN        FDGFYKV--YRESMDD----EAEE--ENK-MLPP-LKEQEPLKTK---------------
B7J7I8_ACIF2      DPGWMAL--YRETAEDEEGTENP---AAN-PVPR-LAVGDAVRAA---------------
Q7WXW8_PSEAI      VPGWRKL--LQGDDAEEQKNETPS--NPI-PIPA-LEPRQILKVY---------------
C6XEP4_METGS      KPGWRVL--AVQDEEH----DDNP--SLS-HIPD-LSVGQILHSS---------------
B1M9R9_METRJ      DAGWRAL--LERDPDEEENSDDDA--AKDGQVPR-LAVGGDLRAI---------------
TOP1P_XYLFA       YQGWLKL--IAGDQTEEEDGNEKE--SSN-PIPV-CAPGECLDVA---------------
C8W7T0_ATOPD      EPGFREI--YPFGLK-----------KDD-QIPD-VGEGEIVSIK---------------
E1RJ15_METP4      YEGYRIV--YTYSQA-----------KEQ-ALPV-LAAGEKLPIL---------------
C7P1M5_HALMD      EPGYHAV--YPYSSA-----------SEN-VVPA-VSEGDALTMS---------------
TOP1_THEAC        DRGWTEI--YGYDP------------KDV-YLPE-LTEGEDLKAI---------------
TOP1_ARCFU        EAGWRDI--YIYSKA-----------EET-ELPL-LKKGDVLRIL---------------
B5IE55_ACIB4      NEGWLYY--YPYARF-----------EEE-KIPI-LRIGDEVKVK---------------
B1L3G6_KORCO      REGWLRV--YPYA-------------RME-EFPE-VEDSEELRVV---------------
TOP1_AERPE        DLGWLKY--YHYSTP-----------GEK-PMPP-LDRGDKARVV---------------
A3DP02_STAMF      DLGWLRY--YPFSKP-----------EER-FLPK-FQYGEKVKIV---------------
B8D5I1_DESA1      EYGWLKY--YNFHNY-----------HAG-KIPV-LKEGELLNIV---------------
K0IBM4_NITGG      YEGWMVF--YKPHVRL----------EQH-ELPE-LRKGDLVKNL---------------
TOP1_METTH        KAGWMES--YPYTKM-----------EDE-EFPE-ISGGDSLAVR---------------
F6D5C7_METPW      KMGWMGH--YPFRKI-----------EED-YFPT-MNKGETLNVK---------------
TOP1_METJA        KEGWHEI--Y-YFPKF----------DEI-ELPP-LKKNDIIKVE---------------
TOP1_PYRAB        KQGWLSV--YGKYIKF----------DEV-TLPE-FFIGERVRVL---------------
TOP1_PYRHO        KKGWLSV--YGKYVKF----------EEV-TLPE-FFIGERIKVI---------------
                    *                                                         

Q6F0G3_MESFL      ------------------INKNAIVTEEAK----------TSPPRMFNQASLVRELKDLG
F0V2L5_MYCS3      ----------------------DIIMEER-----------NSPPSKYSEATLIKALENKG
Q9PPP9_UREPA      ----------------------KIDLIQKE----------TTPPPYYTEASLIAALKNAG
TOP1_MYCGA        ----------------------DVLLNEHQ----------TKPPARFTQATLIEALETEG
TOP1_MYCPN        ----------------------DIKITARQ----------THPAARYTQASLIEALEKSN
TOP1_MYCGE        ----------------------KISVNEHK----------TNPPPRYTQASLIEELEKSN
Q3M6J7_TRIV2      ----------------------NAGHEKKQ----------TQPPPRYSEPKLVQLMERKG
Q4AA55_MYCHJ      ----------------------KFQVDKNFDNSIKSSLHQTKPPAHFRDGTLIEKLDDEK
B3PMD8_MYCA5      ----------------------EFTRFDKE----------TQPPARYNEGSLIKMLDDIK
TOP1P_MIMIV       ----------------------EIIARQEY----------MRPPPRYSEASLVKKLEELG
Q8F5G0_LEPIN      ----------------------KVECEKKQ----------TEPPSRYSEGTLVAKLEKQG
TOP1_BORBU        ----------------------KMKTSEHE----------TKAPFRYTEASLVQKMEKEG
H8H3H1_DEIGI      ----------------------KVKAEEKK----------SSAPARFSEGSFVQLMEKAG
B1VAJ5_PHYAS      ----------------------KIETFQKF----------TTPQARFSEATLIKTLEKLN
TOP1_FERIS        ----------------------EPKSAEAQ----------TTPPDRYTEASLVKTLEMEG
TOP1_THEMA        ----------------------VVKIEEQE----------TKPKPRYTEGSLVKEMERLG
B2V7T0_SULSY      ----------------------KINLEEKF----------TKPPARYTEGGLVKKLEELG
TOP1_AQUAE        ----------------------KTTLEERK----------TQPPPRYTEGTLIKTLEKLG
D3SM80_THEAH      ----------------------KVTLEERR----------TEPPPRYTEATLVKTLEKLG
G8QVT8_SPHPG      ----------------------KLSEVEHQ----------TKPPARYTEASLVQELEKRG
TOP1_SYNE7        ----------------------ELAAIGHE----------TQPPARYTEASLVKMLENEG
TOP1_SYNY3        ----------------------EIDTVGHE----------TQPPARYTEASLVKTLESEG
TOP1_STRCO        ----------------------EITVDGHA----------TKPPARYTEASLVKELEERE
TOP1_MYCTU        ----------------------ELTPDGHA----------TNPPARYTEASLVKALEELG
TOP1_MYCLE        ----------------------DLTPDGHA----------TNPPARYTEASLVKALEELG
I0II60_PHYMF      ----------------------DLDPRQQF----------TSPPARYTEASLQKELEKEG
J9Z7K0_LEPFM      ----------------------EVTPDQHF----------TEPPPRYSEASLIRELEEKG
TOP1_BUCAI        ----------------------KVTPSQKF----------TKPPPRFSEASLVRELEKKG
TOP1_BUCAP        ----------------------KILPHQIF----------TKPPPRFSESSLVRELEKKG
TOP1_PSEAE        ----------------------KLDPSQHF----------TKPPARYSEASLVKELEKRG
TOP1_VIBCH        ----------------------SLDPKQHF----------TKPPARYTEAALVKELEKRG
TOP1_ECOLI        ----------------------ELTPAQHF----------TKPPARFSEASLVKELEKRG
TOP1_SALTY        ----------------------ELTPAQHF----------TKPPARFSEASLVKELEKRG
TOP1_HAEIN        ----------------------EVQPTQHF----------TKPPARFTEAALVKELEKRG
TOP1_PASMU        ----------------------HVLPEQLF----------TKPPARFSEAALVKELEKRG
TOP1_CAMJE        ----------------------NLEMNSHF----------TEPPSRYSEAGLVKKLESLG
TOP1_HELPY        ----------------------KLESNAHV----------TEPPARYSEASLIKVLESLG
TOP1_HELPJ        ----------------------KLESNAHV----------TEPPARYSEASLIKVLESLG
TOP1_TREPA        ----------------------NVQSVQHF----------TQGPVRYTDASIVKMLEEKG
TOP1_LACLA        ----------------------NVKPEQHF----------TQPPARYSEATLIKTLEENG
TOP1_STAS1        ----------------------NIEPSQHF----------TQPPPRYTEARLVKTMEELK
TOP1_STAAB        ----------------------QIEPAQHY----------TQPPPRYTEARLVKTLEELK
TOP1_STAA8        ----------------------QIEPAQHY----------TQPPPRYTEARLVKTLEELK
TOP1_STAAU        ----------------------QIEPAQHY----------TQPPPRYTEARLVKTLEELK
TOP1_STAAM        ----------------------QIEPAQHY----------TQPPPRYTEARLVKTLEELK
TOP1_STAHJ        ----------------------QIEPAQHF----------TQPPPRYTEARLVKTLEELK
TOP1_STAES        ----------------------KIEPAQHF----------TQPPPRYTEARLVKTLEELK
TOP1_BACSU        ----------------------DIEPEQHF----------TQPPPRYTEARLVKTLEERG
TOP1_BACHD        ----------------------EIEPSQHF----------TQPPPRYTEARLVKTMEELG
A5CVH7_VESOH      ----------------------NFKARESF----------SRAKPRYTEASLVKKIEEMG
Q28MI5_JANSC      VVEDDGNGDVRRSKSAILSREGAVLGQQHH----------TAPPPRYTEATLVKRMEELG
TOP1_XYLFT        ----------------------RILTEQHF----------TQPPPRYTEAALVKALEEYG
TOP1_XYLFA        ----------------------RILTEQHF----------TQPPPRYTEAALVKALEEYG
TOP1_RICTY        ----------------------EVIPNKHF----------TEPPPRYSEASLVKKLEELG
TOP1_RICPR        ----------------------EVIPNKHF----------TEPPPRYSEASLVKKLEELG
TOP1_RICBR        ----------------------EIIPNQHF----------TEPPPRYSEASLVKKLEELG
TOP1_RICFE        ----------------------EIIPNQHF----------TEPPPRYSEASLVKKLEELG
TOP1_RICCN        ----------------------AVIPNQHF----------TEPPPRYSEASLVKKLEELG
B7J7I8_ACIF2      ----------------------RGECLSKT----------TKAPPRYTESTLIKALEDHG
Q7WXW8_PSEAI      ----------------------SGEVLEKK----------TTPPKRFTDASLVGEMKRRG
C6XEP4_METGS      ----------------------NVTVCEHS----------TRPPKRYTKASLTNALERLG
B1M9R9_METRJ      ----------------------DGKVLDKK----------TEPPRRFTEATLLQKLEDEG
TOP1P_XYLFA       ----------------------RGKLLEKK----------TKPPSHYTQATLVKKLESEG
C8W7T0_ATOPD      ----------------------SLSLDAKQ----------TEPPARYSQGKLIQEMEKRG
E1RJ15_METP4      ----------------------DIRLEEKE----------TLPPPRYSQSKLIQVMEELG
C7P1M5_HALMD      ----------------------DVSLDAKQ----------TQPPRRYGQSRLIKKMEDFG
TOP1_THEAC        ----------------------DWNIQREE----------TKPPPRYDMSSLLKKMEELN
TOP1_ARCFU        ----------------------KKRLEEKE----------TKPPGRYSASSLIKMMEKLN
B5IE55_ACIB4      ----------------------KIEIERKE----------TRPPARYTQSSLIREMEKLN
B1L3G6_KORCO      ----------------------EVKIEEKE----------TQPPKRYSHISLIKEMERLG
TOP1_AERPE        ----------------------RVDVRVEW----------SQTPVRLDKASLLRWMESVN
A3DP02_STAMF      ----------------------KASIRKTY----------TKPPEKINKIKILRWMENVG
B8D5I1_DESA1      ----------------------KATASESY----------TKPPKRLTKTDLLRWMESVE
K0IBM4_NITGG      ----------------------GIDMEEKF----------TQPPYRYNQASLLAKMEQEQ
TOP1_METTH        ----------------------SVSADERE----------TKPPARYNEASLIRELERRG
F6D5C7_METPW      ----------------------EVRAEDKE----------TKPPARYNQASLIRELEKRG
TOP1_METJA        ----------------------KITITRKE----------TQPPKRYTVASIIKELEKRG
TOP1_PYRAB        ----------------------QVRREKKK----------TKPPARYSPAAVIKKMEDLG
TOP1_PYRHO        ----------------------QVKREKKK----------TKPPARYSPAAVIKKMEDLG
                                                                     .   :.   

