CLUSTAL format seed alignment for MF_00962

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

FLIA_PSEAE            ------------------------------MTAASGVRMYSKAQAQNSQEQLIQRYAPLV
A0A379IWM2_PSEME      --------------------------------------MYNKAQAQDSQHQLIERYAPLV
Q88EW1_PSEPK          -------------------------------MNASGFKMYSRA-AKDAQYELIERYAPLV
A0A1G3DFS0_9GAMM      -------------------------------------MYYSKAQAKDAQYRLIDQYAPLV
Q2SBX5_HAHCH          MVAAPDISSNTHENVFVEIIRFIAGLARKFMSLANTYMMYSETRAERAD-TLVRQYAPLV
Q21IQ5_SACD2          ----------------------------MAVSVAENLMVYEKPKEGDQE-IKVEDYAYLV
A6W0V2_MARMS          ------------------------------MQTKNGYNTYSKKATLSID-AIVEQYGYLV
B1KLJ6_SHEWM          ---------------------------------MSKTAAYTCLDNKAS---IVEQYAPLV
Q7M7J2_VIBVY          --------------------------------MVNKALTYDQHANVNSQKLFIERYSVLV
Q5ZUL1_LEGPH          ----------MYSVCFRFTKLLITTICCYCKESIVDALAAYSKVNQQTQEALVKTHATLV
Q31HN0_HYDCU          --------------------------------MTGTEAYANVHKQTSGAAINIEAFLPLV
D3RRB4_ALLVD          ------------------------------MVRARSRM-GYAS-AGDEAARLVSEHVDLV
D3S9H9_THISK          ------------------------------MMSPRNRLPGYESVAATGHEQRVAEHIELV
Q0A9Z9_ALKEH          ----------------------------------MNGHAMYAEVAAQHDNDLLVQHASLV
I1XMV3_METNJ          --------------------------------------MYSSQISELTQHQLIEQHGGLV
Q8P9F9_XANCP          ----------------------------MSTATATTATAQYRAVQRNNANDVVTQHADLV
H8L3F7_FRAAD          -------------------------------MVKSYASAEYSAAQKMPADELVRQYAPLV
K0C4V7_CYCSP          ----------------------------------MNGIAMYTNLQAKTAGELVATHAPLV
G4T379_META2          ----------------------------------MKGAAMYASVQSGEKEDLVLRHVPLV
D0KYP3_HALNC          ----------------------------------MNVRAMYTDVQRGGAEAVVAEHAGLV
FLIA_ECOLI            ---------------------------------MNSLYTAEGVMDK---HSLWQRYVPLV
FLIA_ECOL6            ---------------------------------MNSLYTAEGVMDK---HSLWQRYVPLV
FLIA_ECO57            ---------------------------------MNSLYTAEGVMDK---HSLWQRYVPLV
FLIA_SALTY            ---------------------------------MNSLYTAEGVMDK---HSLWQRYVPLV
FLIA_SALTI            ---------------------------------MNSLYTAEGVMDK---HSLWQRYVPLV
FLIA_YEREN            -------------------------------------------MDK---NSLWQRYVPLV
S4YQ54_SERPL          ---------------------------------MSDLYTAEGVMDK---NSLWLRYVPLV
D2BX34_DICZ5          ---------------------------------MSELYTAEGTMDK---NSLWKRYVPLV
D8MTK9_ERWBE          ---------------------------------MNDLYTADGVMDK---NSLWQRYVPLV
D3VC82_XENNA          ---------------------------------MSDLYTAEGVMDK---NSLWKRYVPLV
C5BA92_EDWI9          ---------------------------------MTDLYTAEGVIDK---NTLWQRYAPLV
A0A0H3DVQ4_EDWTF      ------------------------------------MYTAEGVIDK---NTLWQRYAPLV
