CLUSTAL format seed alignment for MF_00953

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TOP3_STAAS      -MKSLILAEKPSVARDIADALQINQ-KRNGYFEN-NQYIVTWALGHLVTNATPEQYDKNL
TOP3_STAAW      -MKSLILAEKPSVARDIADALQINQ-KRNGYFEN-NQYIVTWALGHLVTNATPEQYDKNL
TOP3_STAAC      -MKSLILAEKPSVARDIADALQINQ-KRNGYFEN-NQYIVTWALGHLVTNATPEQYDKNL
TOP3_STAAM      -MKSLILAEKPSVARDIADALQINQ-KRNGYFEN-NQYIVTWALGHLVTNATPEQYDKNL
TOP3_STAA3      -MKSLILAEKPSVARDIADALQINQ-KRNGYFEN-NQYIVTWALGHLVTNATPEQYDKNL
TOP3_STAAN      -MKSLILAEKPSVARDIADALQINQ-KRNGYFEN-NQYIVTWALGHLVTNATPEQYDKNL
TOP3_STAA8      -MKSLILAEKPSVARDIADALQINQ-KRNGYFEN-NQYIVTWALGHLVTNATPEQYDKNL
TOP3_STAAR      -MKSLILAEKPSVARDIADALQINQ-KRNGYFEN-NQYIVTWALGHLVTNATPEQYDKNL
TOP3_STAAB      -MKYLILAEKPSVARDIADALQINQ-KRNGYFEN-NQYIVTWALGHLVTNATPEQYDKNL
TOP3_STAEQ      -MKSLILAEKPSVGRDIANALNLQQ-KSNGYIEG-KQYIVTWALGHLVTNATPEQYNPSY
TOP3_STAES      -MKSLILAEKPSVGRDIANALNLQQ-KSNGYIEG-KQYIVTWALGHLVTNATPEQYNPSY
TOP3_STAHJ      -MKSLILAEKPSVARDIAEAMNIKG-KRNGYIEN-EKYVVTWALGHLVTNAQPEHYDKAY
TOP3_STAS1      -MKSLIIAEKPSVGRDIANTLNINE-KRNGYFEN-NKYIVTWALGHLVTNATPEQYDASY
TOP3_BACAH      MAKSVVIAEKPSVARDIARVLKCDK-KGNGYLEG-SKYIVTWALGHLVTLADPESYDVKY
TOP3_BACAN      MAKSVVIAEKPSVARDIARVLKCDK-KGNGYLEG-SKYIVTWALGHLVTLADPESYDVKY
TOP3_BACHK      MAKSVVIAEKPSVARDIARVLKCDK-KGNGYLEG-SKYIVTWALGHLVTLADPESYDVKY
TOP3_BACCZ      MAKSVVIAEKPSVARDIARVLKCDK-KGNGYLEG-SKYIVTWALGHLVTLADPESYDVKY
TOP3_BACC1      MSKSVVIAEKPSVARDIARVLKCDK-KGNGYLEG-SKYIVTWALGHLVTLADPESYDVKY
TOP3_BACCR      MSKSVVIAEKPSVARDIARVLKCDK-KGNGYLEG-SKYIVTWALGHLVTLADPESYDVKY
TOP3_BACLD      MSKTVVLAEKPSVGRDLARVLKCHK-KGNGYLEG-DRYIVTWALGHLVTLADPEGYGKEY
TOP3_BACSU      MSKTVVLAEKPSVGRDLARVLKCHK-KGNGYLEG-DQYIVTWALGHLVTLADPEGYGKEF
TOP3_BACSK      MKKKAVLAEKPSVARDIARVLGCNQ-KGNGYLEG-NGYIITWALGHLVTHADPEHYGKQY
TOP3_SALTI      --MRLFIAEKPSLGRAIADVLPKPHRKGDGFIECGNGQVVTWCIGHLLEQAQPDAYDSRY
TOP3_SALTY      --MRLFIAEKPSLGRAIADVLPKPHRKGDGFIECGNGQVVTWCIGHLLEQAQPDAYDSRY
TOP3_ECOLI      --MRLFIAEKPSLARAIADVLPKPHRKGDGFIECGNGQVVTWCIGHLLEQAQPDAYDSRY
TOP3_HAEIN      --MRLFIAEKPSLARAIADVLPKPHQRGDGFIKCGDNDVVTWCVGHLLEQAEPDAYDPKF
TOP3_PASMU      --MRLFIAEKPSLARAIADVLPKPHQRGDGFIKCGADDYVTWCIGHLLEQAEPDAYDPKF
TOP3_VIBCH      -MTRLFIAEKPSLARAIADALPKPHKKEQGCIRCANGDIVTWCIGHLLEQVEPDAYDERY
                     .:*****:.* :* .:     : :* :.      :**.:***:  . *: *.   

TOP3_STAAS      KEWRLEDLPIIPKYMKTVVIGKTSKQFKTVKALILDNKVKDIIIATDAGREGELVARLIL
TOP3_STAAW      KEWRLEDLPIIPKYMKTVVIGKTSKQFKTVKALILDNKVKDIIIATDAGREGELVARLIL
TOP3_STAAC      KEWRLEDLPIIPKYMKTVVIGKTSKQFKTVKALILDNKVKDIIIATDAGREGELVARLIL
TOP3_STAAM      KEWRLEDLPIIPKYMKTVVIGKTSKQFKTVKALILDNKVKDIIIATDAGREGELVARLIL
TOP3_STAA3      KEWRLEDLPIIPKYMKTVVIGKTSKQFKTVKALILDNKVKDIIIATDAGREGELVARLIL
TOP3_STAAN      KEWRLEDLPIIPKYMKTVVIGKTSKQFKTVKALILDNKVKDIIIATDAGREGELVARLIL
TOP3_STAA8      KEWRLEDLPIIPKYMKTVVIGKTSKQFKTVKALILDNKVKDIIIATDAGREGELVARLIL
TOP3_STAAR      KEWRLEDLPIIPKYMKTVVIGKTSKQFKTVKALILDNKVKDIIIATDAGREGELVARLIL
TOP3_STAAB      KEWRLEDLPIIPKYMKTVVIGKTSKQFKTVKALILDNKVKDIIIATDAGREGELVARLIL
TOP3_STAEQ      KEWNLEDLPIIPKKMKTVVISKTNRQFKIVKSLILDKNVKEIIIATDAGREGELVARLIL
TOP3_STAES      KEWNLEDLPIIPKKMKTVVISKTNRQFKIVKSLILDKNVKEIIIATDAGREGELVARLIL
TOP3_STAHJ      KEWKLEDLPIIPKRMQTVVIGKTSKQFKTVKSLILDKKVKEVIIATDAGREGELVARLIL
TOP3_STAS1      KEWKLNDLPIIPNKMKTIVISKTRKQFSTVQSLINNNKVKDIIIATDAGREGELVARLIL
TOP3_BACAH      KKWNLEDLPMLPERLKLTVIKQTGKQFNAVKSQLLRKDVNEIIVATDAGREGELVARWII
TOP3_BACAN      KKWNLEDLPMLPERLKLTVIKQTGKQFNAVKSQLLRKDVNEIIVATDAGREGELVARWII
TOP3_BACHK      KKWNLEDLPMLPERLKLTVIKQTGKQFNAVKSQLLRKDVNEIIVATDAGREGELVARWII
TOP3_BACCZ      KKWNLEDLPMLPERLKLTVIKQTGKQFNAVKSQLLRKDVNEIIVATDAGREGELVARWII
TOP3_BACC1      KKWNLEDLPMLPERLKLTVIKQTGKQFNAVKSQLLRKDVNEIIVATDAGREGELVARWII