Q6F0G3_MESFL      IGRPSTYTPTLSKLKEREYAIP-------------------------------------H
F0V2L5_MYCS3      IGRPSTYPLISEIVRTRNYANF-------------------------------------K
Q9PPP9_UREPA      VGRPSTYATMATIGTTRGYINK-------------------------------------D
TOP1_MYCGA        IGRPSTYSTILDIVLKRNYAEL-------------------------------------V
TOP1_MYCPN        IGRPSTYNTMASVNLDRGYASL-------------------------------------N
TOP1_MYCGE        IGRPSTYNTMASVNLERGYANL-------------------------------------V
Q3M6J7_TRIV2      IGRPSTYSPTIATLKKRGYVEL-------------------------------------T
Q4AA55_MYCHJ      VGRPSTFAISVKKLKDHLYVDS-------------------------------------E
B3PMD8_MYCA5      VGRPSTFASTINIIKKRLFVET-------------------------------------I
TOP1P_MIMIV       IGRPSTYVNTIKTIINREYVKITDVPGIKKDITIYSIKSENKKHIMEVYEDTDTILLGKE
Q8F5G0_LEPIN      IGRPSTYATVSETLLKRKYVYE-------------------------------------E
TOP1_BORBU        IGRPSTYSTIISTLLEREYAFK-------------------------------------L
H8H3H1_DEIGI      IGRPSTYASTLKTLLGRNYVAI-------------------------------------R
B1VAJ5_PHYAS      IGRPSTYSQIIFTLKKRFYVDM-------------------------------------I
TOP1_FERIS        IGRPSTYATIIQTLLDRGYVVK-------------------------------------K
TOP1_THEMA        IGRPSTYASTIKLLLNRGYIKK-------------------------------------I
B2V7T0_SULSY      IGRPSTYATIIKTIKERGYVVK-------------------------------------E
TOP1_AQUAE        IGRPSTYATIVKTLKERGYVEV-------------------------------------K
D3SM80_THEAH      IGRPSTYAQIVKTLKDRGYVTE-------------------------------------E
G8QVT8_SPHPG      IGRPSTYATIIKTLLDRKYVVK-------------------------------------D
TOP1_SYNE7        IGRPSTYASIIGTIVDRGYAQL-------------------------------------V
TOP1_SYNY3        VGRPSTYASIIGTIIDRGYVQM-------------------------------------R
TOP1_STRCO        IGRPSTYASIIGTILDRGYVFK-------------------------------------K
TOP1_MYCTU        IGRPSTYSSIIKTIQDRGYVHK-------------------------------------K
TOP1_MYCLE        IGRPSTYSSIIKTVQDRGYVQK-------------------------------------K
I0II60_PHYMF      IGRPSTYAAIIGTIQDRKYVET----------------------------------VNAR
J9Z7K0_LEPFM      IGRPSTYATILSTIQDREYVEK-------------------------------------K
TOP1_BUCAI        IGRPSTYSAITSKIQDRGYVKI-------------------------------------K
TOP1_BUCAP        IGRPSTYATIITKIKEKGYLKI-------------------------------------K
TOP1_PSEAE        IGRPSTYAAIISTIQERGYVTT-------------------------------------H
TOP1_VIBCH        IGRPSTYASIISTIQDRGYVKV-------------------------------------D
TOP1_ECOLI        IGRPSTYASIISTIQDRGYVRV-------------------------------------E
TOP1_SALTY        IGRPSTYASIISTIQDRGYVRV-------------------------------------E
TOP1_HAEIN        IGRPSTYAAIISTIQERGYVRT-------------------------------------E
TOP1_PASMU        IGRPSTYAAIISTIQERGYVRV-------------------------------------E
TOP1_CAMJE        IGRPSTYAPTISILTSRDYVTI-------------------------------------D
TOP1_HELPY        IGRPSTYAPTISLLQNRDYIKV-------------------------------------E
TOP1_HELPJ        IGRPSTYAPTISLLQNRDYIKV-------------------------------------E
TOP1_TREPA        IGRPSTYAPTISVLLDRYYVTR-------------------------------------I
TOP1_LACLA        VGRPSTYAPTLETIQKRYYVRL-------------------------------------S
TOP1_STAS1        IGRPSTYAPTIDTIQKRNYVKN-------------------------------------E
TOP1_STAAB        IGRPSTYAPTIDTIQKRNYVKL-------------------------------------E
TOP1_STAA8        IGRPSTYAPTIDTIQKRNYVKL-------------------------------------E
TOP1_STAAU        IGRPSTYAPTIDTIQKRNYVKL-------------------------------------E
TOP1_STAAM        IGRPSTYAPTIDTIQKRNYVKL-------------------------------------E
TOP1_STAHJ        IGRPSTYAPTIDTIQKRNYVKL-------------------------------------E
TOP1_STAES        IGRPSTYAPTIDTIQKRNYVKL-------------------------------------E
TOP1_BACSU        IGRPSTYAPTLDTIQRRGYVAL-------------------------------------D
TOP1_BACHD        IGRPSTYAPTLDTIQKRGYVAL-------------------------------------D
A5CVH7_VESOH      IGRPSTYSTMVSTVQDRNYVTKKNGRGVEREYQLIEIKDN------QVIQSQPSEVISGE
Q28MI5_JANSC      IGRPSTYASIMDTIQNRGYVIK-------------------------------------D
TOP1_XYLFT        IGRPSTYASIIQTLLFRKYVDM-------------------------------------E
TOP1_XYLFA        IGRPSTYASIIQTLLFRKYVDM-------------------------------------E
TOP1_RICTY        IGRPSTYASILSVLQDRKYVTL-------------------------------------E
TOP1_RICPR        IGRPSTYASILSVLQDRKYVAL-------------------------------------E
TOP1_RICBR        IGRPSTYATILSVLQDRKYVTL-------------------------------------E
TOP1_RICFE        IGRPSTYASILSVLQDRKYVSL-------------------------------------E
TOP1_RICCN        IGRPSTYASILSVLQDRKYVAL-------------------------------------E
B7J7I8_ACIF2      VGRPSTYASILKNLFAREYIRR-------------------------------------K
Q7WXW8_PSEAI      IGRPSSYASIVKNIIDKGQVQM-------------------------------------K
C6XEP4_METGS      IGRPATYASMVDGLTDRSYVQV-------------------------------------V
B1M9R9_METRJ      VGRPATFAAIMTNVLGRSYVEL-------------------------------------D
TOP1P_XYLFA       IGRPATYAAIMDNIVSRGYVKT-------------------------------------E
C8W7T0_ATOPD      LGTKSTRASIIDTLYQRKYLKN--------------------------------------
E1RJ15_METP4      LGTKSTRHDVIGKLFSRRYVEG--------------------------------------
C7P1M5_HALMD      LGTKSTRHNTIEKLYDRGYIEG--------------------------------------
TOP1_THEAC        LGTKSTRHDIIGKLIERGFIEG--------------------------------------
TOP1_ARCFU        LGTKSTRHEIIQKLVSRRYIHG--------------------------------------
B5IE55_ACIB4      LGTKSTRAEIIQKLFERGYVRG--------------------------------------
B1L3G6_KORCO      LGTKNTRVQIIDILKSRGYLEE--------------------------------------
TOP1_AERPE        IGTEGTRARIIETLYKRGYLEG-------------------------------------S
A3DP02_STAMF      IGTEATRARIIEILFSRYYLRS-------------------------------------V
B8D5I1_DESA1      IGTEATRAQIIEKLFERKYLYQ-------------------------------------H
K0IBM4_NITGG      IGTKATRADIIATLFKRNYIAS-------------------------------------S
TOP1_METTH        LGTKSTRADIIAKLYDRKYIEG--------------------------------------
F6D5C7_METPW      LGTKSTRANIIDILFSRKYVEG--------------------------------------
TOP1_METJA        LGTKATRAEIIDKLIKRGYVID-------------------------------------D
TOP1_PYRAB        IGTKATRAQILETLYQRGYIEG-------------------------------------K
TOP1_PYRHO        LGTKATRAQILETLYQRGYIEG-------------------------------------K
                  :*   :          .                                           

Q6F0G3_MESFL      RGK--PFEVTEKGYQAEEFLYNKYEDFFNVNYTAKMEENLDEIAEGKFDYKDWIKTIYED
F0V2L5_MYCS3      N-K--KFEITELGYKVSKDLDQNFSNFISYDYTRTMEEELDNISKLKTDWKKFLEGVFIA
Q9PPP9_UREPA      K-S--KLIPTELGIKVIQELKEAFPKVISIKFTSEMEERLDVIANGKLFWKDLVSTFIPI
TOP1_MYCGA        NGR--YYKTTDLGQKLAFELDKNFPTIINKEFTKNMETTLDEIAQGTVNDVSYLQAFWND
TOP1_MYCPN        K-H--AFHVTQLGEQVNEELSKHFGKIINKEFTKNMEKSLDEIAENKKNYQEFLRDFWSN
TOP1_MYCGE        N-R--FFYITELGEKVNNELSKHFGNVINKEFTKKMEKSLDEIAENKVNYQEFLKQFWTN
Q3M6J7_TRIV2      K-D--NLHPTNLGLEVDTFLQKALPDLLEAEFTAKMENALDAIAEGKQPWQIYLTTWNQN
Q4AA55_MYCHJ      S-K--SLVLSDFGKIVYENLKIISPEIIDAKFTAQVEEELDLIAQGKQDYKKYLDSMWSK
B3PMD8_MYCA5      N-G--ALHPTVFGEVVLKKLIEGFPNTITEEYTAQVEEELDEVSEGKADYKILLEDFWNR
TOP1P_MIMIV       N-K--KIVPTNLGITVNDFLMKYFPEFLDYKFTANMETDLDYVSTGTKNWVDIVQDFYDK
Q8F5G0_LEPIN      K-K--FFYPFSLGEKVNFFLQSSFGELFREKFTAELESDLDRIEKKEIDSNSILNRLWLD
TOP1_BORBU        N-N--TLMPTIKGAAVINLLEKYFPVLIELNFTSNMEEKLDKIAIGKLDKIKYLSKFYNG
H8H3H1_DEIGI      A-R--KLHVTPLGLCVALYLLQQLPQLVDARFTAQMEQDLDAIANGELKRLDYLDRVWRD
B1VAJ5_PHYAS      E-K--RFQPTEQGILTIQNLELFFKQFLDYQYTAQMESDLDKIASGLVDNKQLMQTFYTN
TOP1_FERIS        R-K--TLIPTILGFVVNHYLEQRFPDIVDKGFTAEMEKELDEVENGKKDWKEVVKSFLKE
TOP1_THEMA        R-G--YLYPTIVGSVVMDYLEKKYSDVVSVSFTAEMEKDLDEVEQGKKTDKIVLREFYES
B2V7T0_SULSY      N-G--SLRPTENAFHLIEYLNTRYNWVIDYSFTKKMEDFLDKVEENKKDWKEFVKQLHEK
TOP1_AQUAE        K-K--ALVPTEIAFQVVEFLMERFPTLMDYKFTAQMEEKLDLVEEGKLNWKSVVYEFMEK
D3SM80_THEAH      K-G--VLKPTPLGEQVLDFLEKYYPRLVDYKFTAYMEEELDSVEEGKD-WKTAVRYLFRA
G8QVT8_SPHPG      G-P--ALAPTFIGFGVCQYLEDYFAQFVDYDFTSTMESGLDQIASGQLDKESFLEKFYLG
TOP1_SYNE7        S-N--TLTPTFTAFAVTALLEQHFPDLVDTSFSARMEQSLDDISNGEVDWLPYLSQFYRG
TOP1_SYNY3        S-K--ALTPTFTAFAVVSLLESHFPDLVDTGFTSRMEQKLDEIAIGKTQWLPYLQGFFLG
TOP1_STRCO        G-T--ALVPSFLSFAVVNLLEKHFGRLVDYDFTARMEDDLDRIARGEAQSVPWLRRFYFG
TOP1_MYCTU        G-S--ALVPSWVAFAVTGLLEQHFGRLVDYDFTAAMEDELDEIAAGNERRTNWLNNFYFG
TOP1_MYCLE        G-S--ALVPSWVAFAVTGLLEQHFGRLVDYDFTAAMEDELDEIANGNEQRTNWLNNFYFG
I0II60_PHYMF      D-K--RLMATDLGKVVTDKLIEAFPEILDVGYTRDLEAQLDDIENDGRDWRKTLGDFYKP
J9Z7K0_LEPFM      D-N--RFHPTDLGKAVNRLLVESFPDLMSVRFTARMEEELDQVEEGERGYRDVVGDFYTP
TOP1_BUCAI        K-N--KFYAEKMGEILTIRLKKSFSNLIDYNFTAHMEKKLDQVAENKVTWRYLLDDFFKK
TOP1_BUCAP        K-N--KFYAAKIGEILITRLKKNFSDLVDYDFTARMEKNLDQVSDKLINWKHLLNSFFDN
TOP1_PSEAE        N-R--RFYAEKMGDIVTDRLNESFANLMDYGFTAGMEEHLDDVAQGERDWKHLLDEFYGD
TOP1_VIBCH        Q-R--RFFAEKMGEIVTDRLDENFDDLMNYDFTARMEEKLDQIAEGEVNWTAVLDEFFAD
TOP1_ECOLI        N-R--RFYAEKMGEIVTDRLEENFRELMNYDFTAQMENSLDQVANHEAEWKAVLDHFFSD
TOP1_SALTY        N-R--RFYAEKMGEIVTDRLEENFRELMNYDFTAQMEDSLDQVANHQAEWKAVLDNFFSD
TOP1_HAEIN        N-R--RFYAEKMGEIVTDRLNESFGELMNYDFTANMEDTLDKIASGSVNWKTELNQFFKD
TOP1_PASMU        N-R--RFYAEKMGEIVTDRLNQSFTALMNYDFTANMENILDQIANGEKNWKTELNQFFKD
TOP1_CAMJE        K-K--QLIPSDVAFNVTEVLEKNFSDIVDSKFTSNLENTLDEIAEDKADWQETLKEFYYP
TOP1_HELPY        K-K--QISALESAFKVIEILEKHFEEIVDSKFSASLEEELDNIAQNKADYQQVLKDFYYP
TOP1_HELPJ        K-K--QISALESAFKVIEILEKHFEEIVDSKFSASLEEELDNIAQNKADYQQVLKDFYYP
TOP1_TREPA        Q-K--QLMPTPLGKVISDLLTTYFHDVVDVSFTARMESKLDEVEEDKIKWNCVIADFYPA
TOP1_LACLA        A-K--RFEPTELGEIVNKLIVEFFPNIVNTEFTAEMEKDLDEVEEGKRQWIEVVDQFYKP
