CLUSTAL format seed alignment for MF_00954

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

C6C4L2_DICP7          ----MDKPHLTINELDAERLDALLEQSAFAGTDVAQALNAELDRAHIVAPVEIPPDVVTM
E0SHB8_DICD3          ----MDKPHLTISELDAERLDALLEQPAFADTEVAQALSEELDRADIVQPVEIPGDVVTM
Q6DAH0_PECAS          ----MTKPNLTISELDAERLDKLLEQPAFADSDIAQALNDELDRAEILPSASIPSHVVTM
A1JRG9_YERE8          ----MTKPTITINELDAERLDALLAQPAFAGSVVATALNEELDRAEILPPNAIPADVVTM
B4EX42_PROMH          ----MTKPTIIINELDAERLDSLLEQPAFADSPIAEALNEELDRADIVTPADIPANIVTM
A0A140NPS7_PROSM      ----MTKPTIIINDLDAERLDALLEQAAYAGTPVADALNDELDRADILSPQEIPADVVTM
D3V5K5_XENBS          ----MKKPKIIINELDAERLDLLLEQPAFANTHIAEALNSELDRAEIVPPVEIPPDVVTM
D3VDJ4_XENNA          ----MTKPKIIINELDAERLDSLLEQPAFANTGIADALNEELDRAEILPPVDIPADVVTM
C7BLR6_PHOAA          ----MTKPAIIINELDAERLDSLLEQPAFADTSIADALNEELDRAEIVPPAEIPSDVVTM
H2IU83_RAHAC          ----MSKPTLIINELDAERLDTLLAQPAFANSPVADALNEELDRAEILPPEQIPADVVTM
RNK_ECOLI             ----MSRPTIIINDLDAERIDILLEQPAYAGLPIADALNAELDRAQMCSPEEMPHDVVTM
A0A198GQ07_9ENTR      ----MSRPTIIINELDAERIDRLLEKPEFAALPIADALNAELDRAQMCTPESMPHNVVTM
E3G4N0_ENTLS          ----MTRPAIIINEFDAERIDRLLEQPAWASSPVADALNDELDRAQMCAPESMPHDVVSM
A6T682_KLEP7          MEYAMTRPAIIINELDAERIDRLLEQPAFANSPVADALNEELDRAQMLAPEAMPHDVVTM
I2BBE0_SHIBC          ----MSRPAIIINELDAERLDQLLEQPQYAKLPVADALNAELDRAQMCQPEAMPADVVTM
D0ZBG1_EDWTE          ----MSRPAIIINELDAERLDRLLERPAFAAQPVAQALNEELDRAQLLAPAAMPADVVTM
A7MK20_CROS8          ----MSRPALIINELDAERLDSLLEQPAFARLPVADALNDELDRARMVSPQAMPEDVVTM
                          * :* : *.::****:* ** :. :*   :* **. ***** :  .  :* .:*:*

C6C4L2_DICP7          NSRVRFRDLLTCEEHIRTLVYPATLKDSSEQISVMAPLGAALLGMHVGKTINWPLPNGEE
E0SHB8_DICD3          NSRVRFRDLLTTEEHIRTLVYPAGLKDSREQISVMAPLGAALLGMHVGNSIAWPLPNGEE
Q6DAH0_PECAS          NSRVRFRDLNTNEEHIRTLVYPAAVKDSKEPLSVMAPLGAALLGMHVGSAITWQLPNGEE
A1JRG9_YERE8          NSRVRFRDLNSQEEHIRTLVYPASLKDSNEQLSVMAPLGAALLGLHVNDEISWKLPGGDE
B4EX42_PROMH          NSKVRFMDLKNNEERIRTLVYPASLKDSATELSVMAPMGAALLGLAINDEISWQLPNGLE
A0A140NPS7_PROSM      NSTVRFLDLISNEERTRTLVYPASLKDSAEQLSVMAPIGAALLGLHVNDEISWALPNGVE
D3V5K5_XENBS          NSEIRFIDLGSNEERVRTLVYPASLQDSTKHLSVMAPLGAALLGLRVNDEITWQLPNSEK
D3VDJ4_XENNA          NSEIRFIDLGSNEERVRTLVYPASLQDSTKQLSVMAPLGAALLGLRVNGEITCQLPNGEE
C7BLR6_PHOAA          NSRVRFLDLTSSEERVRTLVYPASLQDSSNQLSVMAPLGAALLGLRIGDEISWKLPNGEE
H2IU83_RAHAC          NSKVRFTEGKDGEEHIRTLVYPAALQDSNEQLSVMAPLGAALLGLRVGESITWEMPNGAE
RNK_ECOLI             NSRVKFRNLSDGEVRVRTLVYPAKMTDSNTQLSVMAPVGAALLGLRVGDSIHWELPGGVA
A0A198GQ07_9ENTR      NSQVKFRDLTTGEERTRTLVYPAQMTDSSTQLSVLAPVGAALIGLRTGDTIHWELPGGTS
E3G4N0_ENTLS          NSKVRFRDLTTGEERVRTLVFPTQMTDSSTQLSVLAPVGAALLGLRVGSTIHWELPNGTA
A6T682_KLEP7          NSRVKFRDLTSGEERVRTLVFPSQVTDSASQLSVLAPVGAALLGLKVGSTIHWELPGGAS
I2BBE0_SHIBC          NSQVKFRDLTSGEVRTRTLVYPASLTDSEQQLSVMAPVGAALLGLRVGNTIHWTLPNGNQ
D0ZBG1_EDWTE          NSRVRFRDLNTNEEHVRTLVYPHLQDSAEDGLSVMAPIGAALLGLRVGDAIRWTLPNGNQ
A7MK20_CROS8          NSRVKFRDLASGETYERLLVYPQNAGSSPEALSVMAPVGAALLGLRVGDAIRWPLPDGSE
                      ** ::* :    *   * **:*    .:   :**:**:****:*:  .  *   :*..  

C6C4L2_DICP7          TRIEVMELLYQPEAAGEYHR
E0SHB8_DICD3          TRIEVMELLYQPEAAGEYHR
Q6DAH0_PECAS          TRIEVLELLYQPEAAGEYHR
A1JRG9_YERE8          ARITVLELLYQPEAAGEYHR
B4EX42_PROMH          TKVKVLEILYQPEAAGELHR
A0A140NPS7_PROSM      TRVRVLEIIYQPEAAGEYHR
D3V5K5_XENBS          TRIKVLEIIYQPEAAGEYHR
D3VDJ4_XENNA          TRIKVLEILYQPEAAGEYHR
C7BLR6_PHOAA          TRVKVLELLYQPEAAGEYHR
H2IU83_RAHAC          SDITVLELLFQPEAAGELRR
RNK_ECOLI             THLEVLELEYQPEAAGDYLL
A0A198GQ07_9ENTR      AHLEVLELLYQPEAAGDYLR
E3G4N0_ENTLS          THLEVLELLYQPEAAGEFHR
A6T682_KLEP7          THLEVLELLYQPEAAGEFHR
I2BBE0_SHIBC          TNLEVLELIYQPESAGEYHR
D0ZBG1_EDWTE          THIEVLALLYQPEAAGELLR
A7MK20_CROS8          THIEVLELLYQPEAAGEYRL
                      : : *: : :***:**: