CLUSTAL format seed alignment for MF_00963

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Q7NB90_MYCGA      MLFIPLTFTRMAKNTNSTPKNKTASKAKN---------ISQLSLKQRLELAKKQEKTPAK
SIGA_MYCGE        ----------MSTDKKTLGEKPNSTKPEL-----------------------------SE
SIGA_MYCPN        ----------------MSSPKKNFKKPQP-------------KTENQKQA--------LN
Q9PQE2_UREPA      MSTKQNEPLFVNLEDLKQKVKLSFTEEFSFSYALSELEAGIFESRNLKGADAGDPEEILL
RPOD_HELPY        -------MKKKANEEKAQKRAKTEAKAEA-------------TQENKTKENNKAKESKIK
RPOD_HELPJ        ---------MKKKANEEKAPKRAKQEAKTEATQENKAKESNKENKNNKAKEGKIKEAKTK
RPOD_BORBU        ------------------MSDLEKKYSKL-----------------------------IE
Q1ATP3_RUBXD      ----------------------MAAEDTM-------------MLADR-----------AY
Q6YPU7_ONYPE      ------MEFDNIIKTLNEQAGSEQKLTSQLIMSFLQNQNIKIPYQQIAQSLK------EQ
RPOD_TREPA        --------------------MMELSRTPA-----------------------------VM
A9WAH7_CHLAA      ----------MTQSQPETDRAAPAINPAD-----------------------------LQ
A2C7M0_PROM3      -----MSPAATQAAAAKAKPKASAKTAKP-------------QVAKGTVKAK------AK
SIGA_SYNY3        ----------------------MTQTKEP-------------------------------
SIGA1_SYNE7       -----------MTQLISIDKEQEEAGMTQ-----------------------------AT
SIGA_NOSS1        --------------MNQANNVLDSIYQPD-----------------------------LE
SIGA_MICAE        ----------------------------------------------------------MM
B8G6G0_CHLAD      ----------------------------M-----------------------------IE
D1C328_SPHTD      ---------------------------------------------------M------DA
RPOD_NEIGO        --------------MSKNQNHEEYQDDAR-------------PLTIEEQRAR------LR
SIGA_THEMA        -----MNEEQQVLQEQHQEQTQEQTQEQK-------------ETLPPQIERR------IK
B9L102_THERP      --------MTKAERRGKPKRSREVVTRAN-------------GSVDLPVLAG------AD
RPOD_COXBU        ------------<AKVVSQPLPKTAEKKPSAPPSETQQPKIGENAAESQRLG------FG
RPOD_XYLFA        ------------------MSNERTAQQSD-----------------------------IK
RPOD_XYLFT        ------------------MSNERTAQQSD-----------------------------IK
RPOD_XANAC        ------------------MANERPAQQSD-----------------------------IK
RPOD_XANCP        ------------------MANERPAQQSD-----------------------------IK
RPOD_HAEIN        --------------MEKNQQSTAEQYSEQ-----------------------------IE
RPOD_PSEPU        -------------------MSGKAQQQSR-----------------------------IK
RPOD_PSEAE        -------------------MSGKAQQQSR-----------------------------LK
RPOD_PSEPH        -------------------MSGKAQQQSR-----------------------------LK
RPOD_SHEVD        ------------------------MEHTP-------------QS-------Q------LK
RPOD_BUCBP        ------------------------MEQNP-------------QS-------Q------LK
RPOD_ECOLI        ---------------------MEQNPQSQ-----------------------------LK
RPOD_SALTI        ---------------------MEQNPQSQ-----------------------------LK
RPOD_SALTY        ---------------------MEQNPQSQ-----------------------------LK
RPOD_BUCAI        ---------------------MDQNPQSQ-----------------------------LK
RPOD_BUCAP        ------------------------MEHNP-------------KS-------Q------LK
RPOD_LEPIC        --------------------MENLQSMPE-----------------------------VQ
RPOD_LEPIN        --------------------MENLQSMPE-----------------------------VQ
SIGA_CHLPN        -------MFMNTQNSQATEVSSEEESQKK-----------------------------LE
SIGA_CHLMU        ------------MRMDTLDSQAADAAQEE-------------EIQRK-----------LE
SIGA_CHLTR        ------------MRMDTLDSQAAEAAQEE-------------EIQRK-----------LE
RPOD_RICBR        ------------------MTNTDNNNLNK-----------------------------ID
RPOD_RICPR        -----------------MSNSNIDNDPAK-----------------------------ID
RPOD_RICTY        -----------------MSNSNIDNDPAK-----------------------------ID
RPOD_RICCN        -----------------MSNSNIDNDLDK-----------------------------ID
RPOD_RICFE        -----------------MSNSNIDNDLDK-----------------------------ID
RPOD_RHOCA        ----------MAAKDIDDTKPDTAADEDA-------------SFDMSQAA--------VK
RPOD_RHOCB        ----------MAAKDIDDTKPDTAADEDA-------------SFDMSQAA--------VK
RPOD_CAUVC        ---------MSNNSSAETEAPETTGGDGP-------------LLDLTDAG--------VK
RPOD_AGRFC        -------MATKVKENEEAENERDGATDGP-------------LLDLSDDA--------VK
RPOD_RHIEC        -------MATKVKENEDAEVERDGASDGP-------------LLDLSDDA--------VK
RPOD_RHIME        -------MATKVKENEEADVEREGAPDGP-------------LLDLS--DDA------VK
SIGA_THET2        -------------MKKSKRKNAQAQEAQE-----------------------------TE
SIGA_THEAQ        ------------MKKSKSKKKAAKAQEVE-----------------------------VK
RPOD_MYXXA        --------------------<DPVAERKE-----------------------------VK
D7AZB5_NOCDD      ----------------------------------------------------------MV
SIGA_MYCTU        --------------<PKDAQHEAATDPED-------------ALDSVEELDA------EP
SIGA_MYCBO        --------------<PKDAQHEAATDPED-------------ALDSVEELDA------EP
SIGA_LACLA        ------------MDSPKTLARVEVKENGD-------------TFNVKAYEKA------VK
SIGA_STRMU        --------------MVNNKKKTSSTFNVQ-----------------------------VA
SIGA_STRPN        ---------------MATKQKEVTTFDVQ-----------------------------VA
SIGA_STRR6        ---------------MATKQKEVTTFDVQ-----------------------------VA
E3DLQ7_HALPG      ---------------------------------------------MV-----------KK
SIGA_CLOAB        MKNKTEVKNGGEKKNSKKVSKEESAKEKN-------------EKMKI-----------VK
SIGA_ENTFA        -----------------MEKETSKKYEAA-----------------------------VA
SIGA_STAES        ------------MSDNQVKIKKQTIDPTL-------------TLEDV-----------KK
SIGA_STAEQ        ------------MSDNQVKIKKQTIDPTL-------------TLEDV-----------KK
SIGA_STAA8        ------------MSDNTVKIKKQTIDPTL-------------TLEDV-----------KK
SIGA_STAAC        ------------MSDNTVKIKKQTIDPTL-------------TLEDV-----------KK
SIGA_STAAM        ------------MSDNTVKIKKQTIDPTL-------------TLEDV-----------KK
SIGA_STAAR        ------------MSDNTVKIKKQTIDPTL-------------TLEDV-----------KK
SIGA_STAAS        ------------MSDNTVKIKKQTIDPTL-------------TLEDV-----------KK
SIGA_STAAW        ------------MSDNTVKIKKQTIDPTL-------------TLEDV-----------KK
SIGA_STAAN        ------------MSDNTVKIKKQTIDPTL-------------TLEDV-----------KK
SIGA_BACSP        ----------------MANDQHTELETEF-------------TLDQV-----------KD
SIGA_LISIN        -----------------MSDKTQNTKPVA-------------ELNVEQ----------VK
SIGA_LISMO        -----------------MSDKTKNTKPVA-------------ELSVEQ----------VK
SIGA_BACHD        ---------------MAEKPLRPLAEGEL-------------SIDQV-----------KE
SIGA_BACSU        ------------------MADKQTHETEL-------------TFDQV-----------KE
                                                                              

Q7NB90_MYCGA      KLVNKKTE-TVSKTKKTAKPTKVEKPVSEKKLSVATKAKSEKVVVEQPKAKTTVKK-VK-
SIGA_MYCGE        EL-IAELK-K----QRILEKNRPYKKMIYVDNKVQRKHRHE--------NIAFLKT-LH-
SIGA_MYCPN        EERIAELK-K----SRILGKNRPFKKMIYVDTKAQRKQKHE--------NVAFLKT-LQ-
Q9PQE2_UREPA      NV-VLDVS-KKKRSRNEIKFNKLQNYFIHMN--LREEHFSE--IIDVL-EAIGIRV-PD-
RPOD_HELPY        ESKIKEAKAKEPIPVKKLSFNEALEELFANSL-SDCVSYES--IIQISAKVPTLAQ-IKK
RPOD_HELPJ        ESKVKETA-KEPIPVKKLSFNEALEELFANSL-SDCVSYES--IIQISAKVPTLAQ-IKK
RPOD_BORBU        GIITHLGD------RKSLSFSELSNLLP-DDI-LEPEILDC--ICSVL-EDRGIRL-VNK
Q1ATP3_RUBXD      EL-LSKGR-S----QGFLSAEDVADLVR-EGD-LSPDEAEE--LYATL-EEEDITL-VD-
Q6YPU7_ONYPE      GIQIISCE-TQ---AAPSLNENPNQNDTQPQTNTTNDDFTD--LDSEL-TNANLEN-TD-
RPOD_TREPA        RL-LEYAR-E----KKAITHDEVENILA-HYGVETEELLHD--VLDML-EQENIKV-FS-
A9WAH7_CHLAA      AL-IAQGR-Q----QGFVTFEDIQRLVPNPDE--SIELIDS--IYAAL-AEAGVPV----
A2C7M0_PROM3      KVKATAPK-AKTAAKPVSSAAKASSPKAKKAKATPTPTVSK--NLDLT-ADKLLATAAT-
SIGA_SYNY3        ---LTKAE-----------SAELEQEIELSQY-INTDDIDD--------DDIDVED-LE-
SIGA1_SYNE7       EL-LDPAL------KPAETKAKRSSRKK-----ATTAVVEP--ATTIA-PTADVDA-ID-
SIGA_NOSS1        IM-NQPEI-E----LDDLLIEEDEDLLL-----ADDGDIDE--FLEPQ-TD---------
SIGA_MICAE        QA------------HDVLTLTEPPLDLDLIDL---DEDFDD--------EDIELEL-EE-
B8G6G0_CHLAD      QL-LAAAR-V----RGYITHADILATFPNPEH--DIAEIDQ--LYAML-QAEGIRV-VE-
D1C328_SPHTD      SL-IARGK-D----RGYLLSDEIIAAFP-NAE-ENVESLDE--FYSTL-VEQGIEV-LD-
RPOD_NEIGO        QL-IIMGK-E----RGYITYSEINDALP-DDM-SDADQIDN--IVSMI-SGLGIQV-TE-
SIGA_THEMA        KL-ISLGK-K----KGYITYEDIDKAFPPDFEGFDTNLIER--IHEEL-EKHGINI-VE-
B9L102_THERP      AI-LATAR-L----HGRLTREQWLALIDT----LGPDAAET--ALAEL-QAEGVPVAIE-
RPOD_COXBU        AL-LEEAK-N----KGYLVHEDLINLLP-NDY-ADPSQMEG--IIGRL-TEMGIKV-FE-
RPOD_XYLFA        QL-ISKGL-E----QGYLTYAEVNDHLP-EDL-VDPDQIED--IIGMI-NGMGIEV-HE-
RPOD_XYLFT        QL-ISKGL-E----QGYLTYAEVNDHLP-EDL-VDPDQIED--IIGMI-NGMGIEV-HE-
RPOD_XANAC        LL-ISKGL-E----QGYLTYAEVNDHLP-DDL-VDPEQIED--IISMI-NGMGIDV-HE-
RPOD_XANCP        LL-ISKGL-E----QGYLTYAEVNDHLP-DDL-VDPEQIED--IISMI-NGMGIDV-HE-
RPOD_HAEIN        QL-MELGR-T----QGYLTFAEINDLLP-EDA-IDPEYYDK--LLQTLQNDAGIPV-LD-
RPOD_PSEPU        EL-ITRGR-E----QGYLTYAEVNDHLP-EDI-SDPEQVED--IIRMI-NDMGINV-FE-
RPOD_PSEAE        EL-IARGR-E----QGYLTYAEVNDHLP-EDI-SDPEQVED--IIRMI-NDMGINV-FE-
RPOD_PSEPH        EL-ISRGR-E----QGYLTYAEVNDHLP-EDI-SDPEQVED--IIRMI-NDMGINV-FE-
RPOD_SHEVD        LL-LAKGK-E----QGYLTYAEVNDHLP-ADM-VDADQIED--IVQMI-NDMGIRV-YE-
RPOD_BUCBP        LL-VTYGK-E----QGYLTYSEINDHLS-DNI-INSDQIED--IIQMI-NDMGIQV-VE-
RPOD_ECOLI        LL-VTRGK-E----QGYLTYAEVNDHLP-EDI-VDSDQIED--IIQMI-NDMGIQV-ME-
RPOD_SALTI        LL-VTRGK-E----QGYLTYAEVNDHLP-EDI-VDSDQIED--IIQMI-NDMGIQV-ME-
RPOD_SALTY        LL-VTRGK-E----QGYLTYAEVNDHLP-EDI-VDSDQIED--IIQMI-NDMGIQV-ME-
RPOD_BUCAI        LL-VTHGK-E----QGYLTYSEVNDHLP-EDI-IDSEQIDD--IIQMI-NDMGIPV-VE-
RPOD_BUCAP        LL-VTHGK-E----QGYLTYAEVNDHLP-EEI-IDSEQIDD--IIQMI-NDMGIQV-VE-
RPOD_LEPIC        KI-ISLGK-A----NGEVSYDDINEILP-DKI-LNSEKIDD--FFTLL-HEMGIEI-VE-
RPOD_LEPIN        KI-ISLGK-A----NGEVSYDDINEILP-DKI-LNSEKIDD--FFTLL-HEMGIEI-VE-
SIGA_CHLPN        EL-VALAK-E----QGFITYEEINEILPMSFD--TPEQIDQ--VLIFL-TGMDIQV-LN-
SIGA_CHLMU        EL-VTLAK-D----QGFITYEEINEILPPSFD--SPEQIDQ--VLIFL-AGMDVQV-LN-
SIGA_CHLTR        EL-VTLAK-D----QGFITYEEINEILPPSFD--TPEQIDQ--VLIFL-AGMDVQV-LN-
RPOD_RICBR        SL-LKKAKSK----KGSVTYNDINRALP---DGTSVEEIDK--VMFRF-SEAEVDI-LDT
RPOD_RICPR        SL-LKKAKSK----KIPVTYDDINKALPLNKN-PSIRQLEE--AILKF-SDAGVDI-LE-
RPOD_RICTY        SL-LRKAKSK----KIPVTYDDINKALPLNKN-PSIRQLEE--AILKF-SDAGVDI-LE-
RPOD_RICCN        SL-LKKAKSK----KIPVTYDDINNALPLNKN-PSIRQLEE--AILKF-SDAGVDI-LE-
RPOD_RICFE        SL-LKKAKSK----KIPVTYDDINKALPLNKN-PSIRQLEE--AILKF-SDAGVDI-LE-
RPOD_RHOCA        RM-IGEAK-E----RGYITIDQLNAVMP-PET-VSGEQIED--VMSML-SEMGINV-VE-
RPOD_RHOCB        RM-IGEAK-E----RGYITIDQLNAVMP-PET-VSGEQIED--VMSML-SEMGINV-VE-
RPOD_CAUVC        KF-IKQAK-A----RGYVTMDELNKVLP-SEE-VSPDAIED--TLAML-SEMGVNV-VE-
RPOD_AGRFC        KM-IKAAK-K----RGYVTMDELNSVLP-SEE-VTSEQIED--TMAML-SDMGINV-IE-
RPOD_RHIEC        KM-IKAAK-K----RGYVTMDELNAVLP-SEE-VTSEQIED--TMSML-SDMGINV-IE-
RPOD_RHIME        KM-IKAAK-K----RGYVTMDELNSVLP-SEE-VTSEQIED--TMSML-SDMGINV-IE-
SIGA_THET2        VLVQEEAE-E----LPEFPEGEPDPDLE---D-PDLALEDD--LLDLPEEGEGLDL-EE-
SIGA_THEAQ        EP-VKEPE-P----LPELEAAEDLQDLPEPDP-------------ELLASEPELED-LA-
RPOD_MYXXA        DL-LAAGR-E----KGFLTYDEVNDALP-ADI-VSSDQIDD--VMSMF-GDNDIEI-VD-
D7AZB5_NOCDD      RL-LPD--------TGPVSRGEVASALE-RLD-APPDYLDQ--AVAHL-ARIGVEV----
SIGA_MYCTU        DLDVEPGE-DLDLDAADLNLDDLEDDVAPDAD-DDLDSGDD-EDHEDLEAEAAVAP-GQT
SIGA_MYCBO        DLDVEPGE-DLDLDAADLNLDDLEDDVAPDAD-DDLDSGDD-EDHEDLEAEAAVAP-GQT
SIGA_LACLA        SY-ITKRK-P----LGEALDEEIMDELSVKFG-IVDDALED--LFKQI-QDAGISI-VD-
SIGA_STRMU        DF-IRNHK-K----EGVAVDDEVTEKLVIPFE-LEAEQIDD--LLERL-TDGGISI-TD-
SIGA_STRPN        EF-IRNHK-Q----KGTATDDEINASLVIPFT-LDADGIED--LLQRI-QDAGISI-TD-
SIGA_STRR6        EF-IRNHK-Q----KGTATDDEINASLVIPFT-LDADGIED--LLQRI-QDAGISI-TD-
E3DLQ7_HALPG      AN-NEDND--------------------------------------------------N-
SIGA_CLOAB        NL-IDKGK-K----SGSLTYKEIMDELQ-EVD-LGPEQIEK--IYEVL-ESVGVDV-VG-
SIGA_ENTFA        AF-IKENK-P----KGTVVYDDLANQLATPYT-LDAEAMEK--LIQKV-EDAGISV-VD-
SIGA_STAES        QL-IDKGK-K----EGHLSHEEIAEKLQ-NFE-MDSDQMDD--FFDQL-NDNDITL-VN-
SIGA_STAEQ        QL-IDKGK-K----EGHLSHEEIAEKLQ-NFE-MDSDQMDD--FFDQL-NDNDITL-VN-
SIGA_STAA8        QL-IEKGK-K----EGHLSHEEIAEKLQ-NFD-IDSDQMDD--FFDQL-NDNDISL-VN-
SIGA_STAAC        QL-IEKGK-K----EGHLSHEEIAEKLQ-NFD-IDSDQMDD--FFDQL-NDNDISL-VN-
SIGA_STAAM        QL-IEKGK-K----EGHLSHEEIAEKLQ-NFD-IDSDQMDD--FFDQL-NDNDISL-VN-
SIGA_STAAR        QL-IEKGK-K----EGHLSHEEIAEKLQ-NFD-IDSDQMDD--FFDQL-NDNDISL-VN-
SIGA_STAAS        QL-IEKGK-K----EGHLSHEEIAEKLQ-NFD-IDSDQMDD--FFDQL-NDNDISL-VN-
SIGA_STAAW        QL-IEKGK-K----EGHLSHEEIAEKLQ-NFD-IDSDQMDD--FFDQL-NDNDISL-VN-