TOP1_STAS1        S-K--RFVPTELGEIVHEQVKDYFPEIIDVDFTVNMETLLDKVADGEIGWKKVISDFYSS
TOP1_STAAB        S-K--RFVPTELGEIVHEQVKEYFPEIIDVEFTVNMETLLDKIAEGDITWRKVIDGFFSS
TOP1_STAA8        S-K--RFVPTELGEIVHEQVKEYFPEIIDVEFTVNMETLLDKIAEGDITWRKVIDGFFSS
TOP1_STAAU        S-K--RFVPTELGEIVHEQVKEYFPEIIDVEFTVNMETLLDKIAEGDITWRKVIDGFFSS
TOP1_STAAM        S-K--RFVPTELGEIVHEQVKEYFPEIIDVEFTVNMETLLDKIAEGDITWRKVIDGFFSS
TOP1_STAHJ        S-K--RFVPTELGEIVYEQVKDYFPEIIDVEFTVNMETLLDKIAEGDIGWRKVIDNFYGS
TOP1_STAES        S-K--RFIPTELGEIVYEQVKEYFPEIIDVEFTVNMETLLDKIAEGDMNWRKVIGDFYNS
TOP1_BACSU        N-K--RFVPTELGQIVLDLIMEFFPEIINVEFTAKMERDLDHVEEGNTEWVKIIDNFYTD
TOP1_BACHD        E-R--RFVPTELGEIVLELMTEFFPEILDVEFTAKMEDDLDSIEEGKQQWIKIIDDFYKG
A5CVH7_VESOH      K-N--KLFPTNIAYLLTDFLVKYFNNIIDYKFTAKLESDFDTIATQNISWQGVVKNFYIP
Q28MI5_JANSC      K-G--RLIPEDKGRLVTVFLSNYFNRYVQYDFTADLEQQLDEVSAGDRHYKDVLDRFWRD
TOP1_XYLFT        G-R--SFRPTDIGRAVSKFLSSHFTQYVDYDFTAHLEDELDAISRGEEEWIPLMKKFWVP
TOP1_XYLFA        G-R--SFRPTDIGRAVSKFLASHFTRYVDYDFTAHLEDELDAISRGEEEWIPLMKKFWVP
TOP1_RICTY        K-K--RFIPEELGRLVTVFLVGFFKKYVEYDFTAGLENELDEIAAGKLEWKTSLNNFWSG
TOP1_RICPR        K-K--RFIPEELGRLVTVFLVGFFKKYVEYDFTAGLENELDEIAAGKLEWKTALNNFWRG
TOP1_RICBR        K-K--RFIPEELGRLVTVFLVGFFKKYVEYDFTAGLENELDEIAAGKLEWKSALGNFWNG
TOP1_RICFE        K-K--RFMPEELGRLVTVFLVGFFKKYVEYDFTAGLENELDEIAAGKLEWKAALNNFWSG
TOP1_RICCN        K-K--RFIPEELGRLVTVFLVGFFKKYVEYDFTAGLENELDAIAAGKLEWKAALNNFWSG
B7J7I8_ACIF2      G-KSPALYATELGEKIVEALSVF--DFSNVDYTREVEADLDRITEGQMRPRDLLAKSFAD
Q7WXW8_PSEAI      G-R--SLIPGELGEATIALLEHNFS-FLSLDFTRNLEVALDRIANSEDTYMNVVQQFYQL
C6XEP4_METGS      E-R--FLTPEPVGFAIYDALKGAFS-FIETEYTRGMESDLDLIVKGDKTYRSVVSSKYSD
B1M9R9_METRJ      KKR--CLLPTEIGELVVDNLLRGQFGFMELGFTRELEVQLDAIAEGKASYRDVVEPAYRQ
TOP1P_XYLFA       K-K--YLFPTETGELIVDSLVGKF-EFLDLGFTREIEESLDRIAQGESGYKAVIAKVHDQ
C8W7T0_ATOPD      --D--PVEPSQLGMAIVDALSQFAPHITSPDMTAELESDMTSVAEGKDTRDGVVTHSRSL
E1RJ15_METP4      --N--PLKPTLVGRAVTESLEDHAGLITKPDMTRTLEEHMEEIKKSILSKDSVVQESREM
C7P1M5_HALMD      --D--PPRPTTLAEAVVEAAEEFADRIVSEEMTAQMEADMSAIASGEATLDEVTAESREM
TOP1_THEAC        --N--PVKPTPLGMAFIDAVRSVNSHIADPEMTAKLEEDMDRIEKNEMSKNDVVEESKKM
TOP1_ARCFU        --N--PFRPSETAFSVINVLKETAETITLPDMTAKLENEMDLIAEGKKREPEVVDESREM
B5IE55_ACIB4      --N--PIRPTQLGKALIESLEGNNVDVIKPDMTARLEMDMDEIEKGSKAPEFVVKESREM
B1L3G6_KORCO      --G--SFKPTRLGEAIVEVLESFVPALTNPELTAKLERGMNEIELGKLDPSNFLKESLDE
TOP1_AERPE        R----KSEVTPLGEAVAVIIQTLFPELSKPDLTRRFESMIEDIRSGRRTRQEVIDMSKKT
A3DP02_STAMF      G-G--RVEATDLGLGIIEVLMEYFPEITSVSLTRHFEEEMEKIRLGVKRREEVVKDAKNT
B8D5I1_DESA1      Q-KSSGIDVSEIGFGVVEILEKFFPDLLSVELTRKFEKEMDSIRSGVKRRSEVLEEARRV
K0IBM4_NITGG      VRG--GIEVTDLGFAVIDSMRTFVPAIISTSLTRSMEEQLEKVEQGSAESVLVIEQAVDK
TOP1_METTH        --K--KIRVSPLGENIIDTLTRYCEKIISEELTRQFERELEDIMRGKISKDRVIDEAITE
F6D5C7_METPW      --K--KITVNKLGEQLIDTLRKYSKKITSEELTREFETKLEGIMEGKDKKDKIIDEARVE
TOP1_METJA        G----SLKVTDLGISVIETLKRFCPEIIDEKMTRDLEEKLEKIQFRKIKKDDVLDEAEKR
TOP1_PYRAB        K----SIKVTPLGMKVIETLEKYVPEIISVELTREFERKMDLIMQGKLTKEEVIEEAKVK
TOP1_PYRHO        K----SIKVTPLGMKVIETLEKYVPEIISVELTREFEKKMELIMEGRLTKEEVIEEAKER
                              .                   :  .*  :  :                 

Q6F0G3_MESFL      -LNASVKAQIQ------------------------------------------------E
F0V2L5_MYCS3      -WNDSLKGAEKA------------------------------------------------
Q9PPP9_UREPA      -FEEEVKQAYT---------------------KIEKVP----------------------
TOP1_MYCGA        -FSEVLNEAKT---------------------NIVKKV----------------------
TOP1_MYCPN        -FKEEVKLAE-------------------G--SIQRVKK--------------------E
TOP1_MYCGE        -FKSDVKLAEN---------------------SIQKVKKE--------------------
Q3M6J7_TRIV2      YFAPALAKAKT-------IAVD-------S--GNPTKTF-----PPR------------Q
Q4AA55_MYCHJ      -IENTIEKAVE---------------------VEKVIME---------------------
B3PMD8_MYCA5      -FQRSYDDASK---------------------TIEISIM--------------------P
TOP1P_MIMIV       -LKPIVDELSK-----------------------QKGLS---------------------
Q8F5G0_LEPIN      -LQTQIQNSKF--------------ILFQKEWATVLQKK---------------------
TOP1_BORBU        --KKGLKDTVM---------------------QLEPKID--------------------S
H8H3H1_DEIGI      ALKPAIAGAQ--------------------------------------------------
B1VAJ5_PHYAS      -FLQLYQIADQ---------------------KLEKIK----------------------
TOP1_FERIS        -FNKDLERAKN---------------------EFFAI-----------------------
TOP1_THEMA        -FSSVFDRNDR-------------------------IVV---------------------
B2V7T0_SULSY      SGSKQNVKISK---------------------KM--------------------------
TOP1_AQUAE        IFGKELEMVR--------------------------------------------------
D3SM80_THEAH      ------------------------------------------------------------
G8QVT8_SPHPG      --AEGLENQNT------L--------------QLAQDNK--------------------V
TOP1_SYNE7        --DRGLEEQV----------------------KLRESE----------------------
TOP1_SYNY3        --ESGLENQV----------------------KVRQDQ----------------------
TOP1_STRCO        -EGDGTGGGGA---------ADAGNGDGDHLGGLKELVT--------------------D
TOP1_MYCTU        -GDHGVPDSVA------------------RSGGLKKLVGINLEGIDAR------------
TOP1_MYCLE        -GNHGVSDSIA------------------RSGGLKKLVGVNIEGIDAR------------
I0II60_PHYMF      -FKVQLDDAM-------------------A--NMTHAKA--------------------A
J9Z7K0_LEPFM      -FHHEVEKAKK------------------G--GMANLKK--------------------L
TOP1_BUCAI        -FSEQLEQAKK-------SPEE-------G--GMELN----------------------N
TOP1_BUCAP        -FSQQLEQAKK-------PPEE-------G--GMELN----------------------T
TOP1_PSEAE        -FKKKLEVAEV-------SEK-----------GMRAN----------------------Q
TOP1_VIBCH        -FSRDLETAEQ-------DESL-------G--GMKPN----------------------H
TOP1_ECOLI        -FTQQLDKAEK-------DPEE-------G--GMRPN----------------------Q
TOP1_SALTY        -FTQQLDKAEK-------DPEE-------G--GMRPN----------------------Q
TOP1_HAEIN        -FSSQLSKAEL-------DELE-------G--GMRPN----------------------S
TOP1_PASMU        -FSQQLSQAEL-------DELE-------G--GMKPN----------------------S
TOP1_CAMJE        -FMRKIEEGKT---------------------KIASQKT---------------------
TOP1_HELPY        -FMDKIEAGKK---------------------NIISQKV---------------------
TOP1_HELPJ        -FMDKIEAGKK------------------N--IISQK----------------------V
TOP1_TREPA        -FSEKVSTVMK---------------------DLNSMRGVF-------------------
TOP1_LACLA        -FAKELENAEE---------------------GMEKIQI--------------------K
TOP1_STAS1        -FKQDVERAEE---------------------EMEKIEI--------------------K
TOP1_STAAB        -FKQDVERAEE---------------------EMEKIEI--------------------K
TOP1_STAA8        -FKQDVERAEE---------------------EMEKIEI--------------------K
TOP1_STAAU        -FKQDVERAEE---------------------EMEKIEI--------------------K
TOP1_STAAM        -FKQDVERAE-------------------E--EMEKIEI--------------------K
TOP1_STAHJ        -FKLDVERAEE---------------------EMEKVEI--------------------K
TOP1_STAES        -FKQDVERAE-------------------S--EMEKIEI--------------------K
TOP1_BACSU        -FEKRVKKAES---------------------EMKEVEI--------------------E
TOP1_BACHD        -FEERLKVAE-------------------E--EMKEVEI--------------------K
A5CVH7_VESOH      -FHQKIEDAVN---------------------ISREEIH---------------------
Q28MI5_JANSC      -FRAAIDETS----------------------DLRIGEV----LDKINEVLEPHLFPDPG
TOP1_XYLFT        -FKELVEDKKD---------------------SLDKTDAG--------------------
TOP1_XYLFA        -FKELVEDKKD---------------------SLDKTDAG--------------------
TOP1_RICTY        -FNNNIESVNE------------------Q--KITEIIN-----YLQKALDYHLF----G
TOP1_RICPR        -FNHNIESVNE------------------Q--KITEIIN-----YLQKALDYHLF----G
TOP1_RICBR        -FNHNIESVNK------------------Q--NITEIIS-----YVQQALDYHIF----G
TOP1_RICFE        -FNHNIESVNE------------------Q--KITEIIS-----YVQKALDYHLF----S
TOP1_RICCN        -FNHNIESVNE------------------Q--KITEIIS-----YVQKALDYHLF----G
B7J7I8_ACIF2      -IQRILDAMPT------------------------------------------------Q
Q7WXW8_PSEAI      -LQTELQTLRA----------LPSAQDEPRASSTASISS---------------------
C6XEP4_METGS      -LTTELASFG----------------------GAEIPRP---------------------
B1M9R9_METRJ      -LNEELARIAVSG-----------------------------------------------
TOP1P_XYLFA       -LNMELSTLQV-------------------------------------------------
C8W7T0_ATOPD      -LAGMIDVLID------------------HKEDLSEAIADAVT-----------------
E1RJ15_METP4      -LHEIFESLEA------------------NQEDIGSEIMDKTA-----------------
C7P1M5_HALMD      -LDRVFEELADSREEVGD--------------YLQESLK---------------------
TOP1_THEAC        -LHEVLSHFLT------------------KTADVKDIITKGIN-----------------
TOP1_ARCFU        -LLQILRAIDYRKLSK----------------DLREGVK---------------------
B5IE55_ACIB4      -LKKILNSLEE------------------NRSTVGSNIKSS-------------------
B1L3G6_KORCO      -LSAIMDEFKR------------------NELKISERLYEGLREY---------------
TOP1_AERPE        -ISKLLESFLD---------------------RLDTAVR------------------EIG
A3DP02_STAMF      -LIKLIVSFDK------------------KKYQIGKTLSYRLG-----------------
B8D5I1_DESA1      -LTELLGKFDR------------------N--RIEAGKQ-----LA-------------L
K0IBM4_NITGG      -LIESLSAFIE------------------KEVDIGARIGNAASSSANGAQ----------
TOP1_METTH        -VRSILSDIEE---------------------NLRDIGK------------------ELY
F6D5C7_METPW      -VSSILDDIEK------------------N--KLKIGEE-----LYKSY----------R
TOP1_METJA        -LRKILEEFKK--------KEEDIGIYLIK--NLDATNK---------------------
TOP1_PYRAB        -LTKILEEFKK------------------R--ELEIGLE-----LARIVVGDVKDEIKEE
TOP1_PYRHO        -LTKILEEFKK------------------RELEIGIELAKIVVGEDEV------------
                                                                              