D4HYX8_ERWAC          ---------------------------------MSGIYTPGGIEDK---TILWGKYNHIV
E3DC65_ERWSE          ---------------------------------MSGIYTPGGIEDK---TILWGKYNHIV
Q8D302_WIGBR          -------------------------------MNANTMYSHQGYLLKKDDNFLWKKYTPMI
Q2NWZ1_SODGM          ---------------------------------MDVIYNHQGRLA--DDRGLWQQYAPII
E1VBQ8_HALED          ------------------------------------MYTAQGKIEQ---GDLLEEYLPLV
F8GP67_CUPNN          ------------------------------------MYTIQGKLEQ---ADVVKAHAQLV
G0AII3_COLFT          ------------------------------------MYTAQGKIDK---SDTLAQYAPLV
E3HSA4_ACHXA          ---------------------------------MDPPDIPAMPHAD---DSLV-EYAPLV
F4GQ14_PUSST          -----------------------------------------MPSTE---DQLVGQYAPLV
Q47I32_DECAR          ------------------------------------MYTAAGQPDR---EQLVQRFVPLV
C4KAV7_THASP          ------------------------------------MYDAHGKLDK---GGLVENYAPLV
B2UHX2_RALPJ          -------------------------MNEASKAGMD-MYTATGRKTK---SDEMATYAPLV
D5CMW3_SIDLE          -------------------------MRIVGNLKMKAMYTPNGLSDK---EECLKEYAPLV
Q21S43_RHOFT          ------------------------------------MYTAKGQLDR---NAMIRQYQPLV
A1WGF0_VEREI          ------------------------------------MYTAKGQLDR---DALLRQHVPLV
Q7NZA0_CHRVO          ----------------------------MTFPSFRRSGYAAAAPSV---EIDVEAYAPLV
G2IYC1_PSEUL          ----------------------------MTLPSLKCRAYSSRALHG---DIDVELHAPLV
                                                                             .  ::

FLIA_PSEAE            KRIAYHLLGRLPASVQVEDLMQAGMIGLLEAAKKYDAGKGASFETYAGIRIRGAMLDEVR
A0A379IWM2_PSEME      KRIAYHLLARLPASVQVDDLIQAGMIGLLEASRKYDSGKGASFETFAGIRIRGSMLDEVR
Q88EW1_PSEPK          KRIAYHLLARLPANVQVEDLIQAGMIGLLEVANKYDASKGASFETYAGIRIRGAMLDEVR
A0A1G3DFS0_9GAMM      KRIAYHLLARLPASVQVDDLIQAGMIGLLEAAKKYDAGKGASFETYAGIRIRGTMLDEVR
Q2SBX5_HAHCH          KRIAHHLIARLPASVQVEDLIQAGMIGLLEAAQKYDAGKGAKFETYAGIRIRGAMVDEIR
Q21IQ5_SACD2          KRIAHHMMARMPSCVQIEDLIQAGMLGLLEAAQKYDASKGASFETYSGIRIRGAIVDEMR
A6W0V2_MARMS          KKIAYHLLARLPDSVDVDDLIQAGMMGLIEAYKRFESTKGASFETYAGIRIRGSIMDEVR
B1KLJ6_SHEWM          KKIAHHLLARLPASVQIDDLLQAGMMGLLEASTNFDGSKGAKFETFAGIRIRGSMLDEIR
Q7M7J2_VIBVY          KRIAHHLLGRLPPSVQVEDLIQAGMIGLIEAQQNYDASKGASFETYAGIRIRGAMLDDIR
Q5ZUL1_LEGPH          KRIAHHLLGRLPQSVQLDDLIQSGMLGLLEAARHYDSSKGASFETYAGIRIRGHMLDEVR
Q31HN0_HYDCU          KRIAYHLKGRLPDSVMVDDLIQSGIIGLIESSQKFDATQGASFETYAGIRIRGAMLDEIR
D3RRB4_ALLVD          RRIAHHLVARLPASVQVEDLIQSGMVGLIEAARQFQTGQGATFATYAGIRVRGAMIDELR
D3S9H9_THISK          HRIAHHLMARLPSSVQVDDLIQAGMIGLLEAARQFEGGQGATFATYAGIRIRGAMIDELR
Q0A9Z9_ALKEH          KRIAHHLAGRLPPSVQLDDLIQAGMVGLLEAARQFDPGQGASFQTYAGIRIRGAMLDEIR
I1XMV3_METNJ          KRIAYHLVARLPHTVEVNDLIQAGMIGLLDASHQYKASQGASFETYAGIRIRGAMLDEIR
Q8P9F9_XANCP          RRIAHHLAARLPASVEVDDLIQAGMIGLIEASRSYDSDQGASFETYASIRIRGSMIDEIR
H8L3F7_FRAAD          RRIAYHLRGRLPASIDTGDLIQAGMIGLLEAARHYVAGREASFETFAGIRIRGAMIDELR
K0C4V7_CYCSP          KRIAYHLLAKLPDTVLVEDLIQAGMIGLLEASNNYKDNYGASFATYAGIRIRGAMLDDVR
G4T379_META2          KRIAYHLLAKLPETVLVEDLIQSGMIGLLDAIKHFDASQGASFDTYAGIRIRGAMLDEVR
D0KYP3_HALNC          KRIAFHLMNRLPDHIQAEDLIQAGMIGLLEASNHYDAAQGASFETYAGIRIRGAMLDEVR
FLIA_ECOLI            RHEALRLQVRLPASVELDDLLQAGGIGLLNAVERYDALQGTAFTTYAVQRIRGAMLDELR
FLIA_ECOL6            RHEALRLQVRLPASVELDDLLQAGGIGLLNAVERYDALQGTAFTTYAVQRIRGAMLDELR
FLIA_ECO57            RHEALRLQVRLPASVELDDLLQAGGIGLLNAVERYDALQGTAFTTYAVQRIRGAMLDELR
FLIA_SALTY            RHEALRLQVRLPASVELDDLLQAGGIGLLNAVDRYDALQGTAFTTYAVQRIRGAMLDELR
FLIA_SALTI            RHEALRLQVRLPASVELDDLLQAGGIGLLNAVDRYDALQGTAFTTYAVQRIRGAMLDELR
FLIA_YEREN            RHEALRLQVRLPASVELDDLLQAGGIGLLNAVERYDRLQGTAFTTYAVQRIRGAMLDELR
S4YQ54_SERPL          RHEALRLQVRLPASVELDDLLQAGGIGLLNAVERYDALQGTAFTTYAVQRIRGAMLDELR
D2BX34_DICZ5          RHEALRLQVRLPASVELDDLLQAGGIGLLSAVERYDSLQGTAFTTYAVQRIRGAMLDELR
D8MTK9_ERWBE          RHEALRLQVRLPASVELDDLLQAGGIGLLNAVERYDALQGTAFTTYAVQRIRGAMLDELR
D3VC82_XENNA          RHEALRLQVRLPASVELDDLLQAGGIGLLNAVERFDSMQGTAFTTYAVQRIRGAMLDELR
C5BA92_EDWI9          RHEALRLQVRLPASVELDDLLQAGGIGLLHAVERYDAMQGTAFTTYAIQRIRGAMLDELR
A0A0H3DVQ4_EDWTF      RHEALRLQVRLPASVELDDLLQAGGIGLLHAVERYDAMQGTAFTTYAIQRIRGAMLDELR
D4HYX8_ERWAC          RQEALRLQKRLPASVELDDLIQAGSLGFLSAIDHFDPTKGVTLSAFLAQRIRWALMDELR
E3DC65_ERWSE          RQEALRLQKRLPASVELDDLIQAGSLGFLSAIDHFDPTKGVTLSAFLAQRIRWALMDELR
Q8D302_WIGBR          RREALRLQVKLPGSVELDDLIQAGMIGFLSAIDNFDINQGASFPTYARSRVRWSMLDELR
Q2NWZ1_SODGM          RHEALRLQVRLPASVELEDLIQAGMIGLLAAIDSFDAAQGASFTTYARSRIRWGMLDELR
E1VBQ8_HALED          RRQALALQVRLPASIELDDLIQAGTVGLLEALGRFDAAQGASFSTFASQRIRGAMLDELR
F8GP67_CUPNN          RRIALQLAARLPASVQIDDLIQAGMIGLLDAAKRYEDTHGARFETYASQRIRGAMLDEVR
G0AII3_COLFT          RRLALQLIAKLPASVELDDMIQAGMLGLLDAANRYQDDQGAQFETYASQRIRGAMLDELR
E3HSA4_ACHXA          RKLALQLLARLPASVELDDLIQAGMIGLLDAVRRYQETADAQFETYATTRIRGAMLDELR
F4GQ14_PUSST          RRLALQLVAKLPASVEVDDLMQAGMMGLLDAIRRYQQTADAQFETYAVTRIRGAMLDELR
Q47I32_DECAR          KRIAYHLMARLPPSVQFDDLVQNGMIGLLDAIDRFQEGFGAQFETYATQRIRGAMLDGLR
C4KAV7_THASP          KRIAYQLMSRLPASVDVDDLIQNGMMGLLDALGRYEQGLGAQFETYAVQRIRGAMLDGLR
B2UHX2_RALPJ          RRIANQMMVKLPASVELDDLIQAGMMGLLDALSRYEETQGVQFEFYAAQRIRGAILDELR
D5CMW3_SIDLE          KRIAHHMMLKLPGSVEVDDLIQAGMMGLLDAASRYDELRGAQFETYAAQRIRGAMLDELR
Q21S43_RHOFT          RRLAHHMMAKLPANVEVDDLIQVGLIGLSEALTRYEAAQGVQFETFATQRIRGAMLDELR
A1WGF0_VEREI          RKIAHHMIAKLPANVELDDLIQVGMMGLADALSRYQVAQGVQFETFASQRIRGAMLDQLR
Q7NZA0_CHRVO          RKLASIMIARLPASVELGDLVQVGMIGLIEAARQFDPAQGVQFETFASQRIRGAMLDELR
G2IYC1_PSEUL          KKIAKLLIARLPASVELDDLVQVGIIGLIEAARQFDPTQGVQFETFASQRIRGAMLDELR
                      :: *  :  ::*  :   *::* * :*:      :     . :  :   *:*  ::* :*

FLIA_PSEAE            KGDWAPRSVHRNTRMVTDAIRAIEARTGRDAKDHEVAAELQLSLEDYYGILSDTQGSRLY
A0A379IWM2_PSEME      KGDWAPRSVHRNSRMVSDAIRTVEARTGRDAKDHEVAAELQLSLEDYYGILGDTLGSRLF
Q88EW1_PSEPK          KGDWAPRSVHRNTRMVSDAMRAVEARTGRDAKDHEVAAELQLSLDDYYGILNDTLGSRLF
A0A1G3DFS0_9GAMM      KGDWAPRSVHRNSRMVSEAIRAIEAKTGRDAKDHEVAAELKLSLDEYYAILGDTLGSRLF
Q2SBX5_HAHCH          KGDWVPRSVHRNARNIAEAIHTIEARTGRDASDAEVAAELGVPLEQYHASLRDASSGKLF
Q21IQ5_SACD2          RGDWAPRSVHRNSRRVAEAIATVEARHGRDARDHEIAEEMGLSLDEYYAMARDSASTRLF
A6W0V2_MARMS          KTDWAPRSVRRNGRAVATAIKELEAKLGREVSDMEVASHMNISMDEYHEMIHSSMSTQLF
B1KLJ6_SHEWM          RGDWVPRSVHRNQRRVAQVIDELEQELGRDAKDTEIAQRLDISLNEYHHILNDVSVGKVV
Q7M7J2_VIBVY          RGDWVPRSVHKSNREISQAIAELEGLLNRDPTDAEVAKHMGLSLEQYHGALTDINCSRLI
Q5ZUL1_LEGPH          RNDWVPRSVYRNSRMISDAVRILEHKLGREAKDNEIAEELGVSLDDYHDMLQDSISSHLY
Q31HN0_HYDCU          KGDWTPRSVYRKSREVSEAILKVESEKGREARDEEIAEVMGVSLDEYYHILQDTNSAQLL
D3RRB4_ALLVD          RADWTPRSVHRNSRRIAEAIHQVESREGRAASDREIAETLGVTLDDYHGMLQDTASCQIL
D3S9H9_THISK          RSDWTPRSVHRNSRKIAEAIQTVEAREGRAARGVEVAEELEVPIDEYYSMLQDHAGAHLF
Q0A9Z9_ALKEH          RLDWTPRSVHRKGRSVAEAIRAVEHRTGRDARDHEVAQELGITLDEYHQILQDVSTSRIF
I1XMV3_METNJ          RNDWAPRSVHRKAREIAEVMHQLEQQLGRSPMDLEVADALEMTLDQYHQQLQDASGHQVF
Q8P9F9_XANCP          RGDWVPRSVHRRARDAAAAVRKIEQNTGRAAAATEVAAAMEMPLPDYLRLMEDAARGQVL
H8L3F7_FRAAD          KTDWTPRSVHRKLREMALAIQQIENETGGDAGDQAIMQRMGIDPAEYAKLLVDATSTRVL
K0C4V7_CYCSP          RTDWTPRSVHRKARQITEAMRRIEQQTGRDARDTEIAALLDITIEEYHKILQDSTCCRLF
G4T379_META2          RSDWTPRSVHKKARMVSDAIRHIESKTGRDANDGEVAEYLGISADEYGRILQDTQCCRTL
D0KYP3_HALNC          RNDWAPRSVHRRHREISQAVHEIETRTGCEAKDADVCALLGISLDDYYEALNDSVQVRLA
FLIA_ECOLI            SRDWVPRSVRRNAREVAQAIGQLEQELGRNATETEVAERLGIDIADYRQMLLDTNNSQLF
FLIA_ECOL6            SRDWVPRSVRRNAREVAQAIGQLEQELGRNATETEVAERLGIDIADYRQMLLDTNNSQLF
FLIA_ECO57            SRDWVPRSVRRNAREVAQAIGQLEQELGRNATETEVAERLGIDIADYRQMLLDTNNSQLF
FLIA_SALTY            SRDWVPRSVRRNAREVAQAMGQLEQELGRNATETEVAERLGIPVAEYRQMLLDTNNSQLF
FLIA_SALTI            SRDWVPRSVRRNAREVAQAMGQLEQELGRNATETEVAERLGIPVAEYRQMLLDTNNSQLF
FLIA_YEREN            SRDWAPRSVRRNAREVASAMQKVEQRLGRPATEQEVAQNLDIDLTEYRQILLDTNNSQLF
S4YQ54_SERPL          SRDWVPRSVRRHAREVAQVMRQLEQRLGRPASEVEVAQTLNIPLDEYRQILLDTNNSQLF
D2BX34_DICZ5          SRDWAPRSVRRNAREVAQAMQQAEQSLGRAPTEQEVAQTLNISLEEYRQILLDTNNSQLF
D8MTK9_ERWBE          SRDWAPRSVRRNAREVAGAMHKVEQSLGRTATEQEVAASLDVSLQEYRQILLDTNNSQLF
D3VC82_XENNA          SRDWAPRSVRRNAREVTQTIRKLEQELGRPASEQEVAKELKINLIEYRQILLDTNNSQLF
C5BA92_EDWI9          SRDWVPRSVRRNARGVSAAMQRAEQRLGRVPGDSEIAQEMGISLAEYQQILLDTNTSQLF
A0A0H3DVQ4_EDWTF      SRDWVPRSVRRNARGVSAAMQRAEQRLGRTPGDSEIAQEMGIPLEEYQQILLDTNTSQLF
D4HYX8_ERWAC          ERDWVPRRVRKHAREMTAVIQQLEQNKGGEASEADIATEMGVSVCELQQMLADTNSSQIY
E3DC65_ERWSE          ERDWVPRRVRKHAREVTAVIQQLEQNKGGEASEADIATEMGVSVGELQQMLADTNSSQIY
Q8D302_WIGBR          ERDWVPRSVRRNARDIASAIQRLEQRLGSSASEKQIAKELKISLCEYQKMLQETNCGQIF
Q2NWZ1_SODGM          ERDWVPRSVRRNAREIAAAIQRLEQRLGANTSEQQIADELGVSLTAYQTMLHETNCSQLF
E1VBQ8_HALED          SRDWLPRSVRRGARAADEAVRRLEQSLGRPPEEAEIAEALDMDIDAYRRLLSDTNSGQLL
F8GP67_CUPNN          ANDWQSRSLRQFTRRIERTQRGLEQKLGRAPVDSEVAEAMEMALDEYQLLLNEVYGCQLL
G0AII3_COLFT          ANDWLSRGLRQSSRKVDAAVQALEQKLARPPSEREIAQSMQLSLQDYQHLLQEIHGSQLV
E3HSA4_ACHXA          GQDWLPRSVRAKARKIEQAIQQLEQRLMRAPSEAEIAQQLDMPLGDYQSLLHDAQGVQIV
F4GQ14_PUSST          SQDWLPRSVRSKTRNIEQAIHTLTHRLLRAPAESEIAEEMGVPLPEYQQLLEEARGVQIL
Q47I32_DECAR          ENDWLPRNLRRELRRIETAINQLEHEHGRVPSEKELAEALGMSLADYQKTLQDARGHQLV
C4KAV7_THASP          ENDWLPRSLRRDMRRIEAAIHSLEQQNGRPPSESELAAALDLPLEDYQRMLQDARGHQLV
B2UHX2_RALPJ          GSDWLPRGLRRNARTIEQAIQKLQQQKGRAPTETEIAVALGMSLAEYQKQLVDLQGSQLL
D5CMW3_SIDLE          GADWLPRSLRRDMRRIETAVSRLQQQMGKTPNETEIARELGVSLHEYQQMLQEGRGAQLL
Q21S43_RHOFT          GNDWMSRGSRKSQKDIEQALRRLEHKLGRTPLESEIAADLGLSLVDYQTLLGKVRGTQLV
A1WGF0_VEREI          EGDWMSRSARKSQKEIEQAVHRLEQRLGRSPLESEIASEMGLHLASYQSLLGKVRGTQLV
Q7NZA0_CHRVO          REDWLPRQARRNSRQIEEAISKLEQRLGRAPLESEIAAEMGVELEQYQDMLGDCKGTTLL
G2IYC1_PSEUL          REDWLPRQARRHSKQIEDAIHQLEQREGRPPQESEIADFLGLPLAEYQTMLGECKGVSLQ
                        ** .*      :    .                :   : :          .       

FLIA_PSEAE            SFDDLLQDGE-----HG-LPEDTSLS----HNEPIHGLLDERFQAALADAIAKLPERERL
A0A379IWM2_PSEME      SFDDLLQDGE-----HGGLHEDAGHT----HLEPSRDLEDERFQAALADAIAGLPERERL
Q88EW1_PSEPK          SFDDLLQDGE-----HEGLHEDGASG----QVEPARGLEEERFQAALTEAIANLPERERL
A0A1G3DFS0_9GAMM      SFDDLLQEGE-----HGELQEDASST----HPEPFRDLEDERFQQALADAIGNLPEREKL
Q2SBX5_HAHCH          SLEELGFHGE-----GGSDDETLTA------DNPLSDIEQNAFLEKLSAAIDGLPEREKL
Q21IQ5_SACD2          SYEETYENDE-----SRFDEYEPSDG----LRGPSEQVHRNALYTDLVAAIGKLPERERL
A6W0V2_MARMS          SYEEML-DSD-----TNNLDSIESEV----ENAPYSLVEEGGFQNQLAKEIDDLPEREKL
B1KLJ6_SHEWM          GIEDLGVSLD-----VVGQAEERKD-------DTFESIADVEFHTALVEAIKLLPERDGL
Q7M7J2_VIBVY          GIEDLGVSDD-----VITSVEDSENN------TPFKGVADEYFRKALVESIKQLPEREAL
Q5ZUL1_LEGPH          GFDDLGVTDD-----VLFDHEGNGST------EPHRNVMRSDMMNRLTQVIDSLPRKERL
Q31HN0_HYDCU          SIDEPDHDEL-----AEDRMVGTIKT-------PITELVESDFQGALAEQINELPEKEKL
D3RRB4_ALLVD          GLEDLFGEDA-----DSDRFLPGAG------TAPTEQLEREQFAQALAEALADLPERERL
D3S9H9_THISK          ALDDLGGTDG-----DADRVIEGQE------ASPSRTIEAGEFREELAAALGDLPERERL
Q0A9Z9_ALKEH          SIDQEDPATG-----EP-HQLPGDH------PEPFAEITDEGFQRALAEAIRRLPEREQL
I1XMV3_METNJ          SLDDMTDNQL-----TDGDSFGSDD------VGPAEITENNNFERALAEAIDGLPERERL
Q8P9F9_XANCP          SLESRIEDH-------GELDTTAKG-----GPNPQQMMERGEFGRELGKAIGQLPEREQL
H8L3F7_FRAAD          SLNMSREDNE-----AEELQIPDEV-----TAEPVSQLESQRMLTDLGEAIAALPEREKL
K0C4V7_CYCSP          STDEMEGESD-----QVSTENI------------LENINEEDFRVALAGAISSLPEREQM
G4T379_META2          SVEELSEEGD-----AAFYDNQPL------KNDPLNRLSREKFNQALVESIRSLPEREQL
D0KYP3_HALNC          PLDAG-GEDH-----NETIDVADH------RDQPDQYLSHERFHEDLAEHISALPERERL
FLIA_ECOLI            SYDEWREE------HGDSIELVTDD---HQRENPLQQLLDSNLRQRVMEAIETLPEREKL
FLIA_ECOL6            SYDEWREE------HGDSIELVTDD---HQRENPLQQLLDSNLRQRVMEAIETLPEREKL
FLIA_ECO57            SYDEWREE------HGDSIELVTDD---HQRENPLQQLLDSNLRQRVMEAIETLPEREKL
FLIA_SALTY            SYDEWREE------HGDSIELVTEE---HQQENPLHQLLEGDLRQRVMDAIESLPEREQL
FLIA_SALTI            SYDEWREE------HGDSIELVTEE---HQQENPLHQLLEGDLRQRVMDAIESLPEREQL
FLIA_YEREN            SYDEWREE------HGESVEPMLEG---HEDANPLQHLLEGNLRQRVIEAIEALPEREKM
S4YQ54_SERPL          SYDEWREE------HGESAEPLLEG---HEEANPLHHLLEGNLRQRVIDAIDALPEREKM
D2BX34_DICZ5          SYDEWREE------HGDSAEALLEG---NEDANPLNLLMDVNLRQRVMDAIENLPEREKM
D8MTK9_ERWBE          SYDEFREE------HGDTAELVTDG---HEEANPLHQLMEGNLRERVIEAIEALPDREKM
D3VC82_XENNA          SYDEWHEI------HGESCEPVIEE---EHETNPLQQLLEGDLRQRVINIIESLPEREKM
C5BA92_EDWI9          SYDEWREE------HGDSAEPVVEQ---SEESNPLHQLLESDLRGRVIAAIEALPEREKL
A0A0H3DVQ4_EDWTF      SYDEWRED------HGDSAEPVLEQ---SEEANPLRQLLESDLRGRVIAAIEALPEREKL
D4HYX8_ERWAC          SLDELQEQ------FADSYETIDEE---NEALNPVHQAVQENLVGKIAEHISVIPEREQV
E3DC65_ERWSE          SLDELQEQ------FADSYETIDEE---NEALNPVHQAVQENLVGKIAEHISVIPEREQV
Q8D302_WIGBR          SLDELNNQE-----IIGSFGMNIPI---DHSKDPCQLLLINSLKKKIIKEIQKLPKREKI
Q2NWZ1_SODGM          SLDELMAQE-----AQGT-GPALPA---DAGQDPFQLLMAGGLRKQVKDEIGRLPEREQL
E1VBQ8_HALED          PFEDLMSE--------GGEGRLRDN---ETAETPVSLLVDDERRRQLTAGIEALPEREKL
F8GP67_CUPNN          HYEDFER-----SGEEDFLDRHLGG---SDDGNPLTVLMESGMREALIRAIDRLPEREKL
G0AII3_COLFT          YYEDCEGG----SNENSFLDRQHDDGHRSGAGDPLQRLLDSGMRHMLVEAIALMPERERL
E3HSA4_ACHXA          HYEDFATEPDSASGQSDWAA---TLNHGAAGGNPLDSLLAGDFRQALVHAIDSLPEREKL
F4GQ14_PUSST          HYEDLAGQGEDAGSSLDRSSEDESATQAAHWSNPLNQLVSKGLRRALVEAIKALPEREQL
Q47I32_DECAR          YFDDLA--GEG---DEGFLERHFTD----NAADPAAILEDKSVKATLITAIGELPEREKM
C4KAV7_THASP          YLEDFN--REE---DDDYLDRHLAQ----EGNDPLTLLEDTDLRRRLVGAIEHLPEREQL
B2UHX2_RALPJ          YYEDFD--RED---ADAFIENRAPE----NDATPLDQLLDHDLRESVVAAIEGLPEREKL
D5CMW3_SIDLE          YYEDFH--GEE---GEDFFERFEFS----GDSNPLELLQDERFREALIHAIERLPERERQ
Q21S43_RHOFT          YLEDMARGNDE---EDSFLDRHVGD----SDADPMNVLRDQRLRQALVAAIKNLPEREQF
A1WGF0_VEREI          YLEDMGQGRDEREAEDGFLERHIVD----SAADPVELLRDQRLKTSLVAAIQSLPEREQH
Q7NZA0_CHRVO          HFEDFGGGDDE--GSHNPVTNIADD----DSPDPLAALSDDSFRRQLVSAIKFLPERDQL
G2IYC1_PSEUL          HFSDFDDDDGI--GAEAAVANVADD----NAVDPFASLADGDFRGALVDAIKALPERDQL
                        .                                           :   :  :* ::  

FLIA_PSEAE            VLALYYDEELNLKEIGEVLGVSESRVSQLHSQCAARLRARLADWRSA-------------
A0A379IWM2_PSEME      VLALYYDEELNLKEIGEVLGVSESRVSQLHSQCAARLRSRLSEWRAG-------------
Q88EW1_PSEPK          VLALYYDEELNLKEIGEVLGVSESRVSQLHSQCAARLRSRLGEWRAR-------------
A0A1G3DFS0_9GAMM      VLSLYYDEELNLKEIGQVLGVSESRVSQLHSQCAARLRARLGEWRAN-------------
Q2SBX5_HAHCH          VLSLYYDEELNLKEIGQVLSVSESRVSQIHSQATLRLRSRLSDWKNS-------------
Q21IQ5_SACD2          VLSLYYEQEMNLKEIGLVLGVSESRVSQIHSQAALRLKSRMQDWQSYE------------
A6W0V2_MARMS          VLSLYYNEELNLKEIGAVLGVSESRVSQIHSQAAMRLRARLSDWRD--------------
B1KLJ6_SHEWM          VLSLYYDEALNLKEIGSILEVSESRVSQILSQAMLRLKAKLKHWTNNKIT----------
Q7M7J2_VIBVY          VLSLYYDEELNLKEIGEILSVSESRVSQILSQSMQRLRTKLSAWTQND------------
Q5ZUL1_LEGPH          VLSLYYEQDLNLKEIGEILEVSESRISQILSQATHRIRSRLPE-----------------
Q31HN0_HYDCU          VMALYYDEELNLKEIGEVLEVSESRVSQIHSQAIKRLKSRLRDWI---------------
D3RRB4_ALLVD          VLALYYDEELNLREIGAVLDVTESRVSQIRSQALHRLRGRLSDWTRAGPGA---------
D3S9H9_THISK          VLSLYYIEELNLREIGAVLGVTESRVSQIRSQAVIRLRARLGSWLEDGEALQLF------
Q0A9Z9_ALKEH          IMALYYDEELNLREIGEVLNVTESRVSQIHGRIVVKLREALKEWLGRS------------
I1XMV3_METNJ          LMSLYYNEELNLKEIGEVLGVSESRVSQIHTQTVVRLRSKLRDWMQ--------------
Q8P9F9_XANCP          VLSLYYEQELNLKEIGAVLGVSESRVCQIHGQAVVRLRGRLKVFELADAGVEIDD-----
H8L3F7_FRAAD          VMSLYYDEELNLKEVGEVLGVSESRVCQIHGKALLRLRSRLSEWRQ--------------
K0C4V7_CYCSP          VVSLYYDNELNLKEIGSVLGVSESRACQINNQAMLRLKSRLVNYAPS-------------
G4T379_META2          VVSLYYVDELNLREIGQILNISESRVSQISSQAMLRLRARLADWREGHDNGD--------
D0KYP3_HALNC          VMSLYYVDELNQKEIGAVLGVSESRVCQIQNKAILRLKSSLKDWR---------------
FLIA_ECOLI            VLTLYYQEELNLKEIGAVLEVGESRVSQLHSQAIKRLRTKLGKL----------------
FLIA_ECOL6            VLTLYYQEELNLKEIGAVLEVGESRVSQLHSQAIKRLRTKLGKL----------------
FLIA_ECO57            VLTLYYQEELNLKEIGAVLEVGESRVSQLHSQAIKRLRTKLGKL----------------
FLIA_SALTY            VLTLYYQEELNLKEIGAVLEVGESRVSQLHSQAIKRLRTKLGKL----------------
FLIA_SALTI            VLTLYYQEELNLKEIGAVLEVGESRVSQLHSQAIKRLRTKLGKL----------------
FLIA_YEREN            VLTLYYQEELNLKEIGAVLEVGESRVSQLHSQAIKRLRARLNNDS---------------
S4YQ54_SERPL          VLTLYYQEELNLKEIGAVLDVGESRVSQLHSQAIKRLRARLAAEN---------------
D2BX34_DICZ5          VLTLYYQEELNLKEIGAVLEVGESRVSQLHSQAIKRLRAKLMSDV---------------
D8MTK9_ERWBE          VLTLYYQEELNLKEIGAVLEVGESRVSQLHSQAIKRLRARLTGAR---------------
D3VC82_XENNA          VLTLYYQEELNLKEIGAVLNVGESRVSQLHSQAIKRLRARLNPEK---------------
C5BA92_EDWI9          VLTLYYQEELNLKEIGAVLEVGESRVSQLHSQAIKRLRTRLLSQR---------------
A0A0H3DVQ4_EDWTF      VLTLYYQEELNLKEIGAVLEVGESRVSQLHSQAIKRLRTRLLSQR---------------
D4HYX8_ERWAC          ILQLYYQQDLNMREIGAVLSLTETRVSQLHSLAIKRIRARMDALNGCE------------
E3DC65_ERWSE          ILQLYYQQDLNMREIGAVLSLTETRVSQLHSLAIKRIRARMDAVNGCE------------
Q8D302_WIGBR          LLNLYYQQELNLKEIGEVLGVGESRVSQLHSLAIKRLRSRLKENI---------------
Q2NWZ1_SODGM          LLNLYYHQELNLKEIGEVLGVGESRVSQLHSLAIKRLRARLQGST---------------
E1VBQ8_HALED          LMALYYQEELNLKEIGAVLGVTESRVCQLHSQAVSRLRGRLREAG---------------
F8GP67_CUPNN          VLSLCYDQELNLREIGAVLDVTESRVCQIRGQAITRLRNQLRGLL---------------
G0AII3_COLFT          LLSLYYEQELNLREIGAVLEVSQSRVCQLHSQAISRLRVRLNETSRSEIA----------
E3HSA4_ACHXA          LLSLCYEQGLNLKEIGAILNVTEARVCQLRSQATARIRVKLKEQAWQELPQDGQIAQVI-
F4GQ14_PUSST          LLSLQFEQDLNQKEIGLVMGITEGRVSQLRSQAVARIRAALTHSEWHESPGEVGLHALL-
Q47I32_DECAR          MMALYYEQDLNLREIGEVMGVTESRVCQLHTQAIARLRSQIV--GEIPKAAKRR----KE
C4KAV7_THASP          VMALYYDEELNLREIGEVLGVTESRVCQLHSQAVARLRACVFEGGTAMPVARRRGRPPKN
B2UHX2_RALPJ          MMSLYYEQDLNLREIGAVMGVSESRVCQIHSQAIARIRSRLRDRAWLPTPT---------
D5CMW3_SIDLE          MMGMHYEQDMNLREIGEVMGVSESRVCQLHSQAVARLRASMKGH----------------
Q21S43_RHOFT          IMSMYYEQDMNLKEIAAVLDVTESRICQLHSQSIARLRAKMRAH----------------
A1WGF0_VEREI          IMGMYYEHDMNLKEIAAVLGITESRVCQLHSQSIVRLRAKMRAH----------------
Q7NZA0_CHRVO          VMALYYEQELNLKEIGAVLGVTESRVCQLHSQAIARLRAKLKDWL---------------
G2IYC1_PSEUL          VMALYYEQELNLKEIGAVLGVSESRVSQLHSQAIARVRSKLREWL---------------
                      :: : : . :* :*:. :: : : * .*:      :::  :                   

FLIA_PSEAE            -----
A0A379IWM2_PSEME      -----
Q88EW1_PSEPK          -----
A0A1G3DFS0_9GAMM      -----
Q2SBX5_HAHCH          -----
Q21IQ5_SACD2          -----
A6W0V2_MARMS          -----
B1KLJ6_SHEWM          -----
Q7M7J2_VIBVY          -----
Q5ZUL1_LEGPH          -----
Q31HN0_HYDCU          -----
D3RRB4_ALLVD          -----
D3S9H9_THISK          -----
Q0A9Z9_ALKEH          -----
I1XMV3_METNJ          -----
Q8P9F9_XANCP          -----
H8L3F7_FRAAD          -----
K0C4V7_CYCSP          -----
G4T379_META2          -----
D0KYP3_HALNC          -----
FLIA_ECOLI            -----
FLIA_ECOL6            -----
FLIA_ECO57            -----
FLIA_SALTY            -----
FLIA_SALTI            -----
FLIA_YEREN            -----
S4YQ54_SERPL          -----
D2BX34_DICZ5          -----
D8MTK9_ERWBE          -----
D3VC82_XENNA          -----
C5BA92_EDWI9          -----
A0A0H3DVQ4_EDWTF      -----
D4HYX8_ERWAC          -----
E3DC65_ERWSE          -----
Q8D302_WIGBR          -----
Q2NWZ1_SODGM          -----
E1VBQ8_HALED          -----
F8GP67_CUPNN          -----
G0AII3_COLFT          -----
E3HSA4_ACHXA          -----
F4GQ14_PUSST          -----
Q47I32_DECAR          KA---
C4KAV7_THASP          AAAGR
B2UHX2_RALPJ          -----
D5CMW3_SIDLE          -----
Q21S43_RHOFT          -----
A1WGF0_VEREI          -----
Q7NZA0_CHRVO          -----
G2IYC1_PSEUL          -----