CLUSTAL format seed alignment for MF_00956

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Q47WH1_COLP3          ------------------------------------------------------------
D1B3Y4_SULD5          ------------------------------------------------------------
E6S4E2_HELPF          ------------------------------------------------------------
FCL_AZOC5             ------------------------------------------------------------
FCL_SINFN             ------------------------------------------------------------
A9CH50_AGRFC          ------------------------------------------------------------
Q7VEE9_PROMA          ------------------------------------------------------------
Q7UVN0_RHOBA          ------------------------------------------------------------
FCL_ECOLI             ------------------------------------------------------------
FCL2_ARATH            -------------------------------------------------MADNTGS----
FCL1_ARATH            -------------------------------------------------MAETIGS----
FCL1_ORYSJ            -------------------------------------------------MGTVTTA----
FCL2_ORYSJ            -------------------------------------------------MPSQQRSSSGS
P71791_MYCTU          ------------------------------------------------------------
Q72FX3_DESVH          ------------------------------------------------------------
Q8A8E2_BACTN          ------------------------------------------------------------
Q0P8I6_CAMJE          ------------------------------------------------------------
Q8F5U0_LEPIN          ------------------------------------------------------------
H7C7D0_COXBU          ------------------------------------------------------------
E6VUG2_PSEA9          ------------------------------------------------------------
J9ZEA2_LEPFM          ------------------------------------------------------------
A6VG32_METM7          ------------------------------------------------------------
Q5V1W1_HALMA          ------------------------------------------------------------
Q2IHJ1_ANADE          ------------------------------------------------------------
K9QYD1_NOSS7          ------------------------------------------------------------
P72585_SYNY3          ------------------------------------------------------------
B1XN91_SYNP2          ------------------------------------------------------------
Q8DL64_THEEB          ------------------------------------------------------------
E8R300_ISOPI          ------------------------------------------------------------
D5BSI5_PUNMI          ------------------------------------------------------------
B0T592_CAUSK          ------------------------------------------------------------
Q0BHR7_BURCM          ------------------------------------------------------------
FCL_HUMAN             ------------------------------------------------------------
FCL_PONAB             ------------------------------------------------------------
FCL_MOUSE             ------------------------------------------------------------
FCL_DICDI             ------------------------------------------------------------
FCL_DROME             ------------------------------------------------------------
S7UNW6_TOXGG          MQKSGCAQASGREARQAASGSLRKLLCRGKRKAEQRTFSARNESCCEGEGTSNSGETPRN
A0A024X7F5_PLAFC      ------------------------------------------------------------
                                                                                  

Q47WH1_COLP3          -----------------------MKILLTGANGMVGKNILELASKHQ-------------
D1B3Y4_SULD5          ----------------------MQKILITGSSGMVGKNIVEFEKSKN-------------