Q6F0G3_MESFL      ----AKTSDIKCPR--CHEGNLVFIKSKF-G-RGR---GCSNF---TT-T-KCGYRE---
F0V2L5_MYCS3      ----EIVKDKSCPE--CGS-QCVYKFSRKNHNKFI---GCIDF------P-KCKFVENIE
Q9PPP9_UREPA      ----DEKINRLCPI--CAH-DLLIKRSRM-NTRFI---ACSNF------P-TCRFTESLE
TOP1_MYCGA        ----EYIEGKNCPN--CSS-QLVRREGRY-G-PFV---GCSNF------P-KCKFIEKSE
TOP1_MYCPN        ----KEFVGRDCPS--CAS-PLLYRYTKRGNEKFV---GCSNF------P-NCKYNEFSQ
TOP1_MYCGE        ----KELVERDCPK--CNQ-PLVYRYTKRGNEKFV---GCSDF------P-KCKYSEFSN
Q3M6J7_TRIV2      ----YDTSRTRCPD--CNNFLSKIPSSKLKK-KYF--LKCT--------S-GCENTVLFW
Q4AA55_MYCHJ      ----ARTTGEKCTE--CDA-DLVYRYNRKTNQRFI---GCSSF------P-NCRFIK---
B3PMD8_MYCA5      ----QEFLERSCPR--CGS-TLLYRNNSKKHTKFI---GCSNF------P-ACRYSENA-
TOP1P_MIMIV       ----QSSERLLGED--NDGNEITATKTKF-G-PVVRKKIGDKY------V-YAKIKDPLT
Q8F5G0_LEPIN      ----KETGWGICPV--CRNGILQKKKSSR-KKEFY---QCNRF------P-DCEFVSYEL
TOP1_BORBU        SEFRTVIESQKIEN--KNSINYTINIGKY-G-PYL-IFKGHNYSINAKTPLENLYKKDEI
H8H3H1_DEIGI      ----RTSPRIKVPG--REA-VFEVRDGQV--------------------TLRTADGAALL
B1VAJ5_PHYAS      ----PIETDQKCNL--CNEGNLLIKKSHY-G-SFL---GCSRF------P-DCKNTSPWK
TOP1_FERIS        ----DFDTDITCED--CSG-NYKLKVGKY-G-LYL---HC---------P-NCKTNKALK
TOP1_THEMA        ----DFPTNQKCS---CGK-EMRLSFGKY-G-FYL---KC-----------ECGKTRSVK
B2V7T0_SULSY      ----LDYAKDLAEK--HGKSIEEIKDDPEKLKEFI-----DAHAEKNPSQKQIEYAKSLA
TOP1_AQUAE        ------------------------------------------------------------
D3SM80_THEAH      ----------------------------------------------------------VA
G8QVT8_SPHPG      ----TSKTIRLSQI--SEENPIMI--GPY-G-PYV---LGSEV--------EGKAQYLSL
TOP1_SYNE7        ----IDPAAARTVA--LEGLPAKVRIGRF-G-AYLEA-EADGE------PIKANLPKELT
TOP1_SYNY3        ----IDPAIAKAIE--LENLAAKVKIGKF-G-PYIEIPQGEEI-------ITASIPQDLT
TOP1_STRCO        LGAIDAREVSSFPV----GNDIKLRVGRY-G-PYVERGEKDAE-----NHQRADVPEDLA
TOP1_MYCTU        ----EVNSIKLFDD--THGRPIYVRVGKN-G-PYLERLVAGDT--GEPTPQRANLSDSIT
TOP1_MYCLE        ----EVNSIKLFDD--EHGRPVYVRVGKT-G-PYLERLLAGDD--GELTPQRANLNGTLT
I0II60_PHYMF      ----TEVSDHLCPT--CGS-PCEYRLGKN-G-RFL---SCTAFNVPPVEV-RPEKDPVAP
J9Z7K0_LEPFM      ----EVPTEVPCPV--CQS-PMNRKWGKN-G-PYL---SCSRY------P-ECKTTRNFT
TOP1_BUCAI        ----IVPTSLNCPI--CCK-KMGIKTAIT-G-VFL---SCLGYNNTDNKK-RCKKTINLI
TOP1_BUCAP        ----TVPTEIDCSL--CNK-KMGIKTAVT-G-VFL---SCLGYNSEPNEK-RCKNTINLI
TOP1_PSEAE        ----PTLTNIPCRE--CGR-PMMIRTAST-G-VFL---GCSGY-SLPPKE-RCKATVNLI
TOP1_VIBCH        ----IVMTNILCPT--CSR-PMGIRTAST-G-VFL---GCSGY-GLPPKE-RCKTTINLG
TOP1_ECOLI        ----MVLTSIDCPT--CGR-KMGIRTAST-G-VFL---GCSGY-ALPPKE-RCKTTINLV
TOP1_SALTY        ----MVLTSIDCPT--CGR-KMGIRTAST-G-VFL---GCSGY-ALSPKE-RCKTTINLV
TOP1_HAEIN        ----LVETDIKCPT--CGR-NMAIRTAST-G-VFL---GCTGY-ALPPKE-RCKTTINLI
TOP1_PASMU        ----LVPTDINCPT--CGR-KMAIRTAST-G-VFL---GCSGY-ALPPKE-RCKTTMNLI
TOP1_CAMJE        ----VTKLGESCPD--CGG-ELAIRKGRF-G-EFV---ACLNF------P-KCKYSRNLK
TOP1_HELPY        ----HEKTGQSCPK--CGG-ELVKKNSRY-G-EFI---ACNNY------P-KCKYVKQTE
TOP1_HELPJ        ----HEKTGQSCPK--CGG-ELVKKNSRY-G-EFI---ACNNY------P-KCKYIKQTE
TOP1_TREPA        ----DEKTDVVCSQ--CGD-TMVKKLGRF-G-FFL---ACGKF------P-ECRNTQPVP
TOP1_LACLA        ----DEPAGFDCDV--CGS-PMVIKLGRF-G-KFY---ACSNF------P-DCRNTKAIV
TOP1_STAS1        ----DEPAGEDCEV--CGS-PMVIKMGRY-G-KFM---ACSNF------P-DCRNTKAIV
TOP1_STAAB        ----DEPAGEDCEV--CGS-PMVIKMGRY-G-KFM---ACSNF------P-DCRNTKAIV
TOP1_STAA8        ----DEPAGEDCEI--CGS-PMVIKMGRY-G-KFM---ACSNF------P-DCRNTKAIV
TOP1_STAAU        ----DEPAGEDCEV--CGS-PMVIKMGRY-G-KFM---ACSNF------P-DCRNTKAIV
TOP1_STAAM        ----DEPAGEDCEV--CGS-PMVIKMGRY-G-KFM---ACSNF------P-DCRNTKAIV
TOP1_STAHJ        ----DEPAGEDCEV--CGS-PMVIKMGRY-G-KFM---ACSNF------P-DCRNTKAIV
TOP1_STAES        ----DEPAGEDCEV--CGS-PMVIKMGRY-G-KFM---ACSNF------P-DCRNTKAIV
TOP1_BACSU        ----PEYAGEDCEL--CSS-PMVYKMGRY-G-KFL---ACSNF------P-DCRNTKPIV
TOP1_BACHD        ----DEPTGEMCEK--CGH-EMVYKMGRY-G-KFM---ACSNF------P-DCRNTKPIV
A5CVH7_VESOH      ----SMRNLGVDPK--SDK-PVSVRVGRY-G-AFVQI-GHTDD--------KDKPTFASF
Q28MI5_JANSC      ----DGTDPRLCPN--CGVGRLSMRTARAGG-AFI---GCSAY------P-ECRYTRPFG
TOP1_XYLFT        ----SVRLLGIDPT--SGK-EVSARIGRF-G-PMVQIGTVDDE------E-KPRFASLRP
TOP1_XYLFA        ----SVRLLGIDPT--SGK-EVSGRIGRF-G-PMVQIGTVDDE------E-KPRFASLRP
TOP1_RICTY        ----ENKESKVCPS--CKTGQLSLKLGKF-G-AFL---ACSNY------P-ECTFKKSIV
TOP1_RICPR        ----EDKESKVCPS--CKTGQLSLKLGKF-G-AFL---ACSNY------P-ECTFKKSIV
TOP1_RICBR        ----ENKDSKVCPS--CKTGELSLKLGKF-G-AFL---ACSNY------P-ECNFRKSIV
TOP1_RICFE        ----ENKESKACPS--CKTGELSLKLGKF-G-AFL---ACSNY------P-ECTFRKSIV
TOP1_RICCN        ----ENKESKICPS--CNTGELSLKLGKF-G-AFL---ACSNY------P-ECTFRKSIV
B7J7I8_ACIF2      ----ARAQGRPCPIEGCDGTVRRLESKRKPGVFFW---MCSNR--------DAHPLLQDN
Q7WXW8_PSEAI      ----APTSDFLCGK--CGLPLVHRKKAGKGGFDFW---GCSGY-----RTTGCKVSYPTK
C6XEP4_METGS      ----APSTVGSCPK--CGK-GMVQRTGSR-G-PFL---GCSGY------P-KCKETQQLP
B1M9R9_METRJ      ----EFTPRFKCPK--CGTG--MRRYAKPGKSPFW---RCTAE------AETCGHYMDDD
TOP1P_XYLFA       ----SATPKHPCQE--CGK-PLRRIPGKN-G-HFW---GCSGY------P-DCSVTFPDE
C8W7T0_ATOPD      ----ADAKVGTCPK--CGKDLVAKSSLKTRG-SFV---GCMGW------P-DCDVTYPLP
E1RJ15_METP4      ----EERVVGKCPV--CGK-SLMIRTTKGMA-QFI---GCTGY------P-DCSFNIGLP
C7P1M5_HALMD      ----ADKTLGPCPE--CGE-DLLVRRSRQ-GSYFV---GCDGF------P-ECRFTLPLP
TOP1_THEAC        ----AGQEIGDCPF--HEGKKIMVIRDRF---TYT--VRCEDP--------SCKINFRIK
TOP1_ARCFU        ----KDKIVGKCPE--CGG-ELVVRQSKA-GKRFI---GCSNY------P-DCTFTLPLP
B5IE55_ACIB4      ----MRREIGECPD--GGK---LIYLERK---RLV---VCEND--------GETKYYNLP
B1L3G6_KORCO      ----RSGSLGKCPE--CGG-DLNMRKSSY-G-YFI---VCSNY------PEKCDVKFNLF
TOP1_AERPE        VSLGSVEVEAACHL--CGRKAVSAVSGYR---------LCSHH-----MEAFDRLRKALP
A3DP02_STAMF      ----YITPINKCIL--CNREAYKNNLCKY---HYR----------------ALNTVIKTY
B8D5I1_DESA1      ----RLKIIQNTRK--CRV-SSCYREGVVNG-------LCSHH------ANAVKLVREYY
K0IBM4_NITGG      ----AATMIGSCPV--CKKGQLRMIKSYKTKKRFV---GCSNY------SGGCKATAPLP
TOP1_METTH        RAYQDSRVVGECPA--CGG-KLVIKYSPRNRSTFV---GCSSY------P-DCRTVYSLP
F6D5C7_METPW      ----ESRVVGKCK---CGKNLILIDSPR--GSTFV---GCSGY------P-ECKSTYSMP
TOP1_METJA        ----KAKIVGKCPK--CGGDLILIRHKKG---RFV---GCSNY------P-ECDVKYSLP
TOP1_PYRAB        ----KPIVVGKCPK--CGG-DLIVKYNKKTGKRFV---GCSNW------P-KCDVTYPIL
TOP1_PYRHO        ----KPLVVGKCPK--CGG-DLIVKYNKKTGKRFV---GCSNW------P-KCDVTYPIL
                                                                              

Q6F0G3_MESFL      ------------------------------------------------------------
F0V2L5_MYCS3      QPQKEVELLD--------------------KLCSECKSPLAKKKNRWGNEFIS-------
Q9PPP9_UREPA      KPEILNE-----------------------------------------------------
TOP1_MYCGA        QKAKEIVYEE--------------------------------------------------
TOP1_MYCPN        NKPNLTLEKL--------------------------------------------------
TOP1_MYCGE        PKPKLTLETL--------------------------------------------------
Q3M6J7_TRIV2      SEFSKTWQA---------------------------------------------------
Q4AA55_MYCHJ      ------------------------------------------------------------
B3PMD8_MYCA5      ------------------------------------------------------------
TOP1P_MIMIV       LDTIKLSDAI--------------------------------------------------
Q8F5G0_LEPIN      PESLE-------------------------------------------------------
TOP1_BORBU        EKIINEKELK--------------------------------------------------
H8H3H1_DEIGI      PAELLPEDLD--------------------------------------------------
B1VAJ5_PHYAS      VQEKNKSKDS--------------------------------------------------
TOP1_FERIS        SDVFGVIDGN--------------------------------------------------
TOP1_THEMA        NDEIAVIDDG--------------------------------------------------
B2V7T0_SULSY      EKTGLKLTEK--------------------------------------------------
TOP1_AQUAE        ------------------------------------------------------------
D3SM80_THEAH      PEEELPSSTS--------------------------------------------------
G8QVT8_SPHPG      PLDWTPGNITDEDVKALIARGKVKAEPEILGTGKVAGLPVQLLNGRFGPYWQE-------
TOP1_SYNE7        PADLDVQRVE-------TLLRQKTEGPDQLGTHPETDEPIYLLTGAYGPYVQL-------
TOP1_SYNY3        PADLNPEQVA-------VLLKQKTEGPDKVGIHPETGEPIFILIGAYGPYVQL-------
TOP1_STRCO        PDELSVELAEELLAKPSGDFE--------LGTDPATGHAIVAKDGRYGPYVTE-------
TOP1_MYCTU        PDELTLQVAEELFATPQQGRT--------LGLDPETGHEIVAREGRFGPYVTE------I
TOP1_MYCLE        PDELTLEVAEELFATPHEGRV--------LGVDPETGHEIVAKDGRYGPYVTEVLPKHDD
I0II60_PHYMF      DGSPWLLHKAKGKARPKITTA--------DGETKLGWTKLSKTDKERFMNLSE-------
J9Z7K0_LEPFM      EEDGQIRIVE------EALPE--------GEVCHVCQAPMVIKKGRFGTFLAC-------
TOP1_BUCAI        TLNDFNKEQD--NQKKISLQL--------IQKCDICNMYMDSYFINEKLKLHI-------
TOP1_BUCAP        SLNDLSTTKK--EEKNFHLK----------NRCKKCNLVMDVYLINENLKIFI-------
TOP1_PSEAE        PGDEIAADDE-GESESRVLRG--------KHRCPICSTAMDAYLLDEKHKLHI-------
TOP1_VIBCH        DEEGVINVLE-EDVETAALRA--------KKRCPICETAMDAYLIDDKRKLHV-------
TOP1_ECOLI        PENEVLNVLEGEDAETNALRA--------KRRCPKCGTAMDSYLIDPKRKLHV-------
TOP1_SALTY        PENEVLNVLEGDDAETNALRA--------KRRCQKCGTAMDSYLIDPKRKLHV-------
TOP1_HAEIN        PEAELLNVLD-ESSETKALMD--------RKRCTKCGTAMDSYVIDAHRKIHI-------
TOP1_PASMU        PEAELLNVLD-EASETKALME--------RKRCPKCGTAMDSYLIDPERKIHI-------
TOP1_CAMJE        SESKNESENT--------------------------------------------------
TOP1_HELPY        SANDEADQ----------------------------------------------------
TOP1_HELPJ        NANDEAKQ----------------------------------------------------
TOP1_TREPA        ------------------------------------------------------------