TOP3_BACCR      KKWNLEDLPMLPERLKLTVIKQTGKQFNAVKSQLLRKDVNEIIVATDAGREGELVARWII
TOP3_BACLD      QSWRLEDLPIIPEPLKLVVIKKTGKQFQAVKSQLIRKDVKDIVIATDAGREGELVARWII
TOP3_BACSU      QSWRLEDLPIIPEPLKLVVIKKTGKQFNAVKSQLTRKDVNQIVIATDAGREGELVARWII
TOP3_BACSK      KTWKLEELPMLPKRLELVVIKQTAKQFHAVKHVLNRQDVGEVVIATDAGREGELVARWIL
TOP3_SALTI      ARWNLADLPIVPEKWQLQPRPSVTKQLNVIKRFL--HQAGEIIHAGDPDREGQLLVDEVL
TOP3_SALTY      ARWNLADLPIVPEKWQLQPRPSVTKQLNVIKRFL--HQAGEIIHAGDPDREGQLLVDEVL
TOP3_ECOLI      ARWNLADLPIVPEKWQLQPRPSVTKQLNVIKRFL--HEASEIVHAGDPDREGQLLVDEVL
TOP3_HAEIN      KQWRLEHLPIIPEKWQLLPRKEVKKQLSVVEKLI--HQADTLVNAGDPDREGQLLVDEVF
TOP3_PASMU      KQWRLEHLPIIPEKWQLIPRKDVHKQLTIVEKLI--HQADILINAGDPDREGQLLVDEVF
TOP3_VIBCH      KKWNMADLPIIPEQWQLRPRKSSSQQLTVVRKLL--KEATQIIHAGDPDREGQLLVDEVI
                  *.: .**::*:  :     .  :*:  :.  :  :..  :: * *..***:*:.  ::

TOP3_STAAS      DKVGN----KKPIRRLWISSVTKKAIQQGFKNLKDGRQYNDLYYAALARSEADWIVGINA
TOP3_STAAW      DKVGN----KKPIRRLWISSVTKKAIQQGFKNLKDGRQYNDLYYAALARSEADWIVGINA
TOP3_STAAC      DKVGN----KKPIRRLWISSVTKKAIQQGFKNLKDGRQYNDLYYAALARSEADWIVGINA
TOP3_STAAM      DKVGN----KKPIRRLWISSVTKKAIQQGFKNLKDGRQYNDLYYAALARSEADWIVGINA
TOP3_STAA3      DKVGN----KKPIRRLWISSVTKKAIQQGFKNLKDGRQYNDLYYAALARSEADWIVGINA
TOP3_STAAN      DKVGN----KKPIRRLWISSVTKKAIQQGFKNLKDGRQYNDLYYAALARSEADWIVGINA
TOP3_STAA8      DKVGN----KKPIRRLWISSVTKKAIQQGFKNLKDGRQYNDLYYAALARSEADWIVGINA
TOP3_STAAR      DKVGN----KKPLRRLWISSVTKKAIQQGFKNLKDGRQYNDLYYAALARSEADWIVGINA
TOP3_STAAB      DKVGN----KKPLRRLWISSVTKKAIQQSFKNLKDGRQYNDLYYAALARSEADWIVGINA
TOP3_STAEQ      DKVGN----KKPIKRLWISSVTKKAIQEGFKQLKNGNAYQNLYEAALARSEADWIVGINA
TOP3_STAES      DKVGN----KKPIKRLWISSVTKKAIQEGFKQLKNGNAYQNLYEAALARSEADWIVGINA
TOP3_STAHJ      DKVHN----KKPIKRLWISSVTKKAIQEGFKKLKDGREFQHLYEAALARSEADWIVGINA
TOP3_STAS1      DKAHN----KKPTKRLWISSVTNKAIKEGFNKLQDGRKFNNLYHAALARSEADWIVGINA
TOP3_BACAH      DKVRI----NKPIKRLWISSVTDKAIKDGFANLKPGKAYDNLYASAVARSEADWYIGLNA
TOP3_BACAN      DKVRI----NKPIKRLWISSVTDKAIKDGFANLKPGKAYDNLYASAVARSEADWYIGLNA
TOP3_BACHK      DKVRI----NKPIKRLWISSVTDKAIKDGFANLKPGKAYDNLYASAVARSEADWYIGLNA
TOP3_BACCZ      DKVRI----NKPIKRLWISSVTDKAIKDGFANLKPGKAYDNLYASAVARSEADWYIGLNA
TOP3_BACC1      DKVRI----NKPIKRLWISSVTDKAIKDGFANLKPGRAYDNLYASAVARSEADWYIGLNA
TOP3_BACCR      DKVKL----NKPIKRLWISSVTDKAIKDGFANLKPGKAYDNLYASAVARSEADWYIGLNA
TOP3_BACLD      EKAKV----TKPLKRLWISSVTDKAIKDGFKNLKNGKDFENLYHSAVARAEADWIVGINA
TOP3_BACSU      EKANV----RKPIKRLWISSVTDKAIKEGFQKLRSGKEYENLYHSAVARAEADWIVGINA
TOP3_BACSK      EKAHV----KKPVKRLWISSVTDKAIKDGFKQLKDGKRYETLYAAAAARAEADWYVGING
TOP3_SALTI      DYLQLPAEKRQQVRRCLINDLNPQAVERAIDRLRANSDFVPLCVSALARARADWLYGINM
TOP3_SALTY      DYLQLPAEKRQQVRRCLINDLNPQAVERAIDRLRANSDFVPLCVSALARARADWLYGINM
TOP3_ECOLI      DYLQLAPEKRQQVQRCLINDLNPQAVERAIDRLRSNSEFVPLCVSALARARADWLYGINM
TOP3_HAEIN      SYANLSAEKRDKILRCLISDLNPSAVEKAVKKLQPNRNFIPLATSALARARADWLYGINM
TOP3_PASMU      SYANLSVDKLNQIQRCLISDLNPSAVEKAVNKLQSNRNFIPLATSALARARADWLYGINM
TOP3_VIBCH      DYCKVPKSKKETVQRLLISDLNLSAVKRALQGLRSNREFIPLSVSALARSRADWLYGMNM
                .         .   *  *..:. .*:: ..  *: .  :  *  :* **:.***  *:* 

TOP3_STAAS      TRALTTK-----YDAQLSLGRVQTPTIQLVNTRQQEINQFKPQQYFTLSL----------
TOP3_STAAW      TRALTTK-----YDAQLSLGRVQTPTIQLVNTRQQEINQFKPQQYFTLSL----------
TOP3_STAAC      TRALTTK-----YDAQLSLGRVQTPTIQLVNTRQQEINQFKPQQYFTLSL----------
TOP3_STAAM      TRALTTK-----YDAQLSLGRVQTPTIQLVNTRQQEINQFKPQQYFTLSL----------
TOP3_STAA3      TRALTTK-----YDAQLSLGRVQTPTIQLVNTRQQEINQFKPQQYFTLSL----------
TOP3_STAAN      TRALTTK-----YDAQLSLGRVQTPTIQLVNTRQQEINQFKPQQYFTLSL----------
TOP3_STAA8      TRALTTK-----YDAQLSLGRVQTPTIQLVNTRQQEINQFKPQQYFTLSL----------
TOP3_STAAR      TRALTTK-----YDAQLSLGRVQTPTIQLVNTRQQEINQFKPQQYYTLSL----------
TOP3_STAAB      TRALTTK-----YDAQLSLGRVQTPTIQLVNTRQQEINQFKPQQYYTLSL----------