E6S4E2_HELPF          ---------------------MNEIILITGAYGMVGQNTALYFKKNKPD-----------
FCL_AZOC5             -------------------MGKGKKLLITGGRGMVGRNLIACAARSG-------------
FCL_SINFN             ---------------MPMYLLDGKRIWVAGHKGMVGSAIIRSLASED-------------
A9CH50_AGRFC          ---------------MPFSLN-GKRVWVAGHTGMVGSALVRRLEREN-------------
Q7VEE9_PROMA          ----------MRNMIKKSLLKKEDKIFVAGHKGMAGSAICRSLLHKGF------------
Q7UVN0_RHOBA          ---------------------MPQKIFVAGHRGMVGSAILRRFAHRDD------------
FCL_ECOLI             --------------------MSKQRVFIAGHRGMVGSAIRRQLEQRGD------------
FCL2_ARATH            -----------EMKSGSFMLEKSAKIFVAGHRGLVGSAIVRKLQDQGF------------
FCL1_ARATH            -----------EVSS---MSDKSAKIFVAGHRGLVGSAIVRKLQEQGF------------
FCL1_ORYSJ            -----------DPHA-SFLADKGGKVFVAGHRGLVGSAILRHLVSLGF------------
FCL2_ORYSJ            TAKAGDADGDGDAAAVSFLGDKSAKVFIAGHRGMVGSAVHRKLDALGF------------
P71791_MYCTU          ----------MNAHTSVGPLDRAARVYIAGHRGLVGSALLRTFAGAGF------------
Q72FX3_DESVH          -------------------MEKNDKIYVAGHRGLVGGAIVRNLRSRGF------------
Q8A8E2_BACTN          -------------------MEKNAKIYVAGHHGLVGSAIWKNLQDKGY------------
Q0P8I6_CAMJE          -------------------MQTNSKIYIAGHKGTAGTALVENLQKRGF------------
Q8F5U0_LEPIN          -------------------MEKESKIYIAGHKGLVGSAIERVLKKEGY------------
H7C7D0_COXBU          -------------------MQKDAPIFVTGHRGLAGSAILRRLKKQGY------------
E6VUG2_PSEA9          -------------------MGRETSVLVAGASKALGRAIVEALEDHER------------
J9ZEA2_LEPFM          -----------------MSLTKNSRILVLGASGMIGSACVRWLKLHGY------------
A6VG32_METM7          -------------------MDKNSKITIFGGSGLVGSSIFRQLSKKGY------------
Q5V1W1_HALMA          ---------MTDWHRKTADYWDGKSVMITGGAGFLGSHLIDELERRSE-D----------
Q2IHJ1_ANADE          ----------------MRFDWSSERVVVTGGAGFLGGFVQEELRRRG--A----------
K9QYD1_NOSS7          ---------------MTALELKNKRILVTGGAGFLGRQVISQLCQAGADP----------
P72585_SYNY3          -----------------MLSLENQRILVTGGAGFLGKQVVAQLIAAGGDR----------
B1XN91_SYNP2          -----------------MIDLSQKKILVTGGAGFLGQQVIHQLIQAGAQP----------
Q8DL64_THEEB          ------------------MDLSQKRILVTGGAGFLGRHVVAQLQVAGAVP----------
E8R300_ISOPI          --------------MATQAIWSGRRVTVTGGSGFLGGHLVKRLHTLGA------------
D5BSI5_PUNMI          ----------------------MKRVLITGASGFLGSNLRVALEKSDKKF----------
B0T592_CAUSK          ---------------------MAGRILVTGATGFLGRHMTPVLSEAYPDR----------
Q0BHR7_BURCM          ------------------MAGSEESVLITGAGGVIGHALKQELADSGY------------
FCL_HUMAN             ----------------MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLP----------
FCL_PONAB             ----------------MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLP----------
FCL_MOUSE             ----------------MGEPHGSMRILVTGGSGLVGRAIQKVVADGAGLP----------
FCL_DICDI             ----------------MTETTSKRTVLVTGGSGLVGKGIEKYVKETDKS-----------
FCL_DROME             ----------------------MKKVLVTGGTGLVGKALEAVIKEQSPE-----------
S7UNW6_TOXGG          PLLPLNHAQQAVSMAGDRVSPSLPVCLVTGGSGLVGKALQSVLLREQAPSSSSSSSSSSP
A0A024X7F5_PLAFC      ---------------------MTRICLVTGGTGLLGSSLREVIKNENKNIIEKENEIIVN
                                                 : *     *                        

Q47WH1_COLP3          ------------------------------HTFLTPSSKVLNLLDAASTQAYLVEHKPDM
D1B3Y4_SULD5          ------------------------------YILLTPSSKELNLLDKNSVEMYLKINKPDV
E6S4E2_HELPF          ------------------------------VALLTPKKSELYLLDKDNVQAYLKEHKPTG
FCL_AZOC5             ------------------------------WEIIAPTSVDLDLRNAEAVEQYIRRQLPDV