TOP1_LACLA        KE----------------------------------------------------------
TOP1_STAS1        KT----------------------------------------------------------
TOP1_STAAB        KS----------------------------------------------------------
TOP1_STAA8        KS----------------------------------------------------------
TOP1_STAAU        KS----------------------------------------------------------
TOP1_STAAM        KS----------------------------------------------------------
TOP1_STAHJ        KT----------------------------------------------------------
TOP1_STAES        KT----------------------------------------------------------
TOP1_BACSU        KQ----------------------------------------------------------
TOP1_BACHD        KE-------I--------------------------------------------------
A5CVH7_VESOH      RGLLDIESIT--------------------------------------------------
Q28MI5_JANSC      PPDPEAEASA--------------IPPDGKLLGEDQGDEIRIFKGRFGPYVQR-------
TOP1_XYLFT        NQSIYSISLE--------------------------------------------------
TOP1_XYLFA        NQSIYSISLE--------------------------------------------------
TOP1_RICTY        SGNDNNEDEG--------------------------------------------------
TOP1_RICPR        SGNDNNEDEG--------------------------------------------------
TOP1_RICBR        SGNDNNEADG--------------------------------------------------
TOP1_RICFE        SGNDNNENDG--------------------------------------------------
TOP1_RICCN        SGNDNNENEG--------------------------------------------------
B7J7I8_ACIF2      DGEPGAPFAE--------------------------------------------------
Q7WXW8_PSEAI      SG----------------------------------------------------------
C6XEP4_METGS      KGA---------------------------------------------------------
B1M9R9_METRJ      KGKPVERTAH---------------------PCPRCGETLRRFKRK--------------
TOP1P_XYLFA       GGKPGQKKPV--------------------------------------------------
C8W7T0_ATOPD      QGRVEPLEGE--------------------------------------------------
E1RJ15_METP4      SGQWGKAIRDNKICEIHGMNHIRLVRKGSPPWDLGCPLCNHISSNLETLNMIP-------
C7P1M5_HALMD      STGEPQVLDDSCEDHGLNHVKMLAGRDTFVHGCPRCEAE---------------------
TOP1_THEAC        RNGSITLSDQ--------------------------------------------------
TOP1_ARCFU        QNGTLYITAK--------------------------------------------------
B5IE55_ACIB4      KTGHIEFLDK--------------------------------------------------
B1L3G6_KORCO      KNERFEGKFC--------------------------------------------------
TOP1_AERPE        NLASTISSTP--------------------------------------------------
A3DP02_STAMF      DEWKRREGVD--------------------------------------------------
B8D5I1_DESA1      GEWSRRKDIT--------------------------------------------------
K0IBM4_NITGG      QKGAIRVLGK--------------------------------------------------
TOP1_METTH        RGASVL------------------------------------------------------
F6D5C7_METPW      RGATVL------------------------------------------------------
TOP1_METJA        DKGRIKIPNKVCDACKSPILKIGDREICINPECPLKQVEVKE------------------
TOP1_PYRAB        QRGEIIPTNK--------------------------------------------------
TOP1_PYRHO        QRGEIIPTNK--------------------------------------------------
                                                                              

Q6F0G3_MESFL      ------------------------------------------------------------
F0V2L5_MYCS3      -------------------------------CSNYPKCKYIERNKQEYETVENSFCPE-C
Q9PPP9_UREPA      ------------------------------------------------------LCPN--
TOP1_MYCGA        ----------------------------------------------------GVKCEL--
TOP1_MYCPN        ----------------------------------------------------EELCPE--
TOP1_MYCGE        ----------------------------------------------------DELCPE--
Q3M6J7_TRIV2      -----------------------------------------------------------P
Q4AA55_MYCHJ      -----------------------------------------------------------V
B3PMD8_MYCA5      ------------------------------------------------------------
TOP1P_MIMIV       ----------------------------------------------KLLEYPKNLGQY--
Q8F5G0_LEPIN      ------------------------------------------------------------
TOP1_BORBU        ---------------------------------------------------PNILGVD-P
H8H3H1_DEIGI      ------------------------------------------------------------
B1VAJ5_PHYAS      ----------------------------------------------DHSNQTDQKCNL-C
TOP1_FERIS        -----------------------------------------KLYVLEEQESQEENGEKNS
TOP1_THEMA        ---------------------------------------------------KIFLGRKDS
B2V7T0_SULSY      ------------------------------------------------ELLDRKLLTKWI
TOP1_AQUAE        ------------------------------------------------------------
D3SM80_THEAH      ------------------------------------------------------------
G8QVT8_SPHPG      ------------------GEGKDAKRASIPKWVMDAEKQHELEIANRYLSLPRLLGKD--
TOP1_SYNE7        --------------G--AATEEKPKPKRASLPKGMSLETISLEQAVGLLSLPRTLGEH-P
TOP1_SYNY3        --------------G--EATEENKKPKRTSLPKGVKPEDVTLEMAVGLLALPRNLGEH-P
TOP1_STRCO        ----------VLPEGTPKTGKNAVKPRTASLFKSMSLDTVTLDDALKLMSLPRVVGAD--
TOP1_MYCTU        LPEPAADAAAAAQGVKKRQKAAGPKPRTGSLLRSMDLQTVTLEDALRLLSLPRVVGVD-P
TOP1_MYCLE        DYGAADQGTKKTKKGRRASASQGPKPRTGSLLRSMDLQTITLEDALKLLLLPRVVGVD-P
I0II60_PHYMF      -------------------------QMPEPCKYACPIDRNGNPQAPELTD---VLCPV--
J9Z7K0_LEPFM      -------------------------SRYPACKTTRPWPPKTEASLPAVRPADAPSCPE-C
TOP1_BUCAI        -------------------------CANNPSCSGYKF-EKGVFKSPIYLS-KTIQCEK-C
TOP1_BUCAP        -------------------------CINNPSCNGYNL-KKGIFKKSLNCSLKKIKCEK-C
TOP1_PSEAE        -------------------------CGNNPDCPGYEI-EEGQYRIKGYEG-PSLECDK-C
TOP1_VIBCH        -------------------------CGNNPNCEGFIV-EEGEFKVKGYEG-PTVECDK-C
TOP1_ECOLI        -------------------------CGNNPTCDGYEI-EEGEFRIKGYDG-PIVECEK-C
TOP1_SALTY        -------------------------CGNNPTCDGYEI-EEGEFRIKGYDG-PIVECEK-C
TOP1_HAEIN        -------------------------CGNNPNCDGYLI-EEGSFKIKGYDG-PVVECDK-C
TOP1_PASMU        -------------------------CGHNPNCDGYVL-EQGSFKIKGYDG-PIVECDK-C
TOP1_CAMJE        -------------------------------------------AAKAKANGTGITCPS-C
TOP1_HELPY        -----------------------------------------------------ELCEK--
TOP1_HELPJ        -----------------------------------------------------ELCEK--
TOP1_TREPA        ----------------------------------------------------LAKCPRPA
TOP1_LACLA        ---------------------------------------------------IGVKCPL-C
TOP1_STAS1        ---------------------------------------------------IGVTCPK-C
TOP1_STAAB        ---------------------------------------------------IGVKCPK-C
TOP1_STAA8        ---------------------------------------------------IGVKCPK-C
TOP1_STAAU        ---------------------------------------------------IGVKCPK-C
TOP1_STAAM        ---------------------------------------------------IGVKCPK-C
TOP1_STAHJ        ---------------------------------------------------IGVTCPK-C
TOP1_STAES        ---------------------------------------------------IGVTCPK-C
TOP1_BACSU        ---------------------------------------------------IGVKCPS-C
TOP1_BACHD        ----------------------------------------------------GVKCPK-C
A5CVH7_VESOH      -----------------------------------------LDEALELFNMPRHLGET--
Q28MI5_JANSC      --------------G--AMTEENKKPPRQSIPKDWTPEELDLERALMLLSLPRQIGPH-P
TOP1_XYLFT        -------------------------------------------EAIELFKMPRVLGED--
TOP1_XYLFA        -------------------------------------------EAIELFKMPRVLGED--
TOP1_RICTY        -------------------------------------------NLSTILNDNKILGTD--
TOP1_RICPR        -------------------------------------------DPSTILNDNKILGTD--
TOP1_RICBR        -------------------------------------------EAKDIVNENKVLGKD--
TOP1_RICFE        -------------------------------------------DLAATPNENKVLGTD--
TOP1_RICCN        -------------------------------------------EPAAMPNENKVLGTD--
B7J7I8_ACIF2      ----------------------------------------------RVEAGDGPACPE--
Q7WXW8_PSEAI      ------------------------------------------------------------
C6XEP4_METGS      ------------------------------------------------------------
B1M9R9_METRJ      -------------------------NGGGLVWVCPAEACETFLDDVGGKPVALHTCTK-C
TOP1P_XYLFA       -------------------------------------------------EVSNFACVK-C
C8W7T0_ATOPD      ----------------------------------------------------AGVCPE-C
E1RJ15_METP4      ----------------SISKDLISNLHSHNIYTVYEIANENPEKLSKVTGISKEDSEKLI
C7P1M5_HALMD      -------------------------------------------KADETDDEVIGACPE-C
TOP1_THEAC        ------------------------------------------------------KCPV-C
TOP1_ARCFU        ------------------------------------------------------QCKE--
B5IE55_ACIB4      ------------------------------------------------------KCPI-C
B1L3G6_KORCO      ------------------------------------------------------ECGL-P
TOP1_AERPE        -----------------------------------------------------------R
A3DP02_STAMF      ------------------------------------------------------------
B8D5I1_DESA1      -----------------------------------------------------------F
K0IBM4_NITGG      ------------------------------------------------------ACPE-C
TOP1_METTH        ----------------------------------------------------KSLCEK-C
F6D5C7_METPW      ----------------------------------------------------KTTCEE-C
TOP1_METJA        ---------------------------------------------------EDRICPK--
TOP1_PYRAB        ----------------------------------------------------------TC
TOP1_PYRHO        ------------------------------------------------------TC---C
                                                                              

Q6F0G3_MESFL      -----YEQRDGS--------WLEYVAKPK-------------------------------
F0V2L5_MYCS3      NSQLVYKNSKRK--------GNKFIACSG---------FPNCRYSSTLEGKRIE------
Q9PPP9_UREPA      CSKSLVKRKNRK--------NKYFIGCTG-------------------------------
TOP1_MYCGA        -CHAKLIRRVAK------------------------------------------------
TOP1_MYCPN        -CNSQLVKRRTK--------FNPNKTFVG-------------------------------
TOP1_MYCGE        -CNNKLVKRRTK--------FNAKKTFIG-------------------------------
Q3M6J7_TRIV2      RTKDDKMAENGQ--------KNHLSPATK---------LP--------------------
Q4AA55_MYCHJ      DENAKKVYRFRK--------RNTKILTNK-------------------------------
B3PMD8_MYCA5      -DGTPTGQKTYK--------PRYYKKSSK-------------------------------
TOP1P_MIMIV       -KGFDVLLQKGD--------YGFYLSYNK-----------------------------EN
Q8F5G0_LEPIN      ------------------------------------------------------------
TOP1_BORBU        LTGLNVIFKNTI--------YGNIVQLGEDTHAPQEYTKKGKPKKLKIIKAKKAST----
H8H3H1_DEIGI      -ERSIPALLAGT--------WKPSLKSTR-------------------------------
B1VAJ5_PHYAS      NEGNLLIKKSR---------YGSFLGCSR-------------------------------
TOP1_FERIS        VQSEESSANSGN---------RKFYRKRR-------------------------------
TOP1_THEMA        ESGSPDGRSVEG--------KGNLSE----------------------------------
B2V7T0_SULSY      NKAKKEMMKNYQ--------LSEKQKNV--------------------------------
TOP1_AQUAE        ------------------------------------------------------------
D3SM80_THEAH      ------------------------------------------------------------
G8QVT8_SPHPG      KDGNDIVAAKGK--------FGPFISCNGEFRNLRKTDHDAQLFSITLEEALALLAEEKP
TOP1_SYNE7        ETGRRIQAGLGR--------FGPYVVCDL---------GGGEKDYRSLKADDDVLTIDLD
TOP1_SYNY3        ESGKNIKASLGR--------FGPYVVHDQ---------GKDGKDYRSLKGDDDVLTITLE
TOP1_STRCO        AEGVEITAQNGR--------YGPYLKKGT--------------DSRSLQTEDQLFEITLE
TOP1_MYCTU        ASGEEITAQNGR--------YGPYLKRGN--------------DSRSLVTEDQIFTITLD
TOP1_MYCLE        ASGEEITAQNGR--------YGPYLKRGK--------------DSRPLTTEDQMFIITLD
I0II60_PHYMF      -DGEPMIQRTGR--------FGPFLASSN---------YPAVQYILKLHPKTG-------
J9Z7K0_LEPFM      --SSTMVQKRGR--------FGSFWACSR---------YPE-------------------
TOP1_BUCAI        --YNNMKLKIGP--------FGKFFTCIN---------KICKNTRKILPNG---------
TOP1_BUCAP        --KNDMLFKTGR--------FGNFFMCIN---------DTCKNTRKILPNG---------
TOP1_PSEAE        --GSEMQLKTGR--------FGKFFGCTN---------PTCKNTRKLLKNG---------
TOP1_VIBCH        --GSDMVLKNGR--------FGKYMGCTN---------DACKNTRKILKNG---------
TOP1_ECOLI        --GSEMHLKMGR--------FGKYMACTN---------EECKNTRKILRNG---------
TOP1_SALTY        --GSEMHLKMGR--------FGKYMACTN---------DECKNTRKILRNG---------
TOP1_HAEIN        --GADMHLKLGR--------FGKYMGCTN-----------CDNTRKILKNG---------
TOP1_PASMU        --GADMHLKLGR--------FGKYMGCTS-----------CDNTRKILKSG---------
TOP1_CAMJE        QKGEIVERFSKR---------GKFYGCSA---------YPK-------------------
TOP1_HELPY        -CGGEMVQKFSR--------NGAFLACNN---------YPECKNTKSL------------
TOP1_HELPJ        -CGGEMVQKFSR--------NGAFLACNN---------YPECKNTKSL------------
TOP1_TREPA        CDGNIVGKKTRG--------RKEFYGCTR-------------------------------
TOP1_LACLA        HEGNIIERKTKK--------NRIFYGCDR---------YPD-------------------
TOP1_STAS1        KEGDVVERKSKK--------NRIFYGCSK---------YPE-------------------
TOP1_STAAB        NDGDVVERKSKK--------NRVFYGCSK---------YPE-------------------
TOP1_STAA8        NDGDVVERKSKK--------NRVFYGCSK---------YPE-------------------
TOP1_STAAU        NDGDVVERKSKK--------NRVFYGCSK---------YPE-------------------
TOP1_STAAM        NDGDVVERKSKK--------NRVFYGCSK---------YPE-------------------
TOP1_STAHJ        KDGDVVERKSKK--------NRLFYGCSN---------YPE-------------------
TOP1_STAES        NEGDVVERKSKK--------NRIFYGCSR---------YPE-------------------
TOP1_BACSU        GEGNIVERKSKK--------KRVFYGCDR---------YPD-------------------
TOP1_BACHD        EKGEIVERKSKK--------RRVFYGCNQ---------YPE-------------------
A5CVH7_VESOH      DNFGTIKANYGR--------FGPYIQYGK-------------------------------
Q28MI5_JANSC      EDGIMVWSNIGR--------YGPYLKHAESTSDRGGTNANLDGLDEVFTVGMNRAVQLLA
TOP1_XYLFT        -QSQQVSVGIGR--------FGPFAKRGS-------------------------------
TOP1_XYLFA        -QSQQVSVGIGR--------FGPFAKRGS-------------------------------
TOP1_RICTY        KDGVEIYLKTGP--------YGPYIQLGE---------Q-CGKVKPKRTPVPTNLKQS--
TOP1_RICPR        QDGVEIYLKKGP--------YGPYIQLGE---------Q-CGKVKPKRTPVPANLKQS--
TOP1_RICBR        KEGIEIYLKKGP--------YGPYIQYGE---------QVDSKIKPKRSPLPAGLNQN--
TOP1_RICFE        KDGIEIYLKKGP--------YGPYVQLGE---------Q-EGKVKPKRSPVPASLNQN--
TOP1_RICCN        KDGVEIYLKKGP--------YGPYIQLGK---------Q-EGKVKPKRSPVPASLNQN--
B7J7I8_ACIF2      CGAATSRQETGK--------GYGYFRCGK-------------------------------
Q7WXW8_PSEAI      --RPDFDNPRGL------------------------------------------------
C6XEP4_METGS      ------------------------------------------------------------
B1M9R9_METRJ      NAPLRRYQKKDRETGKPTGAFGWFCTDTE-----------------------------N-
TOP1P_XYLFA       GNPLKHLVKKGK-------GGYDFWGCSG-------------------------------
C8W7T0_ATOPD      GAPRVKVQPFRQ---------RAYETCIN-------------------------------
E1RJ15_METP4      READEVLELLRK--------RSELKKFVRKIIPPKRGRSHAKVLNMFFDAGIVDMESL--
C7P1M5_HALMD      GEGAAPEEQRGE--------GGDSEAQSA-------------------------------
TOP1_THEAC        GLPMIKIIRKGQ---------SPEIKCID-------------------------------
TOP1_ARCFU        HEIKEVKIRTKK--------GYWNLGCPY-------------------------------
B5IE55_ACIB4      GLSLIKIIRRGQ---------SPEIRCLD-------------------------------
B1L3G6_KORCO      LVSGRIKTKSNR--------GRGYTRCIA-------------------------------
TOP1_AERPE        EALEAIARGRSR--------AGAWVRDVA-------------------------------
A3DP02_STAMF      --------------------WNKYLSSIK-------------------------------
B8D5I1_DESA1      NEYIDKLRKSKL--------TGKWVKEVI-------------------------------
K0IBM4_NITGG      GWPIVGVVFARR--------SKHWKICVN-------------------------------
TOP1_METTH        GLPMISYGRPRQ------------RACLD-------------------------------
F6D5C7_METPW      GLPMISFGKPRQ------------RACLDP------------------------------
TOP1_METJA        -CGAKLILKKGV--------YGAFYGCSN-------------------------------
TOP1_PYRAB        CNGAPVVIIRDK--------GRDIEICLD-------------------------------
TOP1_PYRHO        NGAPVVIIREED--------GREFEICLD-------------------------------
                                                                              

Q6F0G3_MESFL      ------------------------ETK---------------------------------
F0V2L5_MYCS3      -----------SKGNSKSNKPPEKLDRKCPKCK------KNYLQ---------IKMSRKG
Q9PPP9_UREPA      ------------------------------------------------------------
TOP1_MYCGA        -----------------------------------------------------KKGRNKD
TOP1_MYCPN        ------------------------------------------------------------
TOP1_MYCGE        ------------------------------------------------------------
Q3M6J7_TRIV2      -----------TQLTAYPCPV-------CKR-PL-----EEY-T---------YTKDGQK
Q4AA55_MYCHJ      ------------------------------------------------------------
B3PMD8_MYCA5      ----------------------------AN------------------------------
TOP1P_MIMIV       FSL--------GEIDDPEDINLDTAIKAIEAKKANNI--AEFNLTENGKKIKAIVLNGKY
Q8F5G0_LEPIN      ------------------------------------------------------------
TOP1_BORBU        -----------KKIDPENITLELALKLLSLPKPIGKHPQTNEQI---------IAATGVF
H8H3H1_DEIGI      ------------------------------------------------------------
B1VAJ5_PHYAS      ------------------------------------------------------------
TOP1_FERIS        ------------------------------------------------------------
TOP1_THEMA        -----------------------------------------------------KRRKGKK
B2V7T0_SULSY      -----------------------------------------------------LIKYGRE
TOP1_AQUAE        ------------------------------------------------------------
D3SM80_THEAH      ------------------------------------------------------------
G8QVT8_SPHPG      KA---------GAKGKGKGSSSSAVVRQIG--EF-----EKEPV---------ALAIGRY
TOP1_SYNE7        RALEL------LAQPKKSRGRGKEPIREVGLHPD-----DQAPI---------QIFEGPY
TOP1_SYNY3        RALE-------LLAEPKRGRGSRTPLKQLGLHPE-----DQEPV---------NLFKGPY
TOP1_STRCO        EALAIY-----AQPKQRGRAAAKPPLKELGTDPV-----SEKPV---------VVKDGRF
TOP1_MYCTU        EALKIYA----EPKRRGRQSASAPPLRELGTDPA-----SGKPM---------VIKDGRF
TOP1_MYCLE        EALKIYA----EPKRAGRQSTSPPPLRELGTDPT-----SGKPM---------LIKDGRF
I0II60_PHYMF      -----------AVVTPKVEPL-VTEMV-CP--KC-----EERPL---------NLRDGKH
J9Z7K0_LEPFM      -----------CKGTRPLAT----GLP-CPVQGC-----KGE-L---------VPRRGKR
TOP1_BUCAI        -----------EISDPKLEPIPFPELL-CK--QS-----DAW-F---------VLREGIS
TOP1_BUCAP        -----------EISEPKFEPIPFPDIL-CE--KS-----NTW-F---------VLREGIS
TOP1_PSEAE        -----------EAAPPKMDAIRMPELK-CE--KV-----DDI-Y---------VLRDGAS
TOP1_VIBCH        -----------EVAPPKEEPVHFPELP-CE--NS-----DAY-F---------VLRDGAS
TOP1_ECOLI        -----------EVAPPKEDPVPLPELP-CE--KS-----DAY-F---------VLRDGAA
TOP1_SALTY        -----------EVAPPKEDPVPLPELP-CE--KS-----DAY-F---------VLRDGAA
TOP1_HAEIN        -----------EVAPPKEEPVHFPELK-CE--KS-----DAY-F---------VLRDGAS
TOP1_PASMU        -----------EVAPPKEEPTHFPELK-CE--KS-----DAY-F---------VLRDGAS
TOP1_CAMJE        -----------CNFISKYKPSEEK----CE--EC-----GETLV----------IKELKK
TOP1_HELPY        -----------KNTPNAKETIEGVKCPECG---------GDI-----------ALKRSKK
TOP1_HELPJ        -----------KNTPNAKETI---EGVKCP--EC-----GGD-I---------ALKRSKK