TOP3_STAEQ      TRALTTK-----YDAQLSLGRVQTPTIQIVKSRQDEINYFKPEKYYTLSI----------
TOP3_STAES      TRALTTK-----YDAQLSLGRVQTPTIQIVKSRQDEINYFKPEKYYTLSI----------
TOP3_STAHJ      TRALTTK-----YDAQLSLGRVQTPTIQLVNARQQEINHFKAKKYYTLST----------
TOP3_STAS1      TRALTTK-----YDAQLSLGRVQTPTIQLVQMRQNEINHFKPQTYYTMKL----------
TOP3_BACAH      TRALTTR-----FNAQLNCGRVQTPTVAMIANREDEIKNFKAQTYYGIEAQ---------
TOP3_BACAN      TRALTTR-----FNAQLNCGRVQTPTVAMIANREDEIKNFKAQTYYGIEAQ---------
TOP3_BACHK      TRALTTR-----FNAQLNCGRVQTPTVAMIANREDEIKNFKAQTYYGIEAQ---------
TOP3_BACCZ      TRALTTR-----FNAQLNCGRVQTPTVAMIANREDEIKNFKAQTYYGIEAQ---------
TOP3_BACC1      TRALTTR-----FNAQLNCGRVQTPTVAMIANREDEIKNFKAQTYYGIEAQ---------
TOP3_BACCR      TRALTTR-----FNAQLNCGRVQTPTVAMIASREDEIKNFKAQTYYGIEAQ---------
TOP3_BACLD      TRALTTK-----FNAQLSCGRVQTPTLAMIAKREEDIKNFKPVPYFGLRA----------
TOP3_BACSU      TRALTTK-----FNAQLSCGRVQTPTLAMIAKREADIQAFTPVPYYGIRA----------
TOP3_BACSK      TRALTTK-----HNAQLSCGRVQTPTLAILADREEAIRKFVPKPYHTISVE---------
TOP3_SALTI      TRAYTILGRNAGYQGVLSVGRVQTPVLGLVVRRDEEIENFVAKDFFEVKAHIVTPADE--
TOP3_SALTY      TRAYTILGRNAGYQGVLSVGRVQTPVLGLVVRRDEEIENFVAKDFFEVKAHIVTPADE--
TOP3_ECOLI      TRAYTILGRNAGYQGVLSVGRVQTPVLGLVVRRDEEIENFVAKDFFEVKAHIVTPADE--
TOP3_HAEIN      TRAYTIRGRQTGYDGVLSVGRVQTPVLGLIVRRDLEIEHFQPKDFFEVQAWVNPESKEEK
TOP3_PASMU      TRAYTLRGRQAGYQGVLSVGRVQTPVLGLIVRRDLEIENFKPQDFFEVLAHIQAETPEKI
TOP3_VIBCH      SRAYTLLGKKAGYQGVLSVGRVQTPVLGLVVRRDEEIEHFIPHDYFTLDALIPYQNGTEY
                :** *       .:. *. ******.: ::  *:  *. * .  :. :            

TOP3_STAAS      ---------------TVKGFDFQLE----SNQRYTNKETLEQMVNNLKNVDGKIKSVATK
TOP3_STAAW      ---------------TVKGFDFQLE----SNQRYTNKETLEQMVNNLKNVDGKIKSVATK
TOP3_STAAC      ---------------TVKGFDFQLE----SNQRYTNKETLEQMVNNLKNVDGKIKSVATK
TOP3_STAAM      ---------------TVKGFDFQLE----SNQRYTNKETLEQMVNNLKNVDGKIKSVATK
TOP3_STAA3      ---------------TVKGFDFQLE----SNQRYTNKETLEQMVNNLKNVDGKIKSVATK
TOP3_STAAN      ---------------TVKGFDFQLE----SNQRYTNKETLEQMVNNLKNVDGKIKSVATK
TOP3_STAA8      ---------------TVKGFDFQLE----SNQRYTNKETLEQMVNNLKNVDGKIKSVATK
TOP3_STAAR      ---------------TVKGFDFQLE----SNQRYTNKETLEQIVNNLKNVDGKIKSVATK
TOP3_STAAB      ---------------TVKGFDFQLE----SNQRYTNKETLEQIVNNLKNVDGKIKSVATK
TOP3_STAEQ      ---------------NVDGYDLNLK----QQKRYKDKKELELIEHKIKHQEGKILEVKGK
TOP3_STAES      ---------------NVDGYDLNLK----QQKRYKDKKELELIEHKIKHQEGKILEVKGK
TOP3_STAHJ      ---------------EIGGLTFQLS----TNKQHMTMEDATQIANEIKHVEGNVDSVEKK
TOP3_STAS1      ---------------NAAGLTFHCT----KPQSHPDKTVLESIKKAIDGQSGHIASISKT
TOP3_BACAH      ---------------TTNQLKLTWQDANG-NSRSFNKEKIDGIVKGLDKHNATVLEIDKK
TOP3_BACAN      ---------------TTNQLKLTWQDANG-NSRSFNKEKIDGIVKGLDKHNATVLEIDKK
TOP3_BACHK      ---------------TTNQLKLTWQDANG-NSRSFNKEKIDGIVKGLDKHNATVLEIDKK
TOP3_BACCZ      ---------------TTNQLKLTWQDANG-NSRSFNKEKIDGIVKGLDKHNATVLEIDKK
TOP3_BACC1      ---------------TTNQLKLTWQDANG-NSRSFNKEKIDGIVKGLDKHNATVMEIDKK
TOP3_BACCR      ---------------TMEKLKLTWQDANG-NSRSFNKEKIDGIVKRLDKQNATVVEIDKK
TOP3_BACLD      ---------------AVDGMTLTWQDKKTSQTRTFNASVTSQLAGALQGKPAVIVDLKKT
TOP3_BACSU      ---------------AVDGMTLTWQDKKSKQTRTFNQDVTSRLLKNLQGKQAVVAELKKT
TOP3_BACSK      ---------------TKDGVTFRWADRRSKEERIFDDKRAKTLQEKLQQSAIVIDSVNAK
TOP3_SALTI      ------------RFTAIWQPSEACEPYQDEEGRLLHRPLAEHVVNRINGQPALVTSYNDK
TOP3_SALTY      ------------RFTAIWQPSEACEPYQDEEGRLLHRPLAEHVVNRINGQPALVTSYNDK
TOP3_ECOLI      ------------RFTAIWQPSEACEPYQDEEGRLLHRPLAEHVVNRISGQPAIVTSYNDK
TOP3_HAEIN      TP-----EKSTALFSALWQPSKACEDYQDDDGRVLSKGLAEKVVKRITNQPAEVTEYKDV
TOP3_PASMU      TALSAQEKANIPQFKALWQPSKACEDYQDEEGRVLSLGLVENVVKRIAQQPAEVVEYVDK
TOP3_VIBCH      F-----------DIRARWKPSEACLPWQDEEGRVTNRKLVDNVASRIANQPATVTESEQD
                                                          :   :      : .    

TOP3_STAAS      HKKSYPQSLYNLTDLQQDMYRRYKIGPKETLNTLQSLYERHKVVTYPRTDSNYLTTDMVD
TOP3_STAAW      HKKSYPQSLYNLTDLQQDMYRRYKIGPKETLNTLQSLYERHKVVTYPRTDSNYLTTDMVD
TOP3_STAAC      HKKSYPQSLYNLTDLQQDMYRRYKIGPKETLNTLQSLYERHKVVTYPRTDSNYLTTDMVD
TOP3_STAAM      HKKSYPQSLYNLTDLQQDMYRRYKIGPKETLNTLQSLYERHKVVTYPRTDSNYLTTDMVD
TOP3_STAA3      HKKSYPQSLYNLTDLQQDMYRRYKIGPKETLNTLQSLYERHKVVTYPRTDSNYLTTDMVD
TOP3_STAAN      HKKSYPQSLYNLTDLQQDMYRRYKIGPKETLNTLQSLYERHKVVTYPRTDSNYLTTDMVD
TOP3_STAA8      HKKSYPQSLYNLTDLQQDMYRRYKIGPKETLNTLQSLYERHKVVTYPRTDSNYLTTDMVD
TOP3_STAAR      HKKSYPQSLYNLTDLQQDMYRRYKIGPKETLNTLQSLYERHKVVTYPRTDSNYLTTDMVD
TOP3_STAAB      HKKSYPQSLYNLTDLQQDMYRRYKIGPKETLNTLQSLYERHKVVTYPRTDSNYLTTDMVD
TOP3_STAEQ      NKKSYAQPLFNLTDLQQEAYKHYKMGPKETLNTLQHLYERHKLVTYPRTDSNYLTDDMVD
TOP3_STAES      NKKSYAQPLFNLTDLQQEAYKRYKMGPKETLNTLQHLYERHKLVTYPRTDSNYLTDDMVD
TOP3_STAHJ      VKKSHPKPLYNLTDLQQEAYQRYKMGPKETLNTIQNLYERHKVLTYPRTDSNYLTDDMVD
TOP3_STAS1      HKKAYPQQLYNLTDLQQDAYKRFHLGPKETLNTLQTLYERHKLVTYPRTDSNYLTDDMVD
TOP3_BACAH      QKKSFSPGLYDLTELQRDANKKFGYSAKETLNIMQKLYEQHKVLTYPRTDSRYISSDIVG
TOP3_BACAN      QKKSFSPGLYDLTELQRDANKKFGYSAKETLNIMQKLYEQHKVLTYPRTDSRYISSDIVG
TOP3_BACHK      QKKSFSPGLYDLTELQRDANKKFGYSAKETLNIMQKLYEQHKVLTYPRTDSRYISSDIVG
TOP3_BACCZ      QKKSFSPGLYDLTELQRDANKKFGYSAKETLNIMQKLYEQHKVLTYPRTDSRYISSDIVG
TOP3_BACC1      QKKSFSPGLYDLTELQRDANKKFGYSAKETLNIMQKLYEQHKVLTYPRTDSRYISSDIVG
TOP3_BACCR      QKKSFSPGLYDLTELQRDANKKFGYSAKETLNIMQKLYEQHKVLTYPRTDSRYISSDIVG
TOP3_BACLD      AKKSFAPGLYDLTELQRDAHKRFGFSAKETLSVLQKLYEQHKLVTYPRTDSRFLSNDIVP
TOP3_BACSU      AKKSFAPALYDLTELQRDAHKRFGFSAKETLSVLQKLYEQHKLVTYPRTDSRFLSSDIVP
TOP3_BACSK      TKRTPPPPLYDLTELQREANKRFGYSAKETLAALQRLYEQHKAVTYPRTDSRYLSSDLVE
TOP3_SALTI      RESESAPLPFSLSTLQIEAAKRFGLSAQNVLDICQKLYETHKLITYPRSDCRYLPEEHFA
TOP3_SALTY      RESESAPLPFSLSTLQIEAAKRFGLSAQNVLDICQKLYETHKLITYPRSDCRYLPEEHFA
TOP3_ECOLI      RESESAPLPFSLSALQIEAAKRFGLSAQNVLDICQKLYETHKLITYPRSDCRYLPEEHFA
TOP3_HAEIN      REKETAPLPYSLSALQIDAAKRFGMSAQAVLDTCQRLYETHRLITYPRSDCRYLPEEHFA
TOP3_PASMU      REHESAPLPYSLSALQIDAAKRYGLSAQEVLDICQRLYETHRLITYPRSDCRYLPEEHFG
TOP3_VIBCH      QTKQAAPLPYSLSALQIDAAKRYNFSAQQVLDLCQSLYEKHKLITYPRSDCRYLPKEHLA
                     .   :.*: ** :  :::  ..: .*   * *** *: :****:*..::. : . 