FCL_SINFN             ------------------------------CEVIVADRQKLDLTRQEEVEKFLLKEKPHA
A9CH50_AGRFC          ------------------------------CEILKVSRRELDLTRQYETEQWMAAARPQV
Q7VEE9_PROMA          ------------------------------ENILTVDRNDLDLTDNHNVRNWFDTYQPSI
Q7UVN0_RHOBA          ------------------------------LQVVTRTRTELDLCNQAAVNKFFESERPDT
FCL_ECOLI             ------------------------------VELVLRTRDELNLLDSRAVHDFFASERIDQ
FCL2_ARATH            ------------------------------TNLVLRTHSELDLTSQSDVESFFATEKPVY
FCL1_ARATH            ------------------------------TNLVLKTHAELDLTRQADVESFFSQEKPVY
FCL1_ORYSJ            ------------------------------TNVVVRTHAELDLTRQSDVEAFFAAELPRY
FCL2_ORYSJ            ------------------------------TNVVVRTRAELDLACQAAVEAFFAAELPRY
P71791_MYCTU          ------------------------------TNLLVRSRAELDLTDRAATFDFVLESRPQV
Q72FX3_DESVH          ------------------------------GNLLMRSSAELDLRCQRAVEDFFAAERPDY
Q8A8E2_BACTN          ------------------------------TNLIGRTHQELDLLDGVAVRRFFDEEQPEY
Q0P8I6_CAMJE          ------------------------------NNLVLKTRQELDLVNQQAVAKFFKEEKPEY
Q8F5U0_LEPIN          ------------------------------ENILGKTHAELDLTEQSKVNEFFEVNRPEY
H7C7D0_COXBU          ------------------------------SSLITRTHQELDLTNKEKVFEFFANNCPEY
E6VUG2_PSEA9          ------------------------------FAPMTAPQP--EWSDQGETERFFAEHAPEH
J9ZEA2_LEPFM          ------------------------------DKIESPSRSELDLFSMENVRHYFHSHSPEF
A6VG32_METM7          ------------------------------SNVNYPSSKSVNLLDKNQVEEYIKSEKPEY
Q5V1W1_HALMA          ------------------------------VNIFVPRSDEYDLRNRQEIKRALVDSNPDV
Q2IHJ1_ANADE          ------------------------------KDVFVPRSKDYDLVQMEGVRALYRDARPTM
K9QYD1_NOSS7          ------------------------------AKITIPRSRELDLRVWENCQRAVDQQ--DI
P72585_SYNY3          ------------------------------PKITIPRSKDCDLRQASACERAVENQ--DI
B1XN91_SYNP2          ------------------------------GNITVPRSSSCDLRRLEACQQAVQGQ--DI
Q8DL64_THEEB          ------------------------------EQITVVRSRDYDLRQLSACQAVVQGQ--DI
E8R300_ISOPI          -------------------------------KVFVPRSASYNLVRLEDCLRCLLEHPCDL
D5BSI5_PUNMI          ------------------------------DCIFLN-SSDYDLTELSQASKMVKEHRPDV
B0T592_CAUSK          ------------------------------EIVGVS-SADGDLTSFDVTRALLERVRPDA
Q0BHR7_BURCM          ------------------------------SNVVAITSSDIDLRDQSATEKMFDELRPTI
FCL_HUMAN             -----------------------------GEDWVFVSSKDADLTDTAQTRALFEKVQPTH
FCL_PONAB             -----------------------------GEDWVFVSSKDADLTDAAQTRALLEKVRPTH
FCL_MOUSE             -----------------------------GEEWVFVSSKDADLTDAAQTQALFQKVQPTH
FCL_DICDI             -----------------------------NDVWVFMRSSDCDLKSRESTRSYFEKIKPTH
FCL_DROME             -----------------------------DEQWFFAGSKDADLTNLAATQALFAREKPTH
S7UNW6_TOXGG          SDSEGKDGKDGGTVRGEASPEGPTIISARAVAFVFVGSRDADLRDYTQTERLFLRYRPQS
A0A024X7F5_PLAFC      SNENKN----------------------IITKYIFLSSEMCDLKDYDKSKLVFEKYNFTD
                                                                                  

Q47WH1_COLP3          IIHAAGVVGGIQANMAHPVKFLVDNMQMGLNILNSAKNCG-IKQFLNLSSSCMYPRDALN
D1B3Y4_SULD5          VIHCAGRVGGIQANMAHPVDFLVQNTQMGLNIIMASYEAR-ITKFINMSSSCMYPRYAKN
E6S4E2_HELPF          IIHCAGRVGGIVANMNDLSTYMVENLLMGLYLFSSALDLG-VKKAINLASSCAYPKFAPN
FCL_AZOC5             VVHAAGVVGGIHANIADPIHFLADNAAMALNVVMSSFRSE-VVTLINLSSSCMYPACIEG
FCL_SINFN             VIMAAAKVGGILANDTMPADFIYQNLIMEANVIEGSFRSG-VEKLLFLGSSCIYPKYAAQ
A9CH50_AGRFC          IFVAAAKVGGIAANAAYPADFLYTNTLISMNIMKSAADIG-VEKLLWMGSSCIYPKFAAQ
Q7VEE9_PROMA          VVLAAAKVGGIQANRIYPADFLLENLKIQNNVIETAWNKG-VKRFLFLGSSCIYPRCTPQ