TOP1_TREPA        ------------FPVCDFVTHFKPTFAVCPQCRC-------FLV---------EKSNRRV
TOP1_LACLA        -----------CEFTSWDKPI----GRDCP--KS-----GHFLV---------EKKVRGG
TOP1_STAS1        -----------CDFVTWDKPI----GRDCP--KC-----EHYLV---------EKKQGRK
TOP1_STAAB        -----------CDFISWDKPI----GRDCP--KC-----NQYLV---------ENKKGKT
TOP1_STAA8        -----------CDFISWDKPI----GRDCP--KC-----NQYLV---------ENKKGKT
TOP1_STAAU        -----------CDFISWDKPI----GRDCP--KC-----NQYLV---------ENKKGKT
TOP1_STAAM        -----------CDFISWDKPI----GRDCP--KC-----NQYLV---------ENKKGKT
TOP1_STAHJ        -----------CDFISWDKPV----GRDCP--KC-----NHYLM---------EHKKGRS
TOP1_STAES        -----------CDFISWDKPV----GRDCP--KC-----HHYLV---------NKKKGKS
TOP1_BACSU        -----------CEFVSWDKPIERK----CP--KC-----GKMLV----------EKKLKK
TOP1_BACHD        -----------CDFVSWDKPIARS----CP--KC-----SSY-L---------VEKRTKK
A5CVH7_VESOH      ------KYVSLKEDIPEEVSLEKALELIKIKEKF-----DSERIIKIFDGSDIQLLNGRF
Q28MI5_JANSC      E----------KVASRGGRGQAAKPLRELGEHPD-----AGGPV---------NVMKGKY
TOP1_XYLFT        ----------TYVSLKSEDDPYTIDLARATLLINEKEEIARNRIIKDFENSQIQVLNGRF
TOP1_XYLFA        ----------TYVSLKSEDDPYTIDLARATFLINEKEEIARNRIIKNFENSQIQVLNGRF
TOP1_RICTY        -----------EITLEVALKLLSLPLK-IGIHKD-----SGEEI---------IIGYSKF
TOP1_RICPR        -----------EITLEIALKLLNLPLK-IGIHKD-----SGEEI---------IIGYSKF
TOP1_RICBR        -----------DITLDMALKLLSLPLK-IGNHKE-----SGEEV---------LVGYGKF
TOP1_RICFE        -----------DITLEMALKLLSLPLK-IGIHKD-----SGEEI---------MIGYGKF
TOP1_RICCN        -----------DITLDIALKLLSLPLK-IGIHKD-----SDEEI---------MIGYGKF
B7J7I8_ACIF2      -----------GHGSWWDDKGSLGKKW--------------------------EDRAPAQ
Q7WXW8_PSEAI      ------------------------------------------------------------
C6XEP4_METGS      ------------------------------------------------------------
B1M9R9_METRJ      -----------CKTFMDDDKGRPVAIKTAPCPKC-----GKAMY----------RRKGDH
TOP1P_XYLFA       ------------------------------------------------------FKEG--
C8W7T0_ATOPD      ---------------PACPTNSEPDLIVGECPTCKANGKHGDLV---------AHKSERT
E1RJ15_METP4      -----------ARADKKTLEKMKLSAEEAESLSHEARLVYNKALLKEYGVPAVSLKKYFD
C7P1M5_HALMD      -----------SDHSSGQSPREETAEAH-----------GGKLA---------IKRLRSG
TOP1_THEAC        --------------PDCSYNRENEDYGECP--AD-----HGRLV---------LRQSKYG
TOP1_ARCFU        ------------------------------------------------------------
B5IE55_ACIB4      --------------SKCEYNRKKDVVGKCP--KC-----GGDLV---------IRQSKNG
B1L3G6_KORCO      -------------------NCDRTPLRCAK---------CGGPM---------VAKQGKF
TOP1_AERPE        ------------------------ALA--------------------------LRDDGLY
A3DP02_STAMF      -------------------------------------------------------KLKST
B8D5I1_DESA1      ---------------------------------------ESELT----------------
K0IBM4_NITGG      --------------------------MQCPSKKK--------------------------
TOP1_METTH        -----------PKCGKKKSEVEEVVGK-CP--EC-----GSDLI----------KRSGRY
F6D5C7_METPW      -----------KCGKDGREPTNEVVGK-CP--DC-----GSD-L---------IKRSGRY
TOP1_METJA        -----------YPKCKYTEPINKKEVV-GKCPKC-----GGDLV----------VREGKF
TOP1_PYRAB        -------------------------------IKC-----KKW------------------
TOP1_PYRHO        ------------------------------------------------------------
                                                                              

Q6F0G3_MESFL      ------------------------------------------------------------
F0V2L5_MYCS3      TKFIS----CSGYP---R----CKYVEWMDKEGETENKSS--------------------
Q9PPP9_UREPA      ------------YP---E----CNFIRNLDESNNDKNDFNQ-------------------
TOP1_MYCGA        NTFLG----CSNFP---K----CKYTKSLEPEKDETIRDSTII-----------------
TOP1_MYCPN        ---------CSNFP---R----CRYIKKDNAS----------------------------
TOP1_MYCGE        ---------CSNFP---N----CRFIKKDNAAEFKQ------------------------
Q3M6J7_TRIV2      KTMLR----CSASS---S----RT--DKKHQDVAYFHTAKGWWSPKFGEINK--------
Q4AA55_MYCHJ      ------------------------------------------------------------
B3PMD8_MYCA5      ------------------------------------------------------------
TOP1P_MIMIV       GYYVQVTRNRIKKN--------YPIPKDLDPNNLTEQQILSIISVKKTYKKSAPK-GGSK
Q8F5G0_LEPIN      ------------------------------------------------------------
TOP1_BORBU        GDYIKTESGSIA----------CSLKKDLKAYDITLDKAISLLNERANKVGIIVK-TITF
H8H3H1_DEIGI      ----------------------RTDGETAPSAAPAAKRKSSTTPRKKRDSTASPR-KKTS
B1VAJ5_PHYAS      ------------FP---D----CKNIVKIKNKPNSK------------------------
TOP1_FERIS        ----------------------TSGSKKSSTKSASSKAKKK-------------------
TOP1_THEMA        GS----------------------------------------------------------
B2V7T0_SULSY      DLV-------------------NNPVQALKFIKSKLSRYKK-------------------
TOP1_AQUAE        ------------------------------------------------------------
D3SM80_THEAH      ------------------------------------------------------------
G8QVT8_SPHPG      GYYLKVGKDNIALP---P----KYKHDDELAKAISLEDAAEIIRTKRAKDSEE-------
TOP1_SYNE7        GLYLKHGKVNASLP---E---------DEKPETISLETAVAALAAKAGQAKAKGG-RRST
TOP1_SYNY3        GVYIKHGKVNASLP---EGETEETITLEKALPLLAEKAGSGKKTSRKKATTTAKGTKKTT
TOP1_STRCO        GPYVTDGETNATLR---SDDSVEEITPERGYELLAEKRAKGPAKKTAKKAVKKTAAKKAP
TOP1_MYCTU        GPYVTDGETNASLR---KGDDVASITDERAAELLADRRARGPAKRPARKAARKVPAKKAA
TOP1_MYCLE        GPYVTDGETNASLR---KGDDVVSITDERAAELLADRRARGPVKRPAKKARKVPAKKAAR
I0II60_PHYMF      GLWLG----CSGFP---K----CR--GREGFTKLPEEEQADLTKLWEKHVKEHPL-PEVK
J9Z7K0_LEPFM      GTFYG----CSRYP---E----CTFLLNGEPVRDPCPDCQF-------------------
TOP1_BUCAI        GIFFA----ANTFP---K----SR--ETRSPFVEELVRFQHLLPEKIYYLSSAPV-IDNY
TOP1_BUCAP        GIFFA----ANTFP---K----SR--ETRSPFVEELARFEYLLPKKLHYLASAPQ-RDNK
TOP1_PSEAE        GMFLA----ASQFP---K----NR--ETRAPLVSEIIPHKAELDPKYHYLCDAPQ-KDPD
TOP1_VIBCH        GLFFA----ASNFP---K----SR--ETRAPLVEELKRFAERLPEKYQYLTSAPA-HDPD
TOP1_ECOLI        GVFLA----ANTFP---K----SR--ETRAPLVEELYRFRDRLPEKLRYLADAPQ-QDPE
TOP1_SALTY        GIFLA----ANTFP---K----SR--ETRAPLVEELYRFRDRLPEKLRYLADAPQ-QDPE
TOP1_HAEIN        GVFMS----AHNFP---K----SR--ETRPVKIAELVQYRERLPEKLAYLADAPQ-KDPE
TOP1_PASMU        GVFMS----AHNFP---K----SR--ETRAPKVAELALYRDRLPEKLRYLADAPQ-HDPE
TOP1_CAMJE        GTFLE----CLK----------CKIKKEMKD-----------------------------
TOP1_HELPY        GSFYG----CNNYP---K----CNFLSNHKPINKRCEKCHYLMSERIYRKKKAHE-CIKC
TOP1_HELPJ        GSFYG----CNNYP---K----CNFLSNHKPINKRCEKCHYLMSERIYRKKKAHE-CIQC
TOP1_TREPA        GTYTA----CVNPE--------CRYVSPTRKNLSLGKEAVLDGSHRGAQDKGAVQ-HYE-
TOP1_LACLA        GKQVV----CSNDE--------CDYQEEKQK-----------------------------
TOP1_STAS1        SQVV-----CSN----------CDYKEEEQK-----------------------------
TOP1_STAAB        TQVI-----CSN----------CDYKEAAQK-----------------------------
TOP1_STAA8        TQVI-----CSN----------CDYKEAAQK-----------------------------
TOP1_STAAU        TQVI-----CSN----------CDYKEAAQK-----------------------------
TOP1_STAAM        TQVI-----CSN----------CDYKEAAQK-----------------------------
TOP1_STAHJ        SQVI-----CSN----------CDYKEEVQK-----------------------------
TOP1_STAES        SQVV-----CSN----------CDYEEEVQK-----------------------------
TOP1_BACSU        GIQVQ----CVE----------CDYKEEPQK-----------------------------
TOP1_BACHD        QVQVQ----CSS----------CDYKEEAN------------------------------
A5CVH7_VESOH      GPYIWNGKKKGKGQ---KNITIKKVFGDKPIANLTLEECKKAISGKLKLKKKIVK-KEVT
Q28MI5_JANSC      GPYVKWDKVNATIP---E---------AIDPEAITMDQAVQLIEERAAKSGKKKP-AAKK
TOP1_XYLFT        GPYISDGKLNGKIP------------KDREPASLTLEEAQQLLINTGKPARKNFSTKKTA
TOP1_XYLFA        GPYISDGKLNGKIP---K---------DREPASLTLEEAQQLLIDTGKPARKNFSTKKTA
TOP1_RICTY        GPYIKYMCKFISVP---K---------KYDFLNLNLDDAIKLIE----------------
TOP1_RICPR        GPYIKYMCKFISVP---K---------KYDFLNLSLNDAMKLIQ----------------
TOP1_RICBR        GPYIKYMGKFISIP---K---------KYDFLNLSLDDAMKLIEEKLNAIAAKQP-NPLN
TOP1_RICFE        GPYIKYMGKFISIP---K---------KYDFLNLSLDDAMKLIE----------------
TOP1_RICCN        GPYIKYMGQFISVQ---K---------KYDFLNLSLDDAMKLIE----------------
B7J7I8_ACIF2      GAASGPARKNTG----------SKASSTKRPTKGTRTKARSSIMD---------------
Q7WXW8_PSEAI      ------------------------------------------------------------
C6XEP4_METGS      ------------------------------------------------------------
B1M9R9_METRJ      GFWWG----CSGYR---E----GCKTIMDDDKGKPVPRAAKGATRSSNSPAKAKA-KPAA
TOP1P_XYLFA       ----------------------CKATYEDKKGKPNFEKAK--------------------
C8W7T0_ATOPD      GKRFIR---CTNYE---E----CETSYPLPARGKLEKTDEVCPDCGAPMVVVTTQ-RGPW
E1RJ15_METP4      AGFVTPEDFCYIHPAYLSAKTGLNIDTVYKHAAIVCEATGVRLPEKVSKKELESGRIELL
C7P1M5_HALMD      SRLVG----CTRYP---D----CEYSLPLPRNGDIVVGEDRCAEHDLPEISIVDD-EDDD
TOP1_THEAC        KRFLG----CSNYP---K----CTVTYPLPQMGRITKTGEVCPYCGAPILALSRN-GRKW
TOP1_ARCFU        ----------------------CNYLNWKKENS---------------------------
B5IE55_ACIB4      KRFIG----CSNYP---K----CDVTYSLPQRGKIIPTGEVCPYCGAPLLILRKKGKKDW
B1L3G6_KORCO      GVYLK-----------------CENCGSTNFFRVRKH-----------------------
TOP1_AERPE        KALL--------------------------------------------------------
A3DP02_STAMF      GKWI------------------VEVIQNFEKIKYSPSE----------------------
B8D5I1_DESA1      ------------------------------------------------------------
K0IBM4_NITGG      ------------------------------------------------------------
TOP1_METTH        GEFVG----CKGFP---K----CRFTCSVDEVPEG-------------------------
F6D5C7_METPW      GEFIG----CSGFP---K----CRFTKSIDDDGGKTAAKTTGAPKKTVAKKAATK-KSAT
TOP1_METJA        GKFVG----CSNYP---K----CRYTEKLKLNEKEEK-----------------------