TOP3_STAAS      TMKERIQATMATTYKDQARPLMSKTFS-SKMSIFNNQKVSDHHAIIPTEVRPVMSDLSNR
TOP3_STAAW      TMKERIQATMATTYKDQARPLMSKTFS-SKMSIFNNQKVSDHHAIIPTEVRPVMSDLSNR
TOP3_STAAC      TMKERIQATMATTYKDQARPLMSKTFS-SKMSIFNNQKVSDHHAIIPTEVRPVMSDLSNR
TOP3_STAAM      TMKERIQATMATTYKDQARPLMSKTFS-SKMSIFNNQKVSDHHAIIPTEVRPVMSDLSNR
TOP3_STAA3      TMKERIQATMATTYKDQARPLMSKTFS-SKMSIFNNQKVSDHHAIIPTEVRPVMSDLSNR
TOP3_STAAN      TMKERIQATMATTYKDQARPLMSKTFS-SKMSIFNNQKVSDHHAIIPTEVRPVMSDLSNR
TOP3_STAA8      TMKERIQVTMATTYKDQARPLMSKTFS-SKMSIFNNQKVSDHHAIIPTEVRPVMSDLSNR
TOP3_STAAR      TMKERIQATMATTYKDQARPLMSKTFS-SKMSIFNNQKVSDHHAIIPTEVRPVMSDLSNR
TOP3_STAAB      TMKERIQATMATTYKDQARPLISKTFS-SKMSIFNNQKVSDHHAIIPTEVRPVMSDLSNR
TOP3_STAEQ      TIQERLRAILATDYKSHVRDLISESFS-SKMHIFNNQKVSDHHAIIPTEVRPSIEQLSQR
TOP3_STAES      TIQERLRAILATDYKSHVRDLISESFS-SKMHIFNNQKVSDHHAIIPTEVRPSIEQLSQR
TOP3_STAHJ      TIKERLYALLATDYKSQVKSLLGQSYS-SKMRIFKNHKVSDHHAIIPTEVRPDMQSLSNR
TOP3_STAS1      TLKDRLKAIMATSLKDMAKAQMSQTFS-SKQRFVNNNKVSDHHAIIPTEVRPDINQLSQR
TOP3_BACAH      TLPERLKACGVGEYRPLAHKVLQKPIK-ANKSFVDDSKVSDHHAIIPTEGYVNFSAFTDK
TOP3_BACAN      TLPERLKACGVGEYRPLAHKVLQKPIK-ANKSFVDDSKVSDHHAIIPTEGYVNFSAFTDK
TOP3_BACHK      TLPERLKACGVGEYRPLAHKVLQKPIK-ANKSFVDDSKVSDHHAIIPTEGYVNFSAFTDK
TOP3_BACCZ      TLPERLKACGVGEYRPLAHKVLQKPIK-ANKSFVDDSKVSDHHAIIPTEGYVNFSAFTDK
TOP3_BACC1      TLPERLKACGVGEYRPLAHKVLQKPIK-ANKSFVDDSKVSDHHAIIPTEGYVNFSAFTDK
TOP3_BACCR      TLPERLKACGVGEYRPFAHKVLQKPIK-PNKSFVDDSKVSDHHAIIPTEGYVNFSAFTDK
TOP3_BACLD      TLKDRLEGMQVKPYAQHVARILKRGVK-ANKSFVNDAKVSDHHAIIPTEEPLALGALSEK
TOP3_BACSU      TLKDRLEGMEVKPYAQYVSQIKKRGIK-SHKGYVNDAKVSDHHAIIPTEEPLVLSSLSDK
TOP3_BACSK      TLKERLHAVDVQPFRKMVANAKKQGLANAKRQMVNDAKVSDHHALIPTEQPQSASAMSDK
TOP3_SALTI      GRQAVMNAISVHAPDLLPQP-VVNPDT--RNRCWDDKKVDAHHAIIPTARSSSVH-LTEN
TOP3_SALTY      GRQAVMNAISVHAPDLLPQP-VVNPDT--RNRCWDDKKVDAHHAIIPTARSSSVH-LTEN
TOP3_ECOLI      GRHAVMNAISVHAPDLLPQP-VVDPDI--RNRCWDDKKVDAHHAIIPTARSSAIN-LTEN
TOP3_HAEIN      ERHNVLNAISTHCEAYQVLPNVILTEQ--RNRCWNDKKVEAHHAIIPTAKNRPVN-LTQE
TOP3_PASMU      ERTKVFQAISRHISDYQPLPDILNPEQ--KNRCWNDKKVEAHHAIIPTAKNTPVN-LNQR
TOP3_VIBCH      QAPDVVAAIANNAQEMVTAVNDADLSL--RSKAWNDSKVDAHHAIIPTPKKASVNALSGH
                     .                       .    .: **. ***:***        :. .

TOP3_STAAS      ELKLYDMIVERFLEALMPPHEYDAITVTLEVAGHTFVLKENVTTVLGFKSIRQG------
TOP3_STAAW      ELKLYDMIVERFLEALMPPHEYDAITVTLEVAGHTFVLKENVTTVLGFKSIRQG------
TOP3_STAAC      ELKLYDMIVERFLEALMPPHEYDAITVTLEVAGHTFVLKENVTTVLGFKSIRQG------
TOP3_STAAM      ELKLYDMIVERFLEALMPPHEYDAITVTLEVAGHTFVLKENVTTVLGFKSIRQG------
TOP3_STAA3      ELKLYDMIVERFLEALMPPHEYDAITVTLEVAGHTFVLKENVTTVLGFKSIRQG------
TOP3_STAAN      ELKLYDMIVERFLEALMPPHEYDAITVTLEVAGHTFVLKENVTTVLGFKSIRQG------
TOP3_STAA8      ELKLYDMIVERFLEALMPPHEYDAITVTLEVAGHTFVLKENVTTVLGFKSIRQG------
TOP3_STAAR      ELKLYDMIVERFLEALMSPHEYDAITVTLEVAGHTFVLKENVTTVLGFKSIRQG------
TOP3_STAAB      ELKLYDMIVERFLEALMPPHEYDAITVTLEVAGHTFVLKENVTTVLGFKSIRQG------
TOP3_STAEQ      EFKIYMLIAERFLENLMNPYLYEVLTIHAQLKDYNFVLKEIIPKQLGYKALKDQ------
TOP3_STAES      EFKIYMLIAERFLENLMNPYLYEVLTIHAQLKDYNFVLKEIIPKQLGYKALKDQ------
TOP3_STAHJ      ESKIYMMVAERFLESLMAPHEYEAVRVNVTVGQHIFAFNEKVTRQLGYKALKMN------
TOP3_STAS1      ESKIYMMIAQRYLENLMPPHEYEAIAIELKVGQHTFTFKDKVTTKLGFKAIYENK-----
TOP3_BACAH      ERKIYDLVVKRFLAVLFPAFEYEQLTLRTKVGNETFIARGKTILHAGWKEVYENRFEDDD
TOP3_BACAN      ERKIYDLVVKRFLAVLFPAFEYEQLTLRTKVGNETFIARGKTILHAGWKEVYENRFEDDD
TOP3_BACHK      ERKIYDLVVKRFLAVLFPAFEYEQLTLRTKVGNETFIARGKTILHAGWKEVYENRFEDDD
TOP3_BACCZ      ERKIYDLVVKRFLAVLFPAFEYEQLTLRTKIGNETFIARGKTILHAGWKEVYENRFEDDD
TOP3_BACC1      ERKIYDLVVKRFLAVLFPAFEYEQLTLRTKVGNETFIARGKTILHAGWKEVYENRFEDDD
TOP3_BACCR      ERKIYDLVVKRFLAVLFPAFEYEQLTLRTKVGNETFIARGKTILHAGWKEVYENRFEDDD