Q7UVN0_RHOBA          VIFAAAKVGGIHVNATYPADFAYDNTMMAANAIHAAFQTG-VSRFLFLGSTCIYPRMAPQ
FCL_ECOLI             VYLAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQND-VNKLLFLGSSCIYPKLAKQ
FCL2_ARATH            VILAAAKVGGIHANNTYPADFIGVNLQIQTNVIHSAYTHG-VKKLLFLGSSCIYPKFAPQ
FCL1_ARATH            VILAAAKVGGIHANNTYPADFIGVNLQIQTNVIHSAYEHG-VKKLLFLGSSCIYPKFAPQ
FCL1_ORYSJ            VVLAAAKVGGIHANSTFPADFIAANLQIQTNVVDAALKCGSVRKLLFLGSSCIYPKFAPQ
FCL2_ORYSJ            VILAAAKVGGVHASSAAPAEYLTENLRITVNVVDAARRCGSVRKLLVLASSTIYPADAPQ
P71791_MYCTU          VIDAAARVGGILANDTYPADFLSENLQIQVNLLDAAVAAR-VPRLLFLGSSCIYPKLAPQ
Q72FX3_DESVH          VFLAAAKVGGILANDTYPADFIRDNLQMEVNVIDAAHRAG-VRKLCFLGSSCIYPKFAPQ
Q8A8E2_BACTN          VFLAAAFVGGIMANSIYRADFIYKNLQIQQNVIGESFRHN-VRKLLFLGSTCIYPRDAEQ
Q0P8I6_CAMJE          VFLTAVLPCG-AANVAQRADFIYENLMIQNNVIHNSFLNN-VKKLVFFGSGYMYPENAKN
Q8F5U0_LEPIN          VFLAAAKVGGIHANNTYPAEFIFSNIQIQNNVIDACYRFK-TKKLLFLGSSCIYPKFAKQ
H7C7D0_COXBU          VFLAAARVGGINDSNLHPVDFIRDNLAIQWNVIEASFRYK-VKRLLFLGSSCIYSNDAPR
E6VUG2_PSEA9          VIIAAGRSGGISFNRQRPATLIRDNLMVAANIIHAAHRHG-VQRLLFLASSCIYPRMSEQ
J9ZEA2_LEPFM          IILAAGRVGGIIENSTRGFDLLRDNLIIQQNVILSAIQSG-VEKCVYFGSSCMYPRQAEQ
A6VG32_METM7          LFMVAGLVGGIYGNMKRNADFLYQNSIMILNVLESIKNCSKDTKILYTGSTCIYPKENPQ
Q5V1W1_HALMA          VIHLAATVGGIGANRKNPGKYFYENAIMGIELIEQARQFG-VEKFTILGTICSYPKHTPV
Q2IHJ1_ANADE          VLHLAARVGGIGANRDNPGKFFYDNLMMGVQLIEVGRQVG-LKKLVALGTICAYPKFCPV
K9QYD1_NOSS7          VIHLAAHVGGIGLNREKPAELFYDNLMMGTQLIHAAHQSS-VEKFVCVGTICAYPKFTPV
P72585_SYNY3          VIHLAAHVGGIGLNREKPAELFYDNLMMGVQLIHAAHQAG-VKKFVCVGTICAYPKFTPV
B1XN91_SYNP2          VIHLAAHVGGIGLNREKPAELFYDNLMMGTQLIHSAYEAG-VEKFVCVGTICAYPKFTPV
Q8DL64_THEEB          VIHLAAHVGGIGLNQAKPAELFYDNLLMGAQLIDCAYRAG-VEKFVCVGTICAYPKFTPV
E8R300_ISOPI          LIHAAAFYGGIGINQTHPGSIYYTNLVMGANIMEAARLAK-VSKVVNIGTACSYPGYLEG
D5BSI5_PUNMI          VIHLAALSGGIGANTERPADFFFENSLLVTNVFQACGSLG-VKDMIYTMGGCSYPNSASS
B0T592_CAUSK          VIHLAAYSGGIGANRSWPADFYWRNITLVSNMYEAAAQTG-VKRIVYTMGGCSYPGTATS
Q0BHR7_BURCM          VFHMAARVYGIMGNMSNRGIAYLDNVRINTNVVEAARQTG-CKKFVAMGSTAIYSDQVRL
FCL_HUMAN             VIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVG-ARKVVSCLSTCIFPDKTTY
FCL_PONAB             VIHLAAMVGGLFRNIKYNLDFWRKNVHINDNVLHSAFEVG-ARKVVSCLSTCIFPDKTTY
FCL_MOUSE             VIHLAAMVGGLFRNIKYNLDFWRKNVHINDNVLHSAFEVG-ARKVVSCLSTCIFPDKTTY
FCL_DICDI             VIHLAARVGGLFSNMKYKVEFFRENIDINDNVLACCKEFN-VVKCVSCLSTCIFPDKTTY
FCL_DROME             VIHLAAMVGGLFHNMNNNLDFLRNNLLINDNVLQTAHEQG-CVKVVSCLSTCIFPDKTSY
S7UNW6_TOXGG          LIHLAARVGGLFDNTAHNLEFFQDNLRINDNVVRVAHLLQ-VRKAVFCLSTCIFPAHYAE
A0A024X7F5_PLAFC      IIHFAAHVGGLYANKNNNLDFLINNLEISMNVIKLCHKYS-ISRGIFTLSTCIFPVNCSL
                      :   *    *   .          *  :                         :.     

Q47WH1_COLP3          P---LSEELILKGELEPTNEGYALAKIASTRLCEYISHEEPELLYKTIIPCNLYGRHDKF
D1B3Y4_SULD5          P---LGEELILKGELEPTNEGYAIAKVTSTRLCEYINKENKEFHYKTIIPCNLYGRYDKF
E6S4E2_HELPF          P---LKESDLLNGSLEPTNEGYALAKLSVMKYCEYVSAE-KGVFYKTLVPCNLYGEFDKF
FCL_AZOC5             P---LKECDILRGPFEVTNEGYALAKTVGLKICEYIDKL-PNFNYKTLIACNLYGVGDNF
FCL_SINFN             P---IREEALLTGPLEPTNEWYAIAKIAGIKLCQAYRKQYGAN-FISAMPTNLYGPRDKF
A9CH50_AGRFC          P---ITENALLTGPLEPTNEAYAIAKIAALKLSQFYSIQYGLN-CVSVMPTNIYGLNDNF
Q7VEE9_PROMA          P---IREESLLTSSLESTNEWYALAKISGLKLCEALRTQHGFD-AITLMPTNLYGPGDNY
Q7UVN0_RHOBA          P---IQEDALLTSPLEETNEGYALAKIMGLKLCQYYRQQHGAL-FHSAMPTNLYGPGDNY
FCL_ECOLI             P---MAESELLQGTLEPTNEPYAIAKIAGIKLCESYNRQYGRD-YRSVMPTNLYGPHDNF
FCL2_ARATH            P---IPESALLTGPLEPTNEWYAIAKIAGIKMCQAYRLQHQWD-AISGMPTNLYGQNDNF
FCL1_ARATH            P---IPESALLTASLEPTNEWYAIAKIAGIKTCQAYRIQHGWD-AISGMPTNLYGPNDNF
FCL1_ORYSJ            P---IPENSLLSGPLEPTNEWYAVAKIAGIKMCQAYRIQHGFD-AISAMPTNLYGPQDNF
FCL2_ORYSJ            P---TPESALLTGPPAEGSEWYAIPKIAGIKMCQAVRAEYGLD-AIAAAPNNLYGPRHPF
P71791_MYCTU          P---IPESALLTGPLEPTNDAYAIAKIAGILAVQAVRRQHGLP-WISAMPTNLYGPGDNF
Q72FX3_DESVH          P---MKEEHLLTGELEPTNEWYAVAKIAGIKMCQAYRRQYGFN-AIAVMPTNLYGPGDNF
Q8A8E2_BACTN          P---MKEEVLLTSPLEYTNEPYAIAKIAGLKMCESFNLQYGTN-YIAVMPTNLYGPNDNF
Q0P8I6_CAMJE          P---LKEEYLFQGDLEYGAYSFGAAKIAGAIMCESYNIQYGTN-FITLVLNNLYGTKANF
Q8F5U0_LEPIN          P---MDESQLLDGKLEPTNEPYAVAKIAGIVMCQSYNRQYGTN-FISVMPTNLYGPGDNY
H7C7D0_COXBU          P---LKEIYFNSGKLEPTNRAYSTAKIAGIEHCWAYNRQYKTQ-YLCAMPTNLFGPNDNY
E6VUG2_PSEA9          P---IQEQALLTGPLEPTNQAYAVAKIAGVELCRAYRTEYGHD-FIPVAPTNYFGPGDDF
J9ZEA2_LEPFM          P---MKEDFLLTGKPEETSLPYAISKLSGVHMCLSYNKQFGKSLFLPVIPNSTYGPQDDF
A6VG32_METM7          P---ISENRLLNGLLEESNKGYALAKILGIVGCELYKKQYGIN-SICVMPTNMYGPNDTY
Q5V1W1_HALMA          P---FSERDLFEGYPEETNAPYGIAKKALLTQSRAYRKQYDFN-SIYLMPVNLYGPRDDF
Q2IHJ1_ANADE          P---FKEEDLWSGYPEETNAPYGLAKKMLLVQSEAYRQQYGFH-SVVLFPVNLYGPRDNF
K9QYD1_NOSS7          P---FKEDDLWNGYPEETNAPYGVAKKALLVQLQSYRQQYGFN-GIYLLPVNLYGPEDNF
P72585_SYNY3          P---FKEEDLWNGYPEETNAPYGVAKKALLVQLESYRLQYGFN-GIYLLPVNLYGPEDNF
B1XN91_SYNP2          P---FKEENLWAGYPEETNAPYGIAKKALLVQLEAYRLQYGFN-GIYLLPVNLYGPGDNF
Q8DL64_THEEB          P---FKESDLWNGYPEETNAPYGIAKKALLVQLQAYRQQYGFN-GIYLLPVNLYGPGDNF
E8R300_ISOPI          E---LKEEDLWAGPCHASVVNYGLTKKMLAVQGLAYRKQYGLD-SIHLILTNLYGPGDSY
D5BSI5_PUNMI          P---ISEGEMWEGMPQGNSSAYSVAKKMGIIAGQAYEKQYGLK-TKVLVPGNLYGKYDNY
B0T592_CAUSK          P---ISEDQMWEGYPQGDSAAYSAAKKMGIVAAKAYEAQHGIS-STVLVPGNLFGEFDNY
Q0BHR7_BURCM          P---MSEEQIWVGAPHHSEAPYAHSKRGMLAQLEAYKDQYGMD-YAFCVSTNLFGPHDKF
FCL_HUMAN             P---IDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCT-FTAVIPTNVFGPHDNF
FCL_PONAB             P---IDETMIHNGPPHSSNFGYSYVKRMIDVQNRAYFQQYGCT-FTAVIPTNVFGPHDNF
FCL_MOUSE             P---IDETMIHNGPPHSSNFGYSYAKRMIDVQNRAYFQQHGCT-FTAVIPTNVFGPYDNF
FCL_DICDI             P---IDETMIHNGPPHPSNEGYAYAKRMIDVLNRAYNEEYGCK-FTSVIPTNIYGPHDNY
FCL_DROME             P---IDETMVHNGPPHPSNYGYSYAKRLIDVQNHAYHDKYGRV-YTSVIPCNIFGPHDNY
S7UNW6_TOXGG          SGECLVEEHLHNGPPHPSNEGYSYAKRMLEVSVRLHRQRFGHQ-WRCVVPTNLYGPFDQF
A0A024X7F5_PLAFC      P---LTEEKIHDGKCHQSNEGYSVSKRVLEVLVRFYREKYNYE-WICIIPTNIYGKYDNF
                            *  .  .        :.  *                         . :*    :

Q47WH1_COLP3          SPHNSHMIPAVIRKVIDAKQK--------------------------------------D
D1B3Y4_SULD5          DPKHSHMLPAVIKKIHEAKMN--------------------------------------N
E6S4E2_HELPF          EEKIAHMIPGLIARMHTAKLK--------------------------------------N
FCL_AZOC5             DPRRSHLLPAIIEKIHKASQC--------------------------------------G
FCL_SINFN             DLNSSHVVPALIRKAHEAKIK--------------------------------------D
A9CH50_AGRFC          DPQSSHVIPAMIRRMHEAKIS--------------------------------------G
Q7VEE9_PROMA          HPENSHVLPAMIRRFHEANEQ--------------------------------------G
Q7UVN0_RHOBA          HPDNSHVIPGLIRRFDDAAKE--------------------------------------N
FCL_ECOLI             HPSNSHVIPALLRRFHEATAQ--------------------------------------N
FCL2_ARATH            HPENSHVLPALMRRFHEAKAN--------------------------------------N
FCL1_ARATH            HPENSHVLPALMRRFHEAKVN--------------------------------------G
FCL1_ORYSJ            HPENSHVLPALIRRFHEAKAS--------------------------------------N
FCL2_ORYSJ            PPEHSHVIPALIRRFHRAKLE--------------------------------------G