SIGA_STAAN        QL-IEKGK-K----EGHLSHEEIAEKLQ-NFD-IDSDQMDD--FFDQL-NDNDISL-VN-
SIGA_BACSP        QL-IEQGK-K----RSSLNYKDIMEKLS-PFD-QDPEQMDE--FYEHL-GDLGIEV-VN-
SIGA_LISIN        EALIEEGK-K----KGILTYAKIAARLA-PFT-LDSDQMDE--YLEHV-GEAGIEV-SD-
SIGA_LISMO        EALIEEGK-K----KGILTYAKIAARLA-PFT-LDSDQMDE--YLEHV-GEAGIEV-SD-
SIGA_BACHD        QL-VELGK-K----RGVLTYAEITEKLA-PYD-QDSDQMDE--FFEYL-GEQGVEI-LN-
SIGA_BACSU        QL-TESGK-K----RGVLTYEEIAERMS-SFE-IESDQMDE--YYEFL-GEQGVEL-IS-
                                                                              

Q7NB90_MYCGA      ---------AAPTKKEVVLKDKKAKAEPKSVAK-----EEKKNKLSLKSAKK------ST
SIGA_MYCGE        ---------ENKESDV--------------------------------------------
SIGA_MYCPN        ---------ENKESDV--------------------------------------------
Q9PQE2_UREPA      ---------YDLVMQS-KSKTNTKKKDEYGIDD-----TLEISTSKIGFSST--------
RPOD_HELPY        IKELCQKYQKKLVSSSEYAKKLNAIDKIKKTEE-----KQKVLDEELEDGYD---FLKEK
RPOD_HELPJ        IKELCQKYQKKLVSSSEYAKKLNAIDKIKNTEE-----KQKVLDEELEDGYD---FLKEK
RPOD_BORBU        ISELDLVVSEDGNDEEEEVEIESDRNFMILDDGFQSDEEDIDIDVKLDDCDEEDISVKDD
Q1ATP3_RUBXD      ---------EELEGAAEVTPERAAGR------------EGDNPASQLAHAVA--------
Q6YPU7_ONYPE      ---------DNKDEDN-TQDSEEDIQDFDISEEDLI--SDEKLIELEEDEDE-----KIS
RPOD_TREPA        ---------SEEEELEDEVFAGLKGPAADDGDG-----SFPLSTERVRDKLCDSSRGARQ
A9WAH7_CHLAA      ---------QEGDETA-------------LDDE-----PSSPATMDLDLDDE--------
A2C7M0_PROM3      ---------SAPKASAETESSQAAAKASS---------EADAKARALANIKI--------
SIGA_SYNY3        ---------QEVAATEG---------------------KEKKVRKIRKDAVK--------
SIGA1_SYNE7       ---------DEDSVGE----------------------DEDAAAKAKAKVRK--------
SIGA_NOSS1        ---------EDDAKSG----------------------KAAKSRRRTQSKKK--------
SIGA_MICAE        ---------TSDSNDG---------------KK-----TRRLASARRRDAAR--------
B8G6G0_CHLAD      ---------SSDELDG----------PTDFEPE-----TDHDLTVDLPDLGE--------
D1C328_SPHTD      ---------QEPTNGN-GTTAS-LSERTASQPA-----PASPTIDTRQDVAD--------
RPOD_NEIGO        ---------HAPDAED-ILLSD---NAAVTDDD-----AVEEAEAALSSADS--------
SIGA_THEMA        ---------NEPEEEE-ISASS--------DEQ-----ELEELLEKESPEIH--------
B9L102_THERP      ---------EALEPDG--------------TSR-----SWEPEKEADPDLL---------
RPOD_COXBU        ---------IPPDADS-LLLEE----DTQSDDD-----EINEDVAEVLATET--------
RPOD_XYLFA        ---------VAPDAETLLLNEGNTGNREVDDT------AAEEAAAALSALDT--------
RPOD_XYLFT        ---------VAPDAETLLLNEGNTGNREVDDT------AAEEAAAALSALDT--------
RPOD_XANAC        ---------VAPDAET-LLLNDGNTGNREVDDT-----AAEEAAAALTALDT--------
RPOD_XANCP        ---------VAPDAET-LLLNDGNTGNREVDDT-----AAEEAAAALTALDT--------
RPOD_HAEIN        ---------EAPESDDMMLSDTIP------DED-----AVEEATQILSNVES--------
RPOD_PSEPU        ---------SAPDADALLLAEADT------DEA-----AAEEAAAALAAVET--------
RPOD_PSEAE        ---------TAPDADALLLAEADT------DEA-----AAEEAAAALAAVES--------
RPOD_PSEPH        ---------SAPDADALLLAEADT------DEA-----AAEEAAAALAAVET--------
RPOD_SHEVD        ---------QAPDADE-IMMTE-D----STDDD-----AAEEAAAALATVEA--------
RPOD_BUCBP        ---------KAPDSDD-LILHE-IKRNNETDED-----IVEATAQVLSTVES--------
RPOD_ECOLI        ---------EAPDADDLMLAENTA------DED-----AAEAAAQVLSSVES--------
RPOD_SALTI        ---------EAPDADDLLLAENTTST----DED-----AEEAAAQVLSSVES--------
RPOD_SALTY        ---------EAPDADDLLLAENTTST----DED-----AEEAAAQVLSSVES--------
RPOD_BUCAI        ---------EAPDADDLILNEINTDT----DED-----AVEAATQVLSSVES--------
RPOD_BUCAP        ---------EAPDADD-LILNE-I--NTDTDED-----AVEAATQVLSSVES--------
RPOD_LEPIC        ---------EYTRNTLEPASTLVP------KDD-----SKPARKKKESSAST--------
RPOD_LEPIN        ---------EYTRNTLEPASTLVP------KDD-----SKPARKKKESSAST--------
SIGA_CHLPN        ---------QIDVERQK---------------------EKKKEAKELEGLAR--------
SIGA_CHLMU        ---------QADVERQK---------------------ERKKEAKELEGLAK--------
SIGA_CHLTR        ---------QADVERQK---------------------ERKKEAKELEGLAK--------
RPOD_RICBR        ---------NEDDAIKIDDMEMEEGFKISTNID-----HEPEDETEEENIGT--------
RPOD_RICPR        ---------SNEDDEIKLDIGM--------DEEFKL--STNVDNESEDEVEE--------
RPOD_RICTY        ---------SNEDDEIKLDIGI--------DEEFKL--STNVDNESEDEVEE--------
RPOD_RICCN        ---------SNEDDEIKLDIGM--------DEEFKL--STNVDNEPEDEVEE--------
RPOD_RICFE        ---------SNEDDEIKLDIGM--------DEEFKL--STNVDNEPEDEVEE--------
RPOD_RHOCA        ---------GEEVE------------------------ESEGGEVVETGSGSREIAVAGA
RPOD_RHOCB        ---------GEEVEESEGGEVVET--------------GSGSREIAVAGAAG--------
RPOD_CAUVC        ---------AEEDAEN--------------AEGGEVATRDENTTVIASDKPA--------
RPOD_AGRFC        ---------DEDAEEAAPAEDDGDS-----DNE-----ESEGGELAPSGGTA---LATAK
RPOD_RHIEC        ---------DEEAEEAGASGGGD-------DDDAGGDEDSEGGELAPSAGTA---LATAK
RPOD_RHIME        ---------DEEAEEA-AAS----DDDDGADEG-----ESEGGELAP-ASGT--ALAASK
SIGA_THET2        ---------EEEDLPI--------------------------------------------
SIGA_THEAQ        ---------DPLDLEGPLEADLLP--------------EEGLLEEEEEELSL--------
RPOD_MYXXA        ---------AQKAAQNNEIKPTVT------VEE-----EKEDADEDEKDEDD--------
D7AZB5_NOCDD      ---------AGPEDTG----------------------SEDPGPVADGGRRS--------
SIGA_MYCTU        A--------DDDEEIAEPTEKDKASGDFVWDED-----ESEALRQARKDAEL--------
SIGA_MYCBO        A--------DDDEEIAEPTEKDKASGDFVWDED-----ESEALRQARKDAEL--------
SIGA_LACLA        ---------KDGNPSPLALVTD--------EIE-----KEEVSDTAMDEIVT--------
SIGA_STRMU        ---------REGNPSTKYAVEEIK--------------PEELTDEELLGSNS--------
SIGA_STRPN        ---------NEGNPSARVLS----------NEE-----EPELSDEDLIGSTS--------
SIGA_STRR6        ---------NEGNPSARVLS----------NEE-----EPELSDEDLIGSTS--------
E3DLQ7_HALPG      ---------QNENT----------------EEE-----EQDL------DLSI--------
SIGA_CLOAB        ---------DMHEI----------------EVE-----EEDL------DLTI--------
SIGA_ENTFA        ---------ENGDPSEHSLKKD----------------EKEAEKAQAEDLSA--------
SIGA_STAES        ---------EKDSSDT--------------DDK-----------INPNDLSA--------
SIGA_STAEQ        ---------EKDSSDT--------------DDK-----------INPNDLSA--------
SIGA_STAA8        ---------EKDSSDT--------------DEK-----------LNPSDLSA--------
SIGA_STAAC        ---------EKDSSD---------------TDE-----KLNP-----SDLSA--------
SIGA_STAAM        ---------EKDSSD---------------TDE-----KLNP-----SDLSA--------
SIGA_STAAR        ---------EKDSSD---------------TDE-----KLNP-----SDLSA--------
SIGA_STAAS        ---------EKDSSDT--------------DEK-----------LNPSDLSA--------
SIGA_STAAW        ---------EKDSSDT--------------DEK-----------LNPSDLSA--------
SIGA_STAAN        ---------EKDSSDT--------------DEK-----------LNPSDLSA--------
SIGA_BACSP        ---------ENDEEVSNLRQGE--------DHD-----GNDNDDFNFDDDLS--------
SIGA_LISIN        ---------DADDEDP--------------DETELV--KEETESFDLTDMSV--------
SIGA_LISMO        ---------DADDEDPDETELV----------------KEETESFDLTDMSV--------
SIGA_BACHD        ---------DNEEVPSLQQV------------------EKEEEEFDLNDLSV--------
SIGA_BACSU        ---------ENEETED-PNIQQLAK-----AEE-----EFDL-----NDLSV--------
                                                                              

Q7NB90_MYCGA      KKKVTSK--------KDENLDLN-NEIDFADFDNKDDEIDFSDFKHEN---------YSS
SIGA_MYCGE        --PKKRR--------GRKPKHAPLKEKNNLKLFDILEG-SLKSHIENDDTNTVINLL---
SIGA_MYCPN        --PKKRR--------GRKPKHAPLKEKNNLKLFDILEGSLKSHTENDDTNKVISLLVEV-
Q9PQE2_UREPA      ---TTEK--------VDDGIKAYLGVLGESKMLRSDEETEYAKMVISD------------
RPOD_HELPY        DFLEWSR--------SDSPVRMYLREMGDIKLLSKDEEIELSKQIRLGEDIILDAICSVP
RPOD_HELPJ        DFLEWSR--------SDSPVRMYLREMGDIKLLSKDEEIELSKQIRLGEDIILDAICSVP
RPOD_BORBU        LGSGYIKGNVLKDSHSEDPIKLYLKEIGKEFLLTGNQEVELAKQMDSGESIIENILKNEG
Q1ATP3_RUBXD      ---------------TGDSIRMYLAEIGRVPLLTHADEIRLAKAISRGCKR---------
Q6YPU7_ONYPE      KIHSDIK--------MDDSVRMYLKEIGQIPLLSLAEEQKKSILVFLG------------
RPOD_TREPA        NLLSNAR-----NIALDDPVKLYLRDIGQEKLLTAEQEVMLSKRMEEGEGIIKDIITQSG
A9WAH7_CHLAA      --LSDAL--------LSDSVRLYLREIGQVPLLTAEQEKRLAQLIEQG------------
A2C7M0_PROM3      -GPKGVY--------TEDSIRVYLQEIGRIRLLRPDEEIELARKIAD-------------
SIGA_SYNY3        ---KKPY--------TEDSIRIYLQEIGRIRLLRAEEEIELARQIADLLE----------
SIGA1_SYNE7       -----TY--------TEDSIRLYLQEIGRIRLLRADEEIELARQIAD-------------
SIGA_NOSS1        -----HY--------TEDSIRLYLQEIGRIRLLRADEEIELARKIAD-------------
SIGA_MICAE        ---KKPY--------TEDSIRIYLQEIGRIRLLRAEEEIELARKIADL------------
B8G6G0_CHLAD      -----IA--------FDDPVRMYLQEIGQVPLLTAEQEVELAKAMEAG------------
D1C328_SPHTD      ----AVS--------VSDSVRLYLQEIGETSLLTMEEEVWLAKRMERG------------
RPOD_NEIGO        ---EFGR--------TTDPVRMYMREMGQVDLLTREDEIIIAKKIENALKNMVQAISACP
SIGA_THEMA        ---DSSN--------VRDSIKMYLKEIGKIPLLTPAQERELARRAQMG------------
B9L102_THERP      ---------------VEDPVRLYLAEIGRVPLLTAEQEVELGRAVELAEYLDELRRCCGD
RPOD_COXBU        ------R--------TTDPVRMYMREMGSVELLTREGEIVIAKRIEEGIRQVMGAVVQYP
RPOD_XYLFA        ---EAGR--------TTDPVRMYMREMGTVELLTREGEIAIAKRIEEGLSEVQAALGVFP
RPOD_XYLFT        ---EAGR--------TTDPVRMYMREMGTVELLTREGEIAIAKRIEEGLSEVQAALGAFP
RPOD_XANAC        ---EGGR--------TTDPVRMYMREMGTVELLTREGEIAIAKRIEEGLSQVQAALGVFP
RPOD_XANCP        ---EGGR--------TTDPVRMYMREMGTVELLTREGEIAIAKRIEEGLSQVQAALGTFP
RPOD_HAEIN        ---EIGR--------TTDPVRMYMREMGTVDLLTREDEISIAKRIEGGIDEVQTSISAYP
RPOD_PSEPU        ---DIRR--------TTDPVRMYMREMGTVELLTREGEIEIAKRIEEGIREVMGAIAHFP
RPOD_PSEAE        ---DIGR--------TTDPVRMYMREMGTVELLTREGEIEIAKRIEEGIREVMSAIAQFP
RPOD_PSEPH        ---DIGR--------TTDPVRMYMREMGTVELLTREGEIEIAKRIEEGIREVMGAIAHFP
RPOD_SHEVD        ---ELGR--------TTDPVRMYMREMGTVELLTREGEIVIAKRIEEGIYTVQASVAEYP
RPOD_BUCBP        ---ELGR--------TTDPVRMYMREMGTVELLTREGEIDIAKRIEDGINQVQCSVAEYP
RPOD_ECOLI        ---EIGR--------TTDPVRMYMREMGTVELLTREGEIDIAKRIEDGINQVQCSVAEYP
RPOD_SALTI        ---EIGR--------TTDPVRMYMREMGTVELLTREGEIDIAKRIEDGINQVQCSVAEYP
RPOD_SALTY        ---EIGR--------TTDPVRMYMREMGTVELLTREGEIDIAKRIEDGINQVQCSVAEYP
RPOD_BUCAI        ---ELGR--------TTDPVRMYMREMGTVELLTREGEIDIAKRIEEGINQVQCSVSEYP
RPOD_BUCAP        ---ELGR--------TTDPVRMYMREMGTVELLTREGEIDIAKRIEEGINQVQSSVSEYP
RPOD_LEPIC        -----SG--------SEDPIKLYLREIGKVSLISGETEVFLAKRIEKGEKIIEETILSSS
RPOD_LEPIN        -----SG--------SEDPIKLYLREIGKVSLISGETEVFLAKRIEKGEKIIEETILSSS
SIGA_CHLPN        --RTEGT--------PDDPVRMYLKEMGTVPLLTREEEVEISKRIEKAQVQIERIILRFR
SIGA_CHLMU        --RSEGT--------PDDPVRMYLKEMGTVPLLTREEEVEISKRIEKAQVQIERIILRFR
SIGA_CHLTR        --RSEGT--------PDDPVRMYLKEMGTVPLLTREEEVEISKRIEKAQVQIERIILRFR
RPOD_RICBR        ---------------TDDPVRLYLKDMGGVDLLTRENEVEIAKRIEEGRKTLIAALCRSP
RPOD_RICPR        --ENIGS--------TDDPVRLYLKDMGGVDLLTRENEVEIAKRIEEGRKTMTASLCRSP
RPOD_RICTY        --ENIGS--------TDDPVRLYLKDMGGVDLLTRENEVEIAKRIEEGRKTMTASLCRSP
RPOD_RICCN        --ENIGT--------TDDPVRLYLKDMGGVDLLTREHEVEIAKRIEEGHKTMIASLCRSP
RPOD_RICFE        --ENIGT--------TDDPVRLYLKDMGGVDLLTRENEVEIAKRIEEGRKTMTASLCKSP
RPOD_RHOCA        AGETLDR--------TDDPVRMYLREMGSVELLSREGEIAIAKRIEAGRNTMIAGLCESP
RPOD_RHOCB        --ETLDR--------TDDPVRMYLREMGSVELLSREGEIAIAKRIEAGRNTMIAGLCESP
RPOD_CAUVC        ---AYDR--------TDDPVRMYLREMGSVELLSREGEIAIAKRIEAGRDTMIRGLCESA
RPOD_AGRFC        KKEPTDR--------TDDPVRMYLREMGSVELLSREGEIAIAKRIEAGRETMISGLCESP
RPOD_RHIEC        KKEPTDR--------TDDPVRMYLREMGSVELLSREGEIAIAKRIEAGRETMIAGLCESP
RPOD_RHIME        KKEPTDR--------TDDPVRMYLREMGSVELLSREGEIAIAKRIEAGRETMIAGLCESP
SIGA_THET2        ---PKIS--------TSDPVRQYLHEIGQVPLLTLEEEVELARKVEEG------------
SIGA_THEAQ        ---PKVS--------TSDPVRQYLHEIGQVPLLTLEEEIDLARKVEEG------------
RPOD_MYXXA        --EPGGK--------SNDPVRLYLRKMGSVSLLTREGEVEIAKRIEDGEKEVLRALLACK
D7AZB5_NOCDD      ---------------GSDLVRLYLREIGRVPLLSAEQEVELAKAVEVG------------
SIGA_MYCTU        -----TA--------SADSVRAYLKQIGKVALLNAEEEVELAKRIEAG------------
SIGA_MYCBO        -----TA--------SADSVRAYLKQIGKVALLNAEEEVELAKRIEAG------------
SIGA_LACLA        ----NVR--------IDDPVRMYLKEIGRYPLISLDEETKLAEAIIAG------------
SIGA_STRMU        -----AK--------VNDPVRMYLKEIGVVPLLTNEEEKELAIAVENG------------
SIGA_STRPN        -----AK--------VNDPVRMYLKEIGVVPLLTNEEEKELALAVEAG------------
SIGA_STRR6        -----AK--------VNDPVRMYLKEIGVVPLLTNEEEKELALAVEAG------------
E3DLQ7_HALPG      --PDGAG--------IDDSVRVYLKEMGKVDLLDKEEEVELAKRIEQG------------
SIGA_CLOAB        --PEGIA--------IDDPVRMYLKEIGKVPLLSPEEEIDLAQRIKNG------------
SIGA_ENTFA        --PTGVK--------INDPVRMYLKEIGRVQLLTAAEEVELALKIEEG------------
SIGA_STAES        --PPGVK--------INDPVRMYLKEIGRVNLLSAQEEIELAKRIEQG------------
SIGA_STAEQ        --PPGVK--------INDPVRMYLKEIGRVNLLSAQEEIELAKRIEQG------------
SIGA_STAA8        --PPGVK--------INDPVRMYLKEIGRVNLLSAQEEIELAKRIEQG------------
SIGA_STAAC        --PPGVK--------INDPVRMYLKEIGRVNLLSAQEEIELAKRIEQG------------
SIGA_STAAM        --PPGVK--------INDPVRMYLKEIGRVNLLSAQEEIELAKRIEQG------------
SIGA_STAAR        --PPGVK--------INDPVRMYLKEIGRVNLLSAQEEIELAKRIEQG------------
SIGA_STAAS        --PPGVK--------INDPVRMYLKEIGRVNLLSAQEEIELAKRIEQG------------
SIGA_STAAW        --PPGVK--------INDPVRMYLKEIGRVNLLSAQEEIELAKRIEQG------------
SIGA_STAAN        --PPGVK--------INDPVRMYLKEIGRVNLLSAQEEIELAKRIEQG------------
SIGA_BACSP        -LPPGIK--------INDPVRMYLKEIGRVPLLSADDEVELAKRIMNG------------
SIGA_LISIN        --PPGVK--------INDPVRMYLKEIGRVDLLTADEEIALAKRIEAG------------
SIGA_LISMO        --PPGVK--------INDPVRMYLKEIGRVDLLTADEEIALAKRIEAG------------
SIGA_BACHD        --PPGVK--------INDPVRMYLKEIGRVPLLTAEEEIELATRIEQG------------
SIGA_BACSU        --PPGVK--------INDPVRMYLKEIGRVNLLSAKEEIAYAQKIEEG------------
                                   .         .   :                            

Q7NB90_MYCGA      AFKETDFSEQDELDDKEFNLSDFFSD----------------------------------
SIGA_MYCGE        ------------------------------------------------------------
SIGA_MYCPN        ------------------------------------------------------------
Q9PQE2_UREPA      ------------------------------------------------------------
RPOD_HELPY        YLIDFIYAYKDALINRERRVKELFRSFDDDD-----------------------------
RPOD_HELPJ        YLIDFIYAYKDALINRERRVKELFRSFDDDD-----------------------------
RPOD_BORBU        LVIENYYNLVNTIYSRMER-----------------------------------------
Q1ATP3_RUBXD      ------------------------------------------------------------
Q6YPU7_ONYPE      ------------------------------------------------------------
RPOD_TREPA        LLLPEFYHIGRSLSKKALAVLD--------------------------------------
A9WAH7_CHLAA      ------------------------------------------------------------
A2C7M0_PROM3      ------------------------------------------------------------
SIGA_SYNY3        ------------------------------------------------------------
SIGA1_SYNE7       ------------------------------------------------------------
SIGA_NOSS1        ------------------------------------------------------------
SIGA_MICAE        ------------------------------------------------------------
B8G6G0_CHLAD      ------------------------------------------------------------
D1C328_SPHTD      ------------------------------------------------------------
RPOD_NEIGO        GSIAEILELIEKICKDEIRVDEVVEAIIDPNE----------------------------
SIGA_THEMA        ------------------------------------------------------------
B9L102_THERP      DPLVLLLAAWERFVTG--------------------------------------------
RPOD_COXBU        ELIEKFIKEYDTIVATEGRLSDLLIGFFDEE-----------------------------
RPOD_XYLFA        LSTELLLSEYELHKEGKRRLTEVVVGFNDLI-----------------------------
RPOD_XYLFT        LSTELLLSEYELHKEGKRRLTEVVVGFNDLI-----------------------------
RPOD_XANAC        LSTEMLLADYEAHKEGKKRLAEIVVGFNDLI-----------------------------
RPOD_XANCP        LSTELLLSDYEAHKEGKKRLAEIVVGFNDLI-----------------------------
RPOD_HAEIN        EALNGLLKNYDDVEKGNFRLTDLITGFVDPN-----------------------------
RPOD_PSEPU        GTVDYILGEYDRVNRG-CRLSDVLSGYIDPD-----------------------------
RPOD_PSEAE        GTVDSILADYNRIVAEGGRLSDVLSGYIDPD-----------------------------
RPOD_PSEPH        GTVDHILSEYTRVTTEGGRLSDVLSGYIDPD-----------------------------
RPOD_SHEVD        PAIASILDQFDRYEAEEVRLSDIISGFIDPN-----------------------------
RPOD_BUCBP        EAITHLLEQYNRVELGELRLSELIHGFVDPN-----------------------------
RPOD_ECOLI        EAITYLLEQYDRVEAEEARLSDLITGFVDPN-----------------------------
RPOD_SALTI        EAITYLLEQYDRVEAEEARLSDLITGFVDPN-----------------------------
RPOD_SALTY        EAITYLLEQYDRVEAEEARLSDLITGFVDPN-----------------------------
RPOD_BUCAI        EAITYLLEQYDRVKTGQIRLSDIITGFVDPN-----------------------------
RPOD_BUCAP        EAITYLLEQYDRIKTGQIRLSDIITGFVDPN-----------------------------
RPOD_LEPIC        ILRANYIKLLPKIRSKKIKVYDLIRV----------------------------------
RPOD_LEPIN        ILRANYIKLLPKIRSKKIKVYDLIRV----------------------------------
SIGA_CHLPN        YSAKEAISIAHYLISGKERFDKIIS-----------------------------------
SIGA_CHLMU        YSTKEAVSIAQYLINGKERFDKIVS-----------------------------------
SIGA_CHLTR        YSTKEAVSIAQYLINGKERFDKIVS-----------------------------------
RPOD_RICBR        IAMDKFRKWYADLVNENNMLLRDLIDLESNM-----------------------------
RPOD_RICPR        IAMRCFIVWYEDLVNEKMLLRDLIDL----------------------------------
RPOD_RICTY        VAMRCFIVWYEDLVNEKMLLRDLIDL----------------------------------
RPOD_RICCN        IAMRCFIVWYEDLVNEKMLLRDLIDL----------------------------------
RPOD_RICFE        IAMRCFIVWYEDLVNEKMLLRDLIDL----------------------------------
RPOD_RHOCA        LTFQAITIWRDELLSEEILLRDVIDLEATFG-RSLDGDEGLEGMEGIEGPVVEGLDLEAA
RPOD_RHOCB        LTFQAITIWRDELLSEEILLRDVIDLEATFG-RSLDGDEGMEGMEGIEGPVVEGLDLETA
RPOD_CAUVC        LTFEAIMVWREELGTGRILLREVIDLEGTYA---------------------AINGVAAQ
RPOD_AGRFC        LTFQALIIWRDELNEGTTLLREIIDLETTYS-----GPEAKAAPQFQSPEKIEADRKAAE
RPOD_RHIEC        LTFQALIIWRDELNEGTTLLREIIDLETTYS-------GPEAKAAPQFQSPEKIEADRKA
RPOD_RHIME        LTFQALIIWRDELNEG-QTLLREIIDLETTYS---GPEAKAAPQFQSPEKIEADRKAAEE
SIGA_THET2        ------------------------------------------------------------
SIGA_THEAQ        ------------------------------------------------------------
RPOD_MYXXA        VAVEEILDIGNKLKTAKLRVRDVIKDAPE-------------------------------
D7AZB5_NOCDD      ------------------------------------------------------------
SIGA_MYCTU        ------------------------------------------------------------
SIGA_MYCBO        ------------------------------------------------------------
SIGA_LACLA        ------------------------------------------------------------
SIGA_STRMU        ------------------------------------------------------------
SIGA_STRPN        ------------------------------------------------------------
SIGA_STRR6        ------------------------------------------------------------
E3DLQ7_HALPG      ------------------------------------------------------------
SIGA_CLOAB        ------------------------------------------------------------
SIGA_ENTFA        ------------------------------------------------------------
SIGA_STAES        ------------------------------------------------------------
SIGA_STAEQ        ------------------------------------------------------------
SIGA_STAA8        ------------------------------------------------------------
SIGA_STAAC        ------------------------------------------------------------
SIGA_STAAM        ------------------------------------------------------------
SIGA_STAAR        ------------------------------------------------------------
SIGA_STAAS        ------------------------------------------------------------
SIGA_STAAW        ------------------------------------------------------------
SIGA_STAAN        ------------------------------------------------------------
SIGA_BACSP        ------------------------------------------------------------
SIGA_LISIN        ------------------------------------------------------------
SIGA_LISMO        ------------------------------------------------------------
SIGA_BACHD        ------------------------------------------------------------
SIGA_BACSU        ------------------------------------------------------------
                                                                              

Q7NB90_MYCGA      ---------------------------SKLDIDQPITAQKRQRGRKPKHAPSNEKNDLVY
SIGA_MYCGE        ------------------------------------------------------------
SIGA_MYCPN        ------------------------------------------------------------
Q9PQE2_UREPA      ------------------------------------------------------------
RPOD_HELPY        -------------------ENSVSDSKKDEDNEEDEENEERKKVVSEKDKKRVEKVQESF
RPOD_HELPJ        -------------------ENSVSDPKKDDDSEEDEENEERKKVVSEKDKKRVEKVQESF
RPOD_BORBU        ------------------------------EEFFKREKDKDKESSPDYYNKKKRIASFYK
Q1ATP3_RUBXD      ------------------------------------------------------------
Q6YPU7_ONYPE      ------------------------------------------------------------
RPOD_TREPA        ------------------------------PAESGRTRKEISEEMADRRRLKQAYGEVLR
A9WAH7_CHLAA      ------------------------------------------------------------
A2C7M0_PROM3      ------------------------------------------------------------
SIGA_SYNY3        ------------------------------------------------------------
SIGA1_SYNE7       ------------------------------------------------------------
SIGA_NOSS1        ------------------------------------------------------------
SIGA_MICAE        ------------------------------------------------------------
B8G6G0_CHLAD      ------------------------------------------------------------
D1C328_SPHTD      ------------------------------------------------------------
RPOD_NEIGO        ------------VLRNELGLGHLETTAPEKPSNDNSDENEDDEESEEDADEISAANLAEL
SIGA_THEMA        ------------------------------------------------------------
B9L102_THERP      ------------------------------------------------------------
RPOD_COXBU        -------------------ESTASPVAPEARDKEAETSDEDDGGEGGSDEFGES---GPD
RPOD_XYLFA        --------------------EEDNSVTSSVDVTDESIVEVDEEDDDSVGNDEDAPTIGPD
RPOD_XYLFT        --------------------EEDNSVTSSVDVTDESIVEVDEEDDDSVGNDEDAPMIGPD
RPOD_XANAC        -------------EEADAAAAALAAAGPVAVSDDEAVDEDDDEDGDDEAAEEEAGPTGPD
RPOD_XANCP        --------------EEADAAAAALAAAGPVAVDEDAVDEDADEDGDDDAAEEEAGPTGPD
RPOD_HAEIN        --------AEIEEHNGLDEDFSDEDDEEESSNADVEDNEDEEDNESESTSDSSDSDNSID
RPOD_PSEPU        ---------------DNIAAPTEEVPIPGTKAAAAKEEADDDEEESEGGDDEEEPKAALT
RPOD_PSEAE        --------------DGSLPAEEVEPVNLKDDSADSKEKDDEEEESDDSSDSDDEGDGGPD
RPOD_PSEPH        ----------------DGITPPAAEVPPPVDTKTAKADDDSEDEEAEATEDEEEAESGPD
RPOD_SHEVD        ------------AADI---APTATHIGSDLSQSERDKDDSKDDSKDDDEDEEEEGPKGPD
RPOD_BUCBP        ------------AEAVH--TSITNHINT--------NSEEHHHNDNTEENNDDD--HLVD
RPOD_ECOLI        ----------------AEEDLAPTATHVGSELSQEDLDDDEDEDEEDGDDDSADDDNSID
RPOD_SALTI        ----------------AEEEMAPTATHVGSELSQEDLDDDEDEDEEDGDDDAADDDNSID
RPOD_SALTY        ----------------AEEEMAPTATHVGSELSQEDLDDDEDEDEEDGDDDAADDDNSID
RPOD_BUCAI        ----------------AEEIFPPTAIHIGSELLDEQQNNEEDE---ENNQEDHEDDHSID
RPOD_BUCAP        ------------AEEIFSHSTSAIHIGSEILDNITNDSNENEDENEDENEDEDE--NSID
RPOD_LEPIC        ------------------------------------DKMYALNAEEAHKLEELFFKNILV
RPOD_LEPIN        ------------------------------------DKMYALNAEEAHKLEELFFKNILV
SIGA_CHLPN        ------------------------------------------------------------
SIGA_CHLMU        ------------------------------------------------------------
SIGA_CHLTR        ------------------------------------------------------------
RPOD_RICBR        ---------MHDDETSESEDDHNSDHEEEEQDHDHDHEENILSMSKVETQILPNIIERMK
RPOD_RICPR        ------------EANMLHDEVHENDEEHNSETEVEEHEDNHLSMSRVETQILHNIIDRMK
RPOD_RICTY        ------------EANMLHDEVHENDEEHNSETEVEEHEDNHLSMSRVETQILHNIIDRMK
RPOD_RICCN        ------------EANMLHDETPENDEENSSETEGEEHEDNHLSMSRVETQILPNIIERMK
RPOD_RICFE        ------------EANMLHDETPENDEEHSSETEGEEHEDNHLSMSRVETQILPNIIERMK
RPOD_RHOCA        EGAAPAARRPASDEPEYDADGNPISRIDEEEDDDDSSNMSLAAMEAALKPKVLETLELIA
RPOD_RHOCB        EGAAPAARRPASDEPEYDADGNPISRIDEEEDDDDSSNMSLAAMEAALKPKVLETLELIA
RPOD_CAUVC        PAAEDDEGPAEPVDDEAGEAKAEGAEGEDEDDFDDGAGPTVSAMEGELREGVMAILDAIA
RPOD_AGRFC        EKEKTRRLRAPTGDEDVTDVGGDGLPPEEEEEDDDESNLSLAAMEAELRPQVMETLDTIA
RPOD_RHIEC        AEEKEKTRRARSGDDDITDVGGEGLPPEEEEEDEDESNLSLAAMEAELRPQVMETLDIIA
RPOD_RHIME        KEKVRRTRTAANDDDITNVGGEGQAP-EEEEEDDDESNLSLAAMEAELRPQVMETLDVIA
SIGA_THET2        ------------------------------------------------------------
SIGA_THEAQ        ------------------------------------------------------------
RPOD_MYXXA        -------------------ETQSEGAEEAPEEVGEGDAPAQLAQSELNKIEQICKQIERF
D7AZB5_NOCDD      ------------------------------------------------------------
SIGA_MYCTU        ------------------------------------------------------------
SIGA_MYCBO        ------------------------------------------------------------
SIGA_LACLA        ------------------------------------------------------------
SIGA_STRMU        ------------------------------------------------------------
SIGA_STRPN        ------------------------------------------------------------
SIGA_STRR6        ------------------------------------------------------------
E3DLQ7_HALPG      ------------------------------------------------------------