TOP3_BACLD      ERKLYDLIAKRFLAVLMPPFEYEETKVFAEIGGETFTAKGKTVQSQGWKAVYDFADEDDD
TOP3_BACSU      ERKLYDLIAKRFLAVLMPAFEYEETKVIAEIGGETFTAKGKTVQSQGWKAVYDMAEEDDE
TOP3_BACSK      EAKLYHLIVRRFLANFFPPSESELTSVEATANGELLRAKGERLVSAGWRG------QETG
TOP3_SALTI      EAKVYTLIARQYLMQFCPDAVFRKCVIELEIAKGKFVAKARFLAEAGWRTLLGSKERDE-
TOP3_SALTY      EAKVYTLIARQYLMQFCPDAVFRKCVIELEIAKGKFVAKARFLAEAGWRTLLGSKERDE-
TOP3_ECOLI      EAKVYNLIARQYLMQFCPDAVFRKCVIELDIAKGKFVAKARFLAEAGWRTLLGSKERDE-
TOP3_HAEIN      ERNIYSLIARQYLMQFCPDAEYRKSKITLNIAGGTFIAQARNLQTAGWKELLG-KEDDT-
TOP3_PASMU      EWQIYHLIARQYLMQFCPDAEYRKSKITLNIAGGTFIAQARNLQVAGWKQLLG-KEDSD-
TOP3_VIBCH      EMKVYQLIARQYLMQFYPAAIYAEAKLVFNIAGGIFIAKGRQLLSAGWKVLTG-QQDEQ-
                * ::* ::..::*  :          :        :  .       *::           

TOP3_STAAS      ---ESITEMQQPFSEGDEVKISKTNIREHETTPPEYFNEGSLLKAMENPQNFIQLKDKKY
TOP3_STAAW      ---ESITEMQQPFSEGDEVKISKTNIREHETTPPEYFNEGSLLKAMENPQNFIQLKDKKY
TOP3_STAAC      ---ESITEMQQPFSEGDEVKISKTNIREHETTPPEYFNEGSLLKAMENPQNFIQLKDKKY
TOP3_STAAM      ---ESITEMQQPFSEGDEVKISKTNIREHETTPPEYFNEGSLLKAMENPQNFIQLKDKKY
TOP3_STAA3      ---ESITEMQQPFSEGDEVKISKTNIREHETTPPEYFNEGSLLKAMENPQNFIQLKDKKY
TOP3_STAAN      ---ESITEMQQPFSEGDEVKISKTNIREHETTPPEYFNEGSLLKAMENPQNFIQLKDKKY
TOP3_STAA8      ---ESITEMQQPFSEGDEVKISKTNIREHETTPPEYFNEGSLLKAMENPQNFIQLKDKKY
TOP3_STAAR      ---ESITEMQQPFSEGDEVKISKTNIREHETTPPEYFNEGSLLKAMENPQNFIQLKDKKY
TOP3_STAAB      ---ESITEMQQPFSEGDEVKISKTNIREHETTPPEYFNEGSLLKAMENPQNFIQLKDKKY
TOP3_STAEQ      ---TSSHTLTHSFKEGQLFKVHRIEIHEHETKAPEYFNEGSLLKAMENPQNHIDLNDKKY
TOP3_STAES      ---TSSHTLTHSFKEGQLFKVHRIEIHEHETKAPEYFNEGSLLKAMENPQNHIDLNDKKY
TOP3_STAHJ      ---NDNVVKKVAFQKGEKYHLQSLKVNEHETTPPDYFNEGSLLKAMENPQNYIQLKEKKH
TOP3_STAS1      ---ESINTQIDQLQKGTKLNVTKILIEEHETTAPPYFNEGSLLKAMESPQKFFDLSDKKH
TOP3_BACAH      VTDDVKEQLLPRIEKGDTLTVKLIMQTSGQTKAPARFNEATLLSAMENPTKYMDTQNKQL
TOP3_BACAN      VTDDVKEQLLPRIEKGDTLTVKLIMQTSGQTKAPARFNEATLLSAMENPTKYMDTQNKQL
TOP3_BACHK      VTDDVKEQLLPRIEKGDTLTVKLIMQTSGQTKAPARFNEATLLSAMENPTKYMDTQNKQL
TOP3_BACCZ      VTDEVKEQLLPRIEKGDTLTVKLIMQTSGQTKAPARFNEATLLSAMENPTKYMDTQNKQL
TOP3_BACC1      VTDDVKEQLLPRIEKGDTLTVKLIMQTSGQTKAPARFNEATLLSAMENPTKYMDTQNKQL
TOP3_BACCR      VTDDVKEQLLPHIEKGDTLAVKLIMQTSGQTKAPARFNEATLLSAMENPTKYMDTQNKQL
TOP3_BACLD      --EEEKDQTLPKLAKGDTLSVRSLTETKGETKPPARFNEGTLLSAMENPAAFMQGEEKNL
TOP3_BACSU      Q-EDDRDQTLPALQKGDTLAVRTLTETSGQTKPPARFNEGTLLSAMENPSAFMQGEEKGL
TOP3_BACSK      EEDEALARLLPAMSKGDKKAVKWVGMTQGKTSPPPRFNEGTLLAAMEKPAQHMEAKDETI
TOP3_SALTI      ---ENDGTPLSVVAKGDELLCEKGEVVERQTQPPRHFTDATLLSAMTGIARFVQ--DKDL
TOP3_SALTY      ---ENDGTPLPVVAKGDELLCEKGEVVERQTQPPRHFTDATLLSAMTGIARFVQ--DKDL
TOP3_ECOLI      ---ENDGTPLPVVAKGDELLCEKGEVVERQTQPPRHFTDATLLSAMTGIARFVQ--DKDL
TOP3_HAEIN      ---ENQEPLLPIVKKGQILHCERGEVMSKKTQPPKPFTDATLLSAMTGIARFVQ--DKEL
TOP3_PASMU      ---EQQEPLLPVVKKGQILFCEKGEIVSKKTQPPKPFTDATLLSAMTGIARFVQ--DKEL
TOP3_VIBCH      ---EECVDKVPPLPVGIVLQCREGEIKQRQTEPPRHFTEATLLQAMTGIARFVA--DKEL
                            .  *           . :* .*  *.:.:** **     ..   ::  

TOP3_STAAS      AQTLKQTGGIGTVATRADIIDKLFNMNAIESRDGKIKVTSKGKQILELAPEELTSPLLTA
TOP3_STAAW      AQTLKQTGGIGTVATRADIIDKLFNMNAIESRDGKIKVTSKGKQILELAPEELTSPLLTA
TOP3_STAAC      AQTLKQTGGIGTVATRADIIDKLFNMNAIESRDGKIKVTSKGKQILELAPEELTSPLLTA
TOP3_STAAM      AQTLKQTGGIGTVATRADIIDKLFNMNAIESRDGKIKVTSKGKQILELAPEELTSPLLTA
TOP3_STAA3      AQTLKQTGGIGTVATRADIIDKLFNMNAIESRDGKIKVTSKGKQILELAPEELTSPLLTA
TOP3_STAAN      AQTLKQTGGIGTVATRADIIDKLFNMNAIESRDGKIKVTSKGKQILELAPEELTSPLLTA
TOP3_STAA8      AQTLKQTGGIGTVATRADIIDKLFNMNAIESRDGKIKVTSKGKQILELAPEELTSPLLTA
TOP3_STAAR      AQTLKQTGGIGTVATRADIIDKLFNMNAIESRDGKIKVTSKGKQILELAPEELTSPLLTA
TOP3_STAAB      AQTLKQTGGIGTVATRADIIDKLFNMNAIESRDGKIKVTSKGKQILELAPEELTSPLLTA
TOP3_STAEQ      AKTLKHSGGIGTVATRADIIEKLFNMNALESRDGKIKVTSKGKQILELSPSELTSPILTA