P71791_MYCTU          SPSGSHLLPALIRRYDEAKAS--------------------------------------G
Q72FX3_DESVH          DLSGSHVLPALLRKFHEAKQA--------------------------------------G
Q8A8E2_BACTN          DLERSHVLPAMIRKIHLAHCLKEGDWEAVRKDMNQRPVEGVNGDSPKADILNILRKYGIS
Q0P8I6_CAMJE          DFGKSRVLPALLRKFHLAKLLSEGNITQILQDLKMNNFEEAK---------EYLHNFGIS
Q8F5U0_LEPIN          HPENSHVLPALIRRFYEAKIK--------------------------------------N
H7C7D0_COXBU          DLENGHVVASLISKIHQAKEQ--------------------------------------K
E6VUG2_PSEA9          SPENSHVVGALIRRMHEAREQ--------------------------------------A
J9ZEA2_LEPFM          DPKTAHVLSSLLFRFHHARKT--------------------------------------N
A6VG32_METM7          DLEDGHFIPSLIKKFVDAKNN--------------------------------------N
Q5V1W1_HALMA          DLETSHVIPAIIRKCVEANRR--------------------------------------G
Q2IHJ1_ANADE          DLRTSHVIPALVRKCVEARER--------------------------------------G
K9QYD1_NOSS7          DPGSSHVIPALIRKVHEAQIN--------------------------------------Q
P72585_SYNY3          DPRSSHVIPALIHKVYEAQKA--------------------------------------G
B1XN91_SYNP2          KPESSHVIPALIRKVYEAQRD--------------------------------------G
Q8DL64_THEEB          DPQSSHVIPALIRKVHTAQQQ--------------------------------------G
E8R300_ISOPI          NPERSHVVAALIRKFVEAEMH--------------------------------------K
D5BSI5_PUNMI          NLDNSHVIPALIRKFHEAKIS--------------------------------------N
B0T592_CAUSK          RNGESHVIPAFLRRFHEAKLN--------------------------------------G
Q0BHR7_BURCM          DEKFGHVIPSLVSKFYRASVL---------------------------------------
FCL_HUMAN             NIEDGHVLPGLIHKVHLAKS---------------------------------------S
FCL_PONAB             NIEDGHVLPGLIHKVHLAKS---------------------------------------S
FCL_MOUSE             NIEDGHVLPGLIHKVHLAKS---------------------------------------S
FCL_DICDI             HLTDGHVIPGLIHKTYLAMK---------------------------------------N
FCL_DROME             NPEVSHVIPGMIYRMHQLVTEKTDVPE--------------------------------N
S7UNW6_TOXGG          SLEKAHVLPALIYKAFLASQ---------------------------------------E
A0A024X7F5_PLAFC      NLENAHVIPSIIHKMYLAKV---------------------------------------N
                          .:.: ..: :                                              

Q47WH1_COLP3          LTEIDIWGDGKARREFMYAGDLADFIFYAIANFSRMPQ-------------NLNVGLGED
D1B3Y4_SULD5          EATLDIWGDGEARREFMYAEDLADFTYFALENFESIPQ-------------NINVGLGHD
E6S4E2_HELPF          EKEFVMWGDGTARREYLNAKDLARFISLAYENIASIPS-------------VMNVGSGVD
FCL_AZOC5             SESVSIWGDGTARREFMFAYDFAKIIIKALEVPELIPS-------------SMNVGVGKD
FCL_SINFN             LGCLSIWGSGTPTRDFLYSEDCSDALVFLLKHYS-ETE-------------HINIGSGGE
A9CH50_AGRFC          QNKIVLWGTGSPLREFLHVDDLADACCFLMKSSA-HFP-------------LINIGSGRE
Q7VEE9_PROMA          VSSIKCWGTGDPYREFLHVDDLGDACVFALENWD-PSSSQAPSDSYGNPLYFLNVGTGID
Q7UVN0_RHOBA          ANSVTVWGSGKPRREFLHVDDLAAAVEHLLQLEN-PPD-------------WVNVGTGVD
FCL_ECOLI             APDVVVWGSGTPMREFLHVDDMAAASIHVMELAH-EVWLENTQPM----LSHINVGTGVD
FCL2_ARATH            ADEVVVWGSGSPLREFLHVDDLADACVFLMDQYS-GFE-------------HVNVGSGVE
FCL1_ARATH            AEEVVVWGTGSPLREFLHVDDLADACVFLLDRYS-GLE-------------HVNIGSGQE
FCL1_ORYSJ            AAEVVVWGTGSPLREFLHVDDLADAVIFLMDHYS-GLE-------------HVNVGSGSE
FCL2_ORYSJ            AGEVAVWGSGAAAREFTHVDDLAEAVVVLMERYS-GEE-------------HVNVGSGEE
P71791_MYCTU          APNVTNWGTGTPRRELLHVDDLASACLYLLEHFD-GPT-------------HVNVGTGID
Q72FX3_DESVH          EPEVVVWGTGTPRREFLHVDDMADACVHLMEVYE-GEN-------------IVNVGVGED
Q8A8E2_BACTN          ETEVTLWGTGTPLREFLWSEEMADASVFVMEHVD--FKDTYKEGDKDIRNCHINIGTGKE