SIGA_CLOAB        ------------------------------------------------------------
SIGA_ENTFA        ------------------------------------------------------------
SIGA_STAES        ------------------------------------------------------------
SIGA_STAEQ        ------------------------------------------------------------
SIGA_STAA8        ------------------------------------------------------------
SIGA_STAAC        ------------------------------------------------------------
SIGA_STAAM        ------------------------------------------------------------
SIGA_STAAR        ------------------------------------------------------------
SIGA_STAAS        ------------------------------------------------------------
SIGA_STAAW        ------------------------------------------------------------
SIGA_STAAN        ------------------------------------------------------------
SIGA_BACSP        ------------------------------------------------------------
SIGA_LISIN        ------------------------------------------------------------
SIGA_LISMO        ------------------------------------------------------------
SIGA_BACHD        ------------------------------------------------------------
SIGA_BACSU        ------------------------------------------------------------
                                                                              

Q7NB90_MYCGA      HEVLEASSKTKNNDQESIRATKTLLAKAKATKSLSNEEIIDVFKNYEFTEAEDLEILEEL
SIGA_MYCGE        -----------------TEAWEKKSKKKQKNITLSNKEIISVLAKFELPEDEIIYVLDEL
SIGA_MYCPN        ---------------------WEKKNKKKDNNSLSNKDIVNVLSKFELPDDEIIFVLDEL
Q9PQE2_UREPA      ------------------------------------------------------------
RPOD_HELPY        KALDKAKKEWLKALEAPIDEREDELVRS-LTLAYKRQTLKDRLYDLEPTSKLINELVKTM
RPOD_HELPJ        KALDKAKKEWLKALEAPIDEKEDELVRS-LTLAYKRQTLKDRLYDLEPTSKLINELVKTM
RPOD_BORBU        IPLKPIQDRLISYVDNKHRVYDLGGDIFEKNLKKERLALKELLRDIPLYQEELRIFSDDY
Q1ATP3_RUBXD      ------------------------------------------------------------
Q6YPU7_ONYPE      ------------------------------------------------------------
RPOD_TREPA        SLYPEMRHYMAMKKRLDERGEPVTVLSSDEEVCKQRDKLLSCLQKVDLQLEEIDRFSRKF
A9WAH7_CHLAA      ------------------------------------------------------------
A2C7M0_PROM3      ------------------------------------------------------------
SIGA_SYNY3        ------------------------------------------------------------
SIGA1_SYNE7       ------------------------------------------------------------
SIGA_NOSS1        ------------------------------------------------------------
SIGA_MICAE        ------------------------------------------------------------
B8G6G0_CHLAD      ------------------------------------------------------------
D1C328_SPHTD      ------------------------------------------------------------
RPOD_NEIGO        KQKVIGHFAQIEKDYKKMIGCLEKHHSRHKDYLAYRDAIANKLLEVRFATRQIDSLSSSL
SIGA_THEMA        ------------------------------------------------------------
B9L102_THERP      ---------------------WPLVERLAQRLPGKRETRTAVLAAILPLRSLPPVLLRQF
RPOD_COXBU        PLITQQHMEELKKLYGRYQNAIKRYGKKAPATLKHQKALAELFSTFKLSIKQFNRLTGQL
RPOD_XYLFA        PAEVASRIESLSTEYAKFKKLYAKHGPEHKAVIKVREDVAAIFVTFKLSLPLTDLLVQQL
RPOD_XYLFT        PAEVASRIESLSTEYAKFKKLYAKHGPEHKAVIKVREDVAAIFVTFKLSLPLTDLLVQQL
RPOD_XANAC        PVEVATRMENLANEYAKFKKVYAKNGAEHKLVVKAREDMAAIFTTLKLPLPLTDALVTQL
RPOD_XANCP        PVEVATRMENLANEYAKFKKAYVKYGAEHKNVAKAREDMAAIFTTLKLPLPLTDALVTQL
RPOD_HAEIN        PEVAREKFQQLREQHSKTLAVIEKHGRSGKRAQDQIALLGEIFKQFRLVPKQFDLLVLSM
RPOD_PSEPU        RSSQPSVSVRYPSSFSDHQGPEEKRSYPQGK-RRALQALADLFMPIKLVPKQFEVLVERV
RPOD_PSEAE        PEEARLRFTAVSEQLDKAKKALKKHGRGSKQATAELTGLAELFMPIKLVPKQFDALVARV
RPOD_PSEPH        PVIAAQRFGAVADQMEVTRKALKKHGRENKQAIAEMLALAELFMPIKLVPKQFEGLVERV
RPOD_SHEVD        PEESKERFTQLREVHENTLKIIADKGRGHPEATVALFEIGELFKEFRLMPKQFDRLVKNM
RPOD_BUCBP        PELAREKFIALKNQYHITNYAIKTKNRNHQDTLIEINNLSEIFKQFRLVPKQFDHLVINM
RPOD_ECOLI        PELAREKFAELRAQYVVTRDTIKAKGRSHATAQEEILKLSEVFKQFRLVPKQFDYLVNSM
RPOD_SALTI        PELAREKFAELRAQYVVTRDTIKAKGRSHAAAQEEILKLSEVFKQFRLVPKQFDYLVNSM
RPOD_SALTY        PELAREKFAELRAQYVVTRDTIKAKGRSHAAAQEEILKLSEVFKQFRLVPKQFDYLVNSM
RPOD_BUCAI        PELANEKFSELRIQYNNTNNTIKNKNRTHKDSLLEIYNLSEVFKQFRLVPKQFDHLVNNM
RPOD_BUCAP        PELANEKFRELRKQYTNTSNTIKNKNRNHQDSLLEIYNLSEIFKQFRLVPKQFDHLVNNM
RPOD_LEPIC        IQEQEKVLQEAVSKIRKYSETSKKYKEFKEKIDASTEIIHNAIRELGVSQKEIQKISQKI
RPOD_LEPIN        IQEQEKVLQEAVSKIRKYSETSKKYKEFKEKIDASTEIIHNAIRELGVSQKEIQKISQKI
SIGA_CHLPN        -----EKEVEDKTHFLKLLPKLITLLKEEDTYLENLLLSLKQPDLSKQEAAKLNDSLEKC
SIGA_CHLMU        -----EKEVEDKTHFLNLLPKLISLLKEEDSYLEERLLALKDPALSKQDQAKLNDELEKC
SIGA_CHLTR        -----EKEVEDKTHFLNLLPKLISLLKEEDAYLEERLLALKDPALSKPDQARLNDELEKC
RPOD_RICBR        KIAFICEELLIETKKSFEKSAGPKILQNSKKYNDNLELLISEVSEIHFNSKRTEEILSEM
RPOD_RICPR        KISFICEELLIEAKKCYEESFEPKVLQNSKKYNNNLELLINEVSEIHFNSKRTEEILGKM
RPOD_RICTY        KISFICEELLIEAKKCYEESFDPKVLQNSRKYNNNLELLIHEVSEIHFNSKRTEEILGKM
RPOD_RICCN        KIAFICEELLIEAKKCYEKSFEPKVLQNSKKY-NNLELLINEVSEIHFNSKRTEEILGKM
RPOD_RICFE        KISFICEELLIEAKKCYEKSFEPKVLQNSKKYNNNLELLINEVSEIHFNSKRTEEILGKM
RPOD_RHOCA        RDYAKLAEMQDLRMSATLNEDGTFTVAEEAAYQKLRSEIVLLVNELHLHNNRIEALIDQL
RPOD_RHOCB        RDYAKLAEMQDLRMSATLNEDGTFSVAEEAAYQKLRSEIVLLVNELHLHNNRIEALIDQL
RPOD_CAUVC        SEFEAFRKLQDKLVGSRLKG-EDLSDADRKAYEGLSATIIQHLKTLKLNNNRIEALVEQL
RPOD_AGRFC        DTYKKLRKLQDQQVEARLACTGTLSSGQERRYKELKDQLITAVKSLSLNQNRIDSLVEQL
RPOD_RHIEC        ETYKKLRKLQDQQVEQRLAATGTLSSAQERRYKELKDELIKAVKSLSLNQNRIDALVEQL
RPOD_RHIME        ETYKKLRKLQDQQVEARLAATGTLSPAQERRYKELKDELIKAVKSLSLNQNRIDALVEQL
SIGA_THET2        ------------------------------------------------------------
SIGA_THEAQ        ------------------------------------------------------------
RPOD_MYXXA        RKFAQDCDVLEEELSSKKKLTEVRKKEVKQEIKDLRTKMMEVLEEMRLNKKQVDRIVINL
D7AZB5_NOCDD      ------------------------------------------------------------
SIGA_MYCTU        ------------------------------------------------------------
SIGA_MYCBO        ------------------------------------------------------------
SIGA_LACLA        ------------------------------------------------------------
SIGA_STRMU        ------------------------------------------------------------