TOP3_STAES      AKTLKHSGGIGTVATRADIIEKLFNMNALESRDGKIKVTSKGKQILELSPSELTSPILTA
TOP3_STAHJ      ANTLRQTGGIGTVATRADIIEKLFNLNAIESRDGKIKVTSKGKQILDLAPQELTSPLLTA
TOP3_STAS1      DKTLKDTGGIGTVATRADIIEKLFNMNAIEARDGKIKVTSKGKQILELAPQKLTSPLLTA
TOP3_BACAH      ADTLKSTGGLGTVATRADIIDKLFNSFLIEKRGKDIHITSKGRQLLDLVPEELKSPTLTG
TOP3_BACAN      ADTLKSTGGLGTVATRADIIDKLFNSFLIEKRGKDIHITSKGRQLLDLVPEELKSPTLTG
TOP3_BACHK      ADTLKSTGGLGTVATRADIIDKLFNSFLIEKRGKDIHITSKGRQLLDLVPEELKSPTLTG
TOP3_BACCZ      ADTLKSTGGLGTVATRADIIDKLFNSFLIEKRGKDIHITSKGRQLLDLVPEELKSPTLTG
TOP3_BACC1      ADTLKSTGGLGTVATRADIIDKLFNSFLIEKRGKDIHITSKGRQLLDLVPEELKSPTLTG
TOP3_BACCR      ADTLKSTGGLGTVATRADIIDKLFNSFLIEKRGKDIHITSKGRQLLDLVPEELKSPTLTG
TOP3_BACLD      VKTLGETGGLGTVATRADIIEKLFNTFLIEKKGKDIYITSKGKQLLELVPSDLKSPALTA
TOP3_BACSU      VKTLGETGGLGTVATRADIIEKLFNSFLIEKKGQDIFITSKGKQLLQLVPEDLKSPALTA
TOP3_BACSK      KKTLAQAGGIGTVATRADIIEKLFSSFYIEKKGKDLYITSKGKQLLELVPAELKSPALTA
TOP3_SALTI      KKILRATDGLGTEATRAGIIELLFKRSFLTKKGRYIHSTDAGKALIHSLPEMAARPDMTA
TOP3_SALTY      KKILRATDGLGTEATRAGIIELLFKRSFLTKKGRYIHSTDAGKALIHSLPEMAARPDMTA
TOP3_ECOLI      KKILRATDGLGTEATRAGIIELLFKRGFLTKKGRYIHSTDAGKALFHSLPEMATRPDMTA
TOP3_HAEIN      KKILRETDGLGTEATRAGIIELLFKRGFLTKKGRNIHSTETGRILIQALPNIATQPDMTA
TOP3_PASMU      KKILRETDGLGTEATRAGIIELLFKRGFLYKKGRNIHSTETGRILIQALPDVATQPDMTA
TOP3_VIBCH      KKILRETDGLGTEATRAGILDTLFKRGLLQRDNKLIKSTPAGRGLIHALPSEATYPDMTA
                 . *  :.*:** ****.*:: **.   :   .  :  *  *: ::.  *     * :*.

TOP3_STAAS      QWEEKLLLIERGKYQAKTFINEMKDFTKDVVNGIKNSDRKYKHDNLTTTECPTCGKFMIK
TOP3_STAAW      QWEEKLLLIERGKYQAKTFINEMKDFTKDVVNGIKNSDRKYKHDNLTTTECPTCGKFMIK
TOP3_STAAC      QWEEKLLLIERGKYQAKTFINEMKDFTKDVVNGIKNSDRKYKHDNLTTTECPTCGKFMIK
TOP3_STAAM      QWEEKLLLIERGKYQAKTFINEMKDFTKDVVNGIKNSDRKYKHDNLTTTECPTCGKFMIK
TOP3_STAA3      QWEEKLLLIERGKYQAKTFINEMKDFTKDVVNGIKNSDRKYKHDNLTTTECPTCGKFMIK
TOP3_STAAN      QWEEKLLLIERGKYQAKTFINEMKDFTKDVVNGIKNSDRKYKHDNLTTTECPTCGKFMIK
TOP3_STAA8      QWEEKLLLIERGKYQAKTFINEMKDFTKDVVNGIKNSDRKYKHDNLTTTECPTCGKFMIK
TOP3_STAAR      QWEEKLLLIERGKYQAKTFINEMKDFTKDVVNGIKNSDRKYKHDNLTTTECPTCGKFMIK
TOP3_STAAB      QWEEKLLLIERGKYQAKTFINEMKGFTKDVVNGIKNSDRKYKHDNLTTTECPTCGKFMIK
TOP3_STAEQ      QWEEKLMLIEKGKYNSQKFIQEMKNFTFKVVNKIKSSEQKYKHDNLTTTECPTCGKFMIK
TOP3_STAES      QWEEKLMLIEKGKYNSQKFIQEMKNFTFKVVNKIKSSEQKYKHDNLTTTECPTCGKFMIK
TOP3_STAHJ      EWEEKLLLIEKGRYNSRHFIDEMKAFTQSIVNTIKNSEQKYKHDNLTTTECPTCGKFMIK
TOP3_STAS1      EWEEKLLLIEQGKYNASQFISEMKAFTNQVVNEIKESEQNYKHDNLTTTECPTCGKFMIK
TOP3_BACAH      EWEQKLEAIAKGKLKKEVFISEMKNYTKEIVSEIKSSDKKYKHDNISTKSCPDCGKPMLE
TOP3_BACAN      EWEQKLEAIAKGKLKKEVFISEMKNYTKEIVSEIKSSDKKYKHDNISTKSCPDCGKPMLE
TOP3_BACHK      EWEQKLEAIAKGKLKKEVFISEMKNYTKEIVSEIKSSDKKYKHDNISTKSCPDCGKPMLE
TOP3_BACCZ      EWEQKLEAIAKGKLKKEVFISEMKNYTKEIVSEIKSSDKKYKHDNISTKSCPDCGKPMLE
TOP3_BACC1      EWEQKLEAIAKGKLKKEVFISEMKNYTKEIVSEIKSSDKKYKHDNISTKSCPDCGKPMLE
TOP3_BACCR      EWEQKLEAIAKGKLKKEVFISEMKNYTKEIVSEIKSSDKKYKHDNISTKSCPDCGKPMLE
TOP3_BACLD      EWEQKLSGIAKGKLKSSAFIKEMKEYAKQTIREIKSSNQKFKHDNITGTHCPDCGKLMLK
TOP3_BACSU      EWEQKLSAIAAGKLKSAVFIKDMKAYAHQTVKEIKNSSQTFRHDNITGTACPECGKMMLK
TOP3_BACSK      EWEQRLEKIVQGKEQKQMFIAEMKEYAKAVVAQVKADTATFRHDNKTGEKCPECGKFLLE
TOP3_SALTI      HWESVLTQISEKQCRYQDFMQPLVGTLYQLIDQAKRTPVKRFRGIVAPGGG---EKKKSA
TOP3_SALTY      HWESVLTQISEKQCRYQDFMQPLVGTLYQLIEQAKRTPVKRFRGIVAPGGG---DKKKSA
TOP3_ECOLI      HWESVLTQISEKQCRYQDFMQPLVGTLYQLIDQAKRTPVRQFRGIVAPGSGGSADKKKAA
TOP3_HAEIN      HWESQLTDISQKQATYQQFMHNLNQILPDLVRFVDLNALRQLSRIKMIKSD---RAKPKS
TOP3_PASMU      HWESQLTSISQKEMSYQQFMSTLTNFLPELMRYVNFAALRQLSQVEKPQS---------F
TOP3_VIBCH      HWEHQLQAIAEKGQAYQPFMQTLQGRLEQLIEQVQVAPVPVSLQALPAVSK-----PAFK
                .**  *  *         *:  :       :   .                         