Q0P8I6_CAMJE          KKSVEIWGTGKVRREFIHSDDLADVAIYTMQNID--FKDLIK--DRKSKNTHINIGTGID
Q8F5U0_LEPIN          LPEVVVWGTGKPLREFLYSDDMGHACVFLMKNYD--VTGDPK------GGEHVNVGSGIE
H7C7D0_COXBU          KPNFVLWGSGKAKREFLYSDDLAEACCHLMNLPDDIVKSVFG---QDDQPPIVNIGSGKE
E6VUG2_PSEA9          LPFIEIWGTGQARREFMYTRDLGRACVFVLDKYQGHD--------------LINIGTGFS
J9ZEA2_LEPFM          ASEVTLWGSGNPRREFIFSEDVASAVFYLLENAPATDM-------------PLNIGSGKD
A6VG32_METM7          LKELTFWGTGIPRREALYVDDCADACIYLMDNYNSPD--------------IINIGTGFD
Q5V1W1_HALMA          ENAITAWGTGEPTREFLYVKDAADGILTATERYDESD--------------PINLGSGIE
Q2IHJ1_ANADE          DGQIVVWGDGSASREFLHARDAAEGILDAAERYDKSE--------------AVNLGAGFE
K9QYD1_NOSS7          DKELPVWGDGSPTREFLYSEDAARGIVMGTQFYNDSE--------------PVNLGTGYE
P72585_SYNY3          QKQLPVWGDGSPTREFLYSTDAARGIVMGTQAYDKAD--------------PVNLGTNFE
B1XN91_SYNP2          VKQLKVWGDGSPTREFLHATDAAQGIVLATQKYNEAA--------------PINLGTNTE
Q8DL64_THEEB          DPRIAVWGDGTPSREFLYVEEAARGIVMATQAYDHPD--------------PVNLGTGEE
E8R300_ISOPI          ADSVEVWGTGQPIREFIEVGDCAEGILLAAERYDDPEL-------------PLNIGTGVG
D5BSI5_PUNMI          SPKVNLWGTGSPIRDFVYAEDVASIIVDLIDFKHIET--------------PMNLSSGNG
B0T592_CAUSK          VTEVTCWGRGIAQRDFVYAEDVAKAIPQFLDRTDVPG--------------PVNLSHGAT
Q0BHR7_BURCM          GQPISVWGSGKAERDFLFSGDAAYALRLIAENHT----------------GAINLATGQS
FCL_HUMAN             GSALTVWGTGNPRRQFIYSLDLAQLFIWVLRE----------YNEVEPIILSVGEE--DE
FCL_PONAB             GSALTVWGTGKPRRQFIYSLDLAQLFIWVLRE----------YNEVEPIILSVGED--DE
FCL_MOUSE             DSALTVWGTGKPRRQFIYSLDLARLFIWVLRE----------YSEVEPIILSVGEE--DE
FCL_DICDI             NQDLTIMGTGKPLRQFIYSYDLAKYFVWTLNN----------YEEMSPLILSVGEE--DE
FCL_DROME             DKVFTVFGSGMPLRQFVYSRDLAELMIWVLRN----------YESVEPIILSADEV--QE
S7UNW6_TOXGG          NNSLVVGGTGSPLRQFLYSEDAAEILLRVLEAP-------ALSEEESLMILASDADSSEG
A0A024X7F5_PLAFC      NTNVYLLGDGSAVRQFIYNIDVNKILYYILNHYYSKNL-TIIKDNIYNIIFSTNLPS-NE
                         .   * *   *:     :                                .      

Q47WH1_COLP3          FTINDYYQRIAEIIGFSGTFKHDLTKPVGMKQKLIDDNKLNAFG-WSYK-TDLTEGLKNT
D1B3Y4_SULD5          YTINEYYKVIAEVIGFEGEFVHDLSQPVGMKQKLIDDTKLKNFG-WKYK-ISLKDGIKKT
E6S4E2_HELPF          YSIEEYYKKVAQVLDYKGAFVKDLSKPVGMQQKLMDISKQKALK-WELE-IPLEQGIKEA
FCL_AZOC5             LSVLEYYSLVARVIGWSGEFVYDLNRPVGMRSKLMDITHLTALG-WVPE-RSLEGGIRST
FCL_SINFN             ISIIELAHIVCRVVGFKGDIVFDTSKPDGTPRKLLSSERLVSMG-WRPK-TSLELGLAKS
A9CH50_AGRFC          ISIRNLAHLIAGIVGYEGQIVFDTSKPDGAPRKLLDCSRLNALG-WNST-VELRYGIQDL
Q7VEE9_PROMA          IKIRDLASTIAKIVGYKGEIIWDKSKPDGTPKKQLDVSRLLQLG-WKST-ISFEDGLKNT
Q7UVN0_RHOBA          LTIADLARKIADATGFEGQIVQDASKPDGTPVKCTDISRIRSTG-WQPT-IRLDDGLTQT
FCL_ECOLI             CTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVTRLHQLG-WYHE-ISLEAGLAST
FCL2_ARATH            VTIKELAELVKEVVGFKGKLVWDTTKPDGTPRKLMDSSKLASLG-WTPK-ISLKDGLSQT
FCL1_ARATH            VTIRELAELVKEVVGFEGKLGWDCTKPDGTPRKLMDSSKLASLG-WTPK-VSLRDGLSQT
FCL1_ORYSJ            VTIKELAELVKEVVGFQGKLVWDSSKPDGTPRKLMDSSKIQEMG-WKPK-VPLKEGLVET
FCL2_ORYSJ            VTVRELAEAVRGVVGYEGVVAWDAARPEGVARRVVDSGRMRKLG-WEPR-VALRDGIQDL
P71791_MYCTU          HTIGEIAEMVASAVGYSGETRWDPSKPDGTPRKLLDVSVLREAG-WRPS-IALRDGIEAT
Q72FX3_DESVH          VTIAELAGLVGQVVGYTGRIVYDASKPDGTPRKLLDVTRLAATG-WRAH-IGLAEGITST
Q8A8E2_BACTN          ITIRQLAERIVETVGYQGKLTFDSSKPDGTMRKLTDPSKLHSLG-WHHK-IEIEEGVRRM
Q0P8I6_CAMJE          YSIKEVALMVKNIVGFSGELVFNTSRPDSTMDRLMDCSKIHSLG-WKHK-IELKDGIKMM
Q8F5U0_LEPIN          VSIRELAETIKEVVGYQGLLTFDLTKPDGTPRKLLDVSKLHKMG-WKHQ-VELKEGIRLA
H7C7D0_COXBU          ISIYELALLIQDIIGYQGDIIWDHSKPDGALTKVMDVSLMQYLG-WSAR-EGLVSGIKKT
E6VUG2_PSEA9          LSIGELAEIIRDIVGYRGELRYDASKPDGMPVKELDGSVLRGLG-FAEA-TPFRDALAAT
J9ZEA2_LEPFM          YSIRELAEAIKDITGFRGSIKWDTSKPDGAPRKLLDSSRINALG-WKPV-TSLKNGIQKT
A6VG32_METM7          YSIKEYIEIMKKVLDFDVEINWDLSKPDGVFEKRTDISKLKEIM-PEFNPRSFEDGVKEV
Q5V1W1_HALMA          TSIQDLVEKIADLTGFEGEIEWDTSKPDGQPRRKLDTSQAKERF-DWEATTSFEDGLERT
Q2IHJ1_ANADE          IKIRDLVPLVARLCRFEGELVWDTTKPNGQPRRMLDTSKALREF-GWKARIGFEDGLRET
K9QYD1_NOSS7          ISIRDLVTLICELMEFDGEIVWQTDQPNGQPRRCLDTERAKTAF-NFTAQVEFKQGLKNT
P72585_SYNY3          ISIKDLTELICELMEFEGDIIWETDQPNGQPRRCLDTTKAKAEF-GFEAQVSLREGLKNT
B1XN91_SYNP2          ISIKDLVELICELMAFDGEIIWEADKPNGQPRRCLDTQKAKEKF-GFEAAIGLRQGLQET
Q8DL64_THEEB          ITIQNLVALICELMGFQGQIEWQTDKPNGQPRRCLDTTKAREAF-GFRAQISLKEGLKRT
E8R300_ISOPI          TSIRQLTELIHELSGFKGRVVWNADKPDGAAKKVLDITRMTHVLDGWTPPTSLREGLART
D5BSI5_PUNMI          ISIKELSELVASVVDYKGVLEWDTSKPDGQKEKVFDVALMESWG--FKCDTNLMQGLRKS
B0T592_CAUSK          TTIRELAETVADVVGLKAEIKWDHDKPEGQLIKIFDVKRMREMG--IDCPTGLREGLVKT
Q0BHR7_BURCM          HTIRHTVDTLCQISGFSGSVEWDATKPDGQKLRAYDISRLTALG--FKPRFSFDEALAIT
FCL_HUMAN             VSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYL-PDFRFTPFKQAVKET
FCL_PONAB             VSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYL-PDFRFTPFKQAVKET
FCL_MOUSE             VSIKEAAEAVVEAMDFNGEVTFDSTKSDGQYKKTASNGKLRSYL-PDFRFTPFKQAVKET
FCL_DICDI             ISIADVARLITEAMEFKGKLIFDTSKADGQYKKTASNLKLKSLV-PDLTFTPIQQAIKES
FCL_DROME             VTIFEVAQAVAKAFNFNGRLVCDTSKSDGQYKKTASNAKLRSFL-PDYAFTDLETAINAS
S7UNW6_TOXGG          TSIAYIAQRIADAFHLSKPLEFDRSRPDGIYRKPVSTARLRRFLGPDFRFLSLEEGIQRT
A0A024X7F5_PLAFC      LSIKELADKIKYYLKFNNKILFDTTKDNGIHKKTSSNDTLMKLLDNSFTFTELDNGLF--
                       .:      :            :  :  .   :  .                :  .:   

Q47WH1_COLP3          VQFFLSEQNLSEQAND-------
D1B3Y4_SULD5          YEYYLKEV-LNDK----------
E6S4E2_HELPF          YEYYLKLLEV-------------
FCL_AZOC5             YQYYITGNEVYE-----------
FCL_SINFN             YE------SFVSNVADN------
A9CH50_AGRFC          YEWWRHPKSLQSDMLRQAAR---
Q7VEE9_PROMA          IQHFRDELKQNKVRI--------
Q7UVN0_RHOBA          VADYHHRIQSGEVRSV-------
FCL_ECOLI             YQWFLE--NQDRFRG--------
FCL2_ARATH            YEWYLENVVQKKQ----------
FCL1_ARATH            YDWYLKNVCNR------------
FCL1_ORYSJ            YKWYVENVISAKK----------
FCL2_ORYSJ            YRFYLRHECGGQAHHA-------
P71791_MYCTU          VAWYREHAGTVRQ----------
Q72FX3_DESVH          YAWYLEHLGGRASAGGQTVHGGA
Q8A8E2_BACTN          YEWYLK-----------------
Q0P8I6_CAMJE          YEWYKTQN---------------
Q8F5U0_LEPIN          FEDYKTVI---------------
H7C7D0_COXBU          YQYYLSYERQAIAIEGIEKNA--
E6VUG2_PSEA9          YQWFIQNKAK-------------
J9ZEA2_LEPFM          YDWFLENELPIQKGSSS------
A6VG32_METM7          LNDDF------------------
Q5V1W1_HALMA          IEWFEKSFEK-------------
Q2IHJ1_ANADE          VEWFEANRGSIP-----------
K9QYD1_NOSS7          IDWYRQNAA--------------
P72585_SYNY3          IDWYRQQRS--------------
B1XN91_SYNP2          IDWYCQNPE--------------
Q8DL64_THEEB          ICWYRQHATSL------------
E8R300_ISOPI          IAWYRAHKAQADAKW--------
D5BSI5_PUNMI          YDWFSTNYEVEG-AIRL------
B0T592_CAUSK          YAWFQENYAEAGDGLRL------
Q0BHR7_BURCM          YDWYCKNVASARK----------
FCL_HUMAN             CAWFTDNYEQARK----------
FCL_PONAB             CAWFTDNYEQARK----------
FCL_MOUSE             CTWFTDNYEQARK----------
FCL_DICDI             CQWFIDNYETARK----------
FCL_DROME             VKWYIENYDQARK----------
S7UNW6_TOXGG          VQWFVQNNKSART----------
A0A024X7F5_PLAFC      -----------------------