TOP1_PYRAB        ------------------------------------------------------------
TOP1_PYRHO        ----------------------INCKDWKAKSH---------------------------
                                                                              

Q6F0G3_MESFL      ------------------------------------------------------------
F0V2L5_MYCS3      ------------------------------------------------------------
Q9PPP9_UREPA      ------------------------------------------------------------
TOP1_MYCGA        ------------------------------------------------------------
TOP1_MYCPN        ------------------------------------------------------------
TOP1_MYCGE        ------------------------------------------------------------
Q3M6J7_TRIV2      ------------------------------------------------------------
Q4AA55_MYCHJ      ------------------------------------------------------------
B3PMD8_MYCA5      ------------------------------------------------------------
TOP1P_MIMIV       TIRKPSQTKYSQTKSTKSTKSTKSTNKKFVGKSAKKTTKKTTKK----------------
Q8F5G0_LEPIN      ------------------------------------------------------------
TOP1_BORBU        SKNKIGNKIYIYKKNDKFYAKIKRKKIDLPDNINLEEINEKYVFSLL-------------
H8H3H1_DEIGI      TSGTSRRKA---------------------------------------------------
B1VAJ5_PHYAS      ------------------------------------------------------------
TOP1_FERIS        ------------------------------------------------------------
TOP1_THEMA        ------------------------------------------------------------
B2V7T0_SULSY      ------------------------------------------------------------
TOP1_AQUAE        ------------------------------------------------------------
D3SM80_THEAH      ------------------------------------------------------------
G8QVT8_SPHPG      ------------------------------------------------------------
TOP1_SYNE7        GTPKSGETKARTTKTTKKTTTRRTTSR---------------------------------
TOP1_SYNY3        SKKASATGTAKKTTTKRTTRKKAASPDQSSEAG---------------------------
TOP1_STRCO        AKKAAATKKTAAAKTTAAKKTAAKSTAKKTTAKTAAKKATASKTSED-------------
TOP1_MYCTU        KRD---------------------------------------------------------
TOP1_MYCLE        LAPARGISQSPR------------------------------------------------
I0II60_PHYMF      TADGRVLHDEDNYVPQPL--------EAAG------------------------------
J9Z7K0_LEPFM      --------PYRVRTGKKS--------VDLVCPNEACSHAKTGG-----------------
TOP1_BUCAI        GNKTIV--CFDKKKKTHY--------IASKKDGKFTGWSAVFIDQKWCVINK--------
TOP1_BUCAP        GNKTIV--CFNKLNKQQY--------IASKKEGKFTGWAAFFIDRKWCIVNK--------
TOP1_PSEAE        GRPAVI--RFSRKTKEQY--------VQSEVDGKPTGWRAFYDGGKWKVEDKR-------
TOP1_VIBCH        GLPAVV--RFSRKEKEHY--------VRTETEGKPSGWMAVYQEGKWLVTDKRKNAK---
TOP1_ECOLI        GNKTMV--RFSRKTKQQY--------VSSEKDGKATGWSAFYVDGKWV--EGKK------
TOP1_SALTY        GNKTVV--RFSRKTKQQY--------VAAEKDGKATGWSAFFVDGKWV--EGKK------
TOP1_HAEIN        ENEAIV--RFSRKEKKQY--------VTSEKEGKATKWIVDFTNGKWV--ERKK------
TOP1_PASMU        GNDAIV--RFSRKEKRQY--------VTSEKNGKATKWIVDYLGNQWV--ERKK------
TOP1_CAMJE        ------------------------------------------------------------
TOP1_HELPY        KERVFLEEDNG-------------------------------------------------
TOP1_HELPJ        KERVFLEEDNG-------------------------------------------------
TOP1_TREPA        ------------------------------------------------------------
TOP1_LACLA        ------------------------------------------------------------
TOP1_STAS1        ------------------------------------------------------------
TOP1_STAAB        ------------------------------------------------------------
TOP1_STAA8        ------------------------------------------------------------
TOP1_STAAU        ------------------------------------------------------------
TOP1_STAAM        ------------------------------------------------------------
TOP1_STAHJ        ------------------------------------------------------------
TOP1_STAES        ------------------------------------------------------------
TOP1_BACSU        ------------------------------------------------------------
TOP1_BACHD        ------------------------------------------------------------
A5CVH7_VESOH      KNS---------------------------------------------------------
Q28MI5_JANSC      KTTAKKPAAKKKPAAKKTAKSAD-------------------------------------
TOP1_XYLFT        TKNETRKQTTKKRTTDAKATKKVSDKPVKKQIKKRIAPNITQ------------------
TOP1_XYLFA        TKNETRKQTTKKRTTDAKATKKVSDKPVKKQIKKRIAPNITE------------------
TOP1_RICTY        --------NNKAKLEKKHRSMV--------------------------------------
TOP1_RICPR        --------NNKAKLEKKYG-----------------------------------------
TOP1_RICBR        MDEVTNLVDKKIKVKKTKK-----------------------------------------
TOP1_RICFE        --------DNKAKLEKKQA-----------------------------------------
TOP1_RICCN        --------ENKAKLEKKQA-----------------------------------------
B7J7I8_ACIF2      ------------------------------------------------------------
Q7WXW8_PSEAI      ------------------------------------------------------------
C6XEP4_METGS      ------------------------------------------------------------
B1M9R9_METRJ      KPKMRR------------------------------------------------------
TOP1P_XYLFA       ------------------------------------------------------------
C8W7T0_ATOPD      KLCPNYDCPGKEKKTAPRRGARKSTKSTKSTKAAKK------------------------
E1RJ15_METP4      SIEGLGEAMLEKLYMAGIVSRKKLCSADPEQISKLTGIPSEKITYFQEECK---------
C7P1M5_HALMD      DPWELGCPICNYAEYQARNAIDDLEDLNGIGGATAEKLAAVGIDEPADLRAVEPDEIAAN
TOP1_THEAC        KFCPNMQCEYNKKRKPEAAVEKSVRKKGRNASKS--------------------------
TOP1_ARCFU        ------------------------------------------------------------
B5IE55_ACIB4      KFCPNIKCEYNRRNKDEK------------------------------------------
B1L3G6_KORCO      ------------------------------------------------------------
TOP1_AERPE        ------------------------------------------------------------
A3DP02_STAMF      ------------------------------------------------------------
B8D5I1_DESA1      ------------------------------------------------------------
K0IBM4_NITGG      ------------------------------------------------------------
TOP1_METTH        ------------------------------------------------------------
F6D5C7_METPW      KKSATKKSATKKSATKKSATKKSATKKSATKKSATKKSATKKNAKKTK------------
TOP1_METJA        ------------------------------------------------------------
TOP1_PYRAB        ------------------------------------------------------------
TOP1_PYRHO        ------------------------------------------------------------
                                                                              

Q6F0G3_MESFL      ------------------
F0V2L5_MYCS3      ------------------
Q9PPP9_UREPA      ------------------
TOP1_MYCGA        ------------------
TOP1_MYCPN        ------------------
TOP1_MYCGE        ------------------
Q3M6J7_TRIV2      ------------------
Q4AA55_MYCHJ      ------------------
B3PMD8_MYCA5      ------------------
TOP1P_MIMIV       ------------------
Q8F5G0_LEPIN      ------------------
TOP1_BORBU        ------------------
H8H3H1_DEIGI      ------------------
B1VAJ5_PHYAS      ------------------
TOP1_FERIS        ------------------
TOP1_THEMA        ------------------
B2V7T0_SULSY      ------------------
TOP1_AQUAE        ------------------
D3SM80_THEAH      ------------------
G8QVT8_SPHPG      ------------------
TOP1_SYNE7        ------------------
TOP1_SYNY3        ------------------
TOP1_STRCO        ------------------
TOP1_MYCTU        ------------------
TOP1_MYCLE        ------------------
I0II60_PHYMF      ------------------
J9Z7K0_LEPFM      ------------------
TOP1_BUCAI        ------------------
TOP1_BUCAP        ------------------
TOP1_PSEAE        ------------------
TOP1_VIBCH        ------------------
TOP1_ECOLI        ------------------
TOP1_SALTY        ------------------
TOP1_HAEIN        ------------------
TOP1_PASMU        ------------------
TOP1_CAMJE        ------------------
TOP1_HELPY        ------------------
TOP1_HELPJ        ------------------
TOP1_TREPA        ------------------
TOP1_LACLA        ------------------
TOP1_STAS1        ------------------
TOP1_STAAB        ------------------
TOP1_STAA8        ------------------
TOP1_STAAU        ------------------
TOP1_STAAM        ------------------
TOP1_STAHJ        ------------------
TOP1_STAES        ------------------
TOP1_BACSU        ------------------
TOP1_BACHD        ------------------
A5CVH7_VESOH      ------------------
Q28MI5_JANSC      ------------------
TOP1_XYLFT        ------------------
TOP1_XYLFA        ------------------
TOP1_RICTY        ------------------
TOP1_RICPR        ------------------
TOP1_RICBR        ------------------
TOP1_RICFE        ------------------
TOP1_RICCN        ------------------
B7J7I8_ACIF2      ------------------
Q7WXW8_PSEAI      ------------------
C6XEP4_METGS      ------------------
B1M9R9_METRJ      ------------------
TOP1P_XYLFA       ------------------
C8W7T0_ATOPD      ------------------
E1RJ15_METP4      ------------------
C7P1M5_HALMD      VQGVSASQIEDWQAELAD
TOP1_THEAC        ------------------
TOP1_ARCFU        ------------------
B5IE55_ACIB4      ------------------
B1L3G6_KORCO      ------------------
TOP1_AERPE        ------------------
A3DP02_STAMF      ------------------
B8D5I1_DESA1      ------------------
K0IBM4_NITGG      ------------------
TOP1_METTH        ------------------
F6D5C7_METPW      ------------------
TOP1_METJA        ------------------
TOP1_PYRAB        ------------------
TOP1_PYRHO        ------------------