TOP3_STAAS      VKTKNGQMLVCQDPSCKTKKNVQRKTNARCPNCKKKLTLFGKGKEAVYRCVCGHSETQAH
TOP3_STAAW      VKTKNGQMLVCQDPSCKTKKNVQRKTNARCPNCKKKLTLFGKGKEAVYRCVCGHSETQAH
TOP3_STAAC      VKTKNGQMLVCQDPSCKTKKNVQRKTNARCPNCKKKLTLFGKGKEAVYRCVCGHSETQAH
TOP3_STAAM      VKTKNGQMLVCQDPSCKTKKNVQRKTNARCPNCKKKLTLFGKGKEAVYRCVCGHSETQAH
TOP3_STAA3      VKTKNGQMLVCQDPSCKTKKNVQRKTNARCPNCKKKLTLFGKGKEAVYRCVCGHSETQAH
TOP3_STAAN      VKTKNGQMLVCQDPSCKTKKNVQRKTNARCPNCKKKLTLFGKGKEAVYRCVCGHSETQAH
TOP3_STAA8      VKTKNGQMLVCQDPSCKTKKNVQRKTNARCPNCKKKLTLFGKGKEAVYRCVCGHSETQAH
TOP3_STAAR      VKTKNGQMLVCQDPSCKTKKNVQRKTNARCPNCKKKLTLFGKGKEAVYRCVCGHSETQAH
TOP3_STAAB      VKTKNGQMLVCQDPSCKTKKNVQRKTNARCPNCKKKLTLFGKGKEAVYRCVCGHSETQAH
TOP3_STAEQ      VKTKNGQMLVCQDPKCKTKKNIQRKTNARCPYCKKKMTLFGKGKEAVYRCVCGHTETQSQ
TOP3_STAES      VKTKNGQMLVCQDPKCKTKKNIQRKTNARCPNCKKKMTLFGKGKEAVYRCVCGHTETQSQ
TOP3_STAHJ      VKTKNGQMLVCQDPTCKTKKNVQRKTNARCPNCKKKMTLFGRGKDAVYRCVCGHTETQEQ
TOP3_STAS1      VKTKNGQMLVCQDPQCKTKKNVQRKTNARCPNCHKKMTLFGRGKDAVYRCVCGHTETQAQ
TOP3_BACAH      VNGKKGKMLVCQDRECGHRKNVSRTTNARCPQCKKKLELRGEGAGQIFACKCGYREKLST
TOP3_BACAN      VNGKKGKMLVCQDRECGHRKNVSRTTNARCPQCKKKLELRGEGAGQIFACKCGYREKLST
TOP3_BACHK      VNGKKGKMLVCQDRECGHRKNVSRTTNARCPQCKKKLELRGEGAGQIFACKCGYREKLST
TOP3_BACCZ      VNGKKGKMLVCQDRECGHRKNVSRTTNARCPQCKKKLELRGEGAGQIFACKCGYREKLST
TOP3_BACC1      VNGKKGKMLVCQDRECGHRKNVSRTTNARCPQCKKKLELRGEGAGQIFACKCGYREKLSK
TOP3_BACCR      VNGKKGKMLVCQDRECGHRKNVSRTTNARCPQCKKKLELRGEGAGQIFACKCGYREKLST
TOP3_BACLD      VNGKRGTMLVCQDRECGHRKTVAKQTNARCPVCHKRMELRGHGEGQTFACVCGHREKLSV
TOP3_BACSU      VNGKRGTMLVCQDRECGSRKTIARKTNARCPNCHKRMELRGQGEGQTFACVCGHREKLSV
TOP3_BACSK      VNGKKGKMRVCQDRECGYRKNIAMTTNARCPKCKKKLELRGEGEGQVFACVCGHREKKAQ
TOP3_SALTI      PRKRAGKKSPPAEETGRQTE----------------------------------------
TOP3_SALTY      PRKRAGKKSPPAAETGRQTE----------------------------------------
TOP3_ECOLI      PRKRSAKKSPPADEVGSGAIA---------------------------------------
TOP3_HAEIN      AVKKSSKSNGETD-----------------------------------------------
TOP3_PASMU      SKKMSAKSKKRPT-----------------------------------------------
TOP3_VIBCH      RTRRAPKSKARTYKA---------------------------------------------
                                                                            

TOP3_STAAS      MDQRMKSKSSGKVSRKEMKKYMN---KNEGLDNNPFKDALKNLNL-----
TOP3_STAAW      MDQRMKSKSSGKVSRKEMKKYMN---KNEGLDNNPFKDALKNLNL-----
TOP3_STAAC      MDQRMKSKSSGKVSRKEMKKYMN---KNEGLDNNPFKDALKNLNL-----
TOP3_STAAM      MDQRMKSKSSGKVSRKEMKKYMN---KNEGLDNNPFKDALKNLNL-----
TOP3_STAA3      MDQRMKSKSSGKVSRKEMKKYMN---KNEGLDNNPFKDALKNLNL-----
TOP3_STAAN      MDQRMKSKSSGKVSRKEMKKYMN---KNEGLDNNPFKDALKNLNL-----
TOP3_STAA8      MDQRMKSKSSGKVSRKEMKKYMN---KNEGLDNNPFKDALKNLNL-----
TOP3_STAAR      MDQRMKSKSSGKVSRKEMKKYMN---KNEGLDNNPFKDALKNLNL-----
TOP3_STAAB      MDQRMKSKSSGKVSRKEMKKYMN---KNEGLDNNPFKDALKNLNL-----
TOP3_STAEQ      MDKRMRDKTNGKVSRKEMKKYIN---KKEEIDNNPFKDALKNLKL-----
TOP3_STAES      MDKRMRDKTNGKVSRKEMKKYIN---KKEEIDNNPFKDALKNLKL-----
TOP3_STAHJ      MDKRFKNKSSGKVSKKEMKKYMN---NEDSLENNPFKDALKNLKL-----
TOP3_STAS1      MDKRHKNKKSDKVNKKDLKKYMN---NDEGIENNPFQDALKGLKF-----
TOP3_BACAH      FQERRKKESGNKADKRDVQKYMKQQKKEEEPLNNPFAEALKKLKFD----
TOP3_BACAN      FQERRKKESGNKADKRDVQKYMKQQKKEEEPLNNPFAEALKKLKFD----
TOP3_BACHK      FQERRKKESGNKADKRDVQKYMKQQKKEEEPLNNPFAEALKKLKFD----
TOP3_BACCZ      FQERRKKESGNKADKRDVQKYMKQQKKEEEPLNNPFAEALKKLKFD----
TOP3_BACC1      FQERRKKESGNKADKRDVQKYMKQQKKEEEPLNNPFAEALKKLKFD----
TOP3_BACCR      FQERRKKESGNKADKRDVQKYMKQQNKEEEPLNNPFAEALKKLKFD----
TOP3_BACLD      FEKRRAKDKNSKASKRDVHSYMKKQNKDE-PINNALAEQLKKLKLDQ---
TOP3_BACSU      FEKRKNKDK-ARATKRDVSSYMKKQNKDE-PINNALAEQLKKLGLDK---
TOP3_BACSK      FEQRRKQNKHKNVSKREVQSYMKKQNKQDQFANSALADQLAKLGLKGDDS
TOP3_SALTI      --------------------------------------------------
TOP3_SALTY      --------------------------------------------------
TOP3_ECOLI      --------------------------------------------------
TOP3_HAEIN      --------------------------------------------------
TOP3_PASMU      --------------------------------------------------
TOP3_VIBCH      --------------------------------------------------