SIGA_STRPN        ------------------------------------------------------------
SIGA_STRR6        ------------------------------------------------------------
E3DLQ7_HALPG      ------------------------------------------------------------
SIGA_CLOAB        ------------------------------------------------------------
SIGA_ENTFA        ------------------------------------------------------------
SIGA_STAES        ------------------------------------------------------------
SIGA_STAEQ        ------------------------------------------------------------
SIGA_STAA8        ------------------------------------------------------------
SIGA_STAAC        ------------------------------------------------------------
SIGA_STAAM        ------------------------------------------------------------
SIGA_STAAR        ------------------------------------------------------------
SIGA_STAAS        ------------------------------------------------------------
SIGA_STAAW        ------------------------------------------------------------
SIGA_STAAN        ------------------------------------------------------------
SIGA_BACSP        ------------------------------------------------------------
SIGA_LISIN        ------------------------------------------------------------
SIGA_LISMO        ------------------------------------------------------------
SIGA_BACHD        ------------------------------------------------------------
SIGA_BACSU        ------------------------------------------------------------
                                                                              

Q7NB90_MYCGA      KDNKIKLEDNVEEKISL-----------FRKNQDLSEIDKNLDDLISKGAST--------
SIGA_MYCGE        RDKGIQLQH---------------DVEEHIHEFRANQDLSIIDEDIEELTSK----NISN
SIGA_MYCPN        RDKGIELPH---------------DVEEHIHEFRANQDLSIIDEDIEELTTK----NISN
Q9PQE2_UREPA      ------------------------------------------------------------
RPOD_HELPY        ETTLKSGDGFEKELKRLEYKLPLFNDTLIANHKKILANITNMTKEDIIAQVP--EATMVS
RPOD_HELPJ        ETTLKSGDGFEKELKRLEYKLPLFNDTLIANHKKILANITNMTKEDIIAQVP--EATMVS
RPOD_BORBU        IDSANKIKDLQRQQRIILSRLKIEKIRDLRVLGRDLTIAEKKIEIEKSLKLK--EDAIKE
Q1ATP3_RUBXD      ------------------------------------------------------------
Q6YPU7_ONYPE      ------------------------------------------------------------
RPOD_TREPA        LDTARKIREYKRRKDRHEKQLMIADLCDMRKIGRGLAVPRQRAKLEETLGMS--ADCIQE
A9WAH7_CHLAA      ------------------------------------------------------------
A2C7M0_PROM3      ------------------------------------------------------LLHLEE
SIGA_SYNY3        -------LELIRDNLTLQLERQPSELEWGKQVWKLETAKQRLVGDKKKEPKK------KD
SIGA1_SYNE7       ------------------------------------------------------LLALER
SIGA_NOSS1        -------------LLEL--------------------------------------ERVRE
SIGA_MICAE        ----------------LKLERIREDFCLYSDAEWGKQVFLFERIEKIIVEKSEKEPKLSD
B8G6G0_CHLAD      ------------------------------------------------------------
D1C328_SPHTD      ------------------------------------------------------------
RPOD_NEIGO        RGKVENIRKLEREIRDICLDRVHMERDYFIQNFLPEITNLQWIEEEIAKGRV-WSNALDR
SIGA_THEMA        ------------------------------------------------------------
B9L102_THERP      RGKDGRSVEELEDTLR-----------------------------CRRLEFALFPEPLQR
RPOD_COXBU        RRMLRAARAQERLIMSYCVVKAKTPRKKFIASFPHNETNMKWLEQYKNENKE-QAKRLEK
RPOD_XYLFA        QNMVNSVKDHERKVLHLATNVAKMPRKDFIRSWENNQTNLEWVEDAIKRKQK-WSSALRD
RPOD_XYLFT        QNMVNSVKDHERKVLHLATNVAKMPRKDFIRSWENNQTNLEWVEDAIKRKQK-WSSALRD
RPOD_XANAC        RGVVNGIKDHERKVLHLATTVARMPRKDFIRSWEGNQTNLEWVEDALKRKQK-WSSALRD
RPOD_XANCP        RGVVNGIKDHERKVLHLATTVARMPRKDFIRSWEGNQTNLEWVEDALKRKQK-WSSALRD
RPOD_HAEIN        KEMMKRVRYQERQLQKILVDIAGMPKDDFEKIITTNGSNSEWVAKALKSSKP-WAKRLIK
RPOD_PSEPU        RDALNRLRQQERAIMQLCVRDARMPRADFLRMFPSNETDQTWSGDLAKRNTK-WAAALGE
RPOD_PSEAE        RSALEGVRAQERAIMQLCVRDARMPRADFLRLFPNHETDEKWVDSVLKSKPK-YAEAIER
RPOD_PSEPH        RSALDRLRQQERAIMQLCVRDARMPRADFLRQFPGNEVDESWTDALAKGKSK-YAEAIAR
RPOD_SHEVD        RATMDKVRVQERLIMKLCVEQAKMPKKNFVKGYTADESSIAWFDTELASKKP-YAEGLKM
RPOD_BUCBP        RKMMQKIRIQERNIAKLCIEYGNIPKKALLNFFSLQKTNQIWSKIVQNIKKP-WIDKFNT
RPOD_ECOLI        RVMMDRVRTQERLIMKLCVEQCKMPKKNFITLFTGNETSDTWFNAAIAMNKP-WSEKLHD
RPOD_SALTI        RVMMDRVRTQERLIMKLCVEQCKMPKKNFITLFTGNETSETWFNAAIAMNKP-WSEKLHD
RPOD_SALTY        RVMMDRVRTQERLIMKLCVEQCKMPKKNFITLFTGNETSETWFNAAIAMNKP-WSEKLHD
RPOD_BUCAI        RHMMERVRKQERIIIKLCVEICKMPKKNFIKIFPIKKINYLWFIREQNTNQP-WSENLKK
RPOD_BUCAP        RNMMNRVRKQERKIMKLCIEECKIPKKIFLKIFSGKETDQNWFKKEQSSNQS-WSKKLEE
RPOD_LEPIC        KSMVFRIKEIDRHFLKIK-AQYGQDVRDIKAFNRFIEKNEKLDDIEVKMGVN--IDEVRE
RPOD_LEPIN        KSMVFRIKEIDRHFLKIK-AQYGQDVRDIKAFNRFIEKNEKLDDIEVKMGVN--IDEVRE
SIGA_CHLPN        RIRTQAYLRCFHCRHNVTEDFGEVVFKAYDSFLHLEQQINDLKVRAERNKFA--------
SIGA_CHLMU        RIRTQAYLRCFHCRHNVTEDFGEVVFKAYDSFLQLEQQINDLKVRAERNKFA--------
SIGA_CHLTR        RIRTQAYLRCFHCRHNVTEDFGEVVFKAYDSFLQLEQQINDLKARAERNKFA--------
RPOD_RICBR        YRINRDLINKETAFLKLA-EKYGITRQNFLDEYIGAVINAAWKEKMLKNKKAGWKELLTK
RPOD_RICPR        YGINRDLINKETAFLKLA-EKYGVTRQNFLDEYIGSVINAAWKEKMLKNKKVAWKELITK
RPOD_RICTY        YGINRDLINKETAFLKLA-EKYGVTRQNFLDEYIGSVINAAWKEKMLKNKKVAWKELITK
RPOD_RICCN        YGINRDLINKETAFLKLA-EKYGVTRQNFLDEYIGSVINAAWKEKMLKNKKVAWKELMTK
RPOD_RICFE        YGINRDLINKEIAFLKLA-EKYGVTRQNFLDEYIGSVINAAWKEKMLKNKKVAWKELITK
RPOD_RHOCA        YGINRKIMSIDSGMVKLA-DAARINRREFIDEYRGYELDPTWMDRMSAKPARAWVTLFEK
RPOD_RHOCB        YGINRKIMSIDSGMVKLA-DAARINRREFIDEYRGYELDPTWMDRMSAKPARAWVTLFEK
RPOD_CAUVC        YAINKRLIGLEGRLLRLA-DSYGISRGEFLKAYFGSELNPTWSEQVKAMGVR-WTKFVEN
RPOD_AGRFC        YDISKRLMQNEGRLLRLA-ESYGVKRDSFLEQYHGAELDPNWMKSITNLAARGWKEFARE
RPOD_RHIEC        YDINKRLVQNEGRLLRLA-ESYGVKRDSFLEQYQGAELDPNWMKSIGNLAARGWKEFAKA
RPOD_RHIME        YDISKRLTQNEGRLLRLA-ESYGVKREAFLEQYSGAELDPNWMKSISNLAGKGWKEFARA
SIGA_THET2        -------------------------MEAIKKLSEITGLDPDLIREVVRAKILGSARVRHI
SIGA_THEAQ        -------------------------MEAIKKLSEATGLDQELIREVVRAKILGTARIQKI
RPOD_MYXXA        KALIERVDKAEDELRDLE-RRYDCSMKELRPQLKESRENPNIGKKLQKQLNL-TPEQLEV
D7AZB5_NOCDD      ------------------------------------------------------------
SIGA_MYCTU        ------------------------------------------------------------
SIGA_MYCBO        ------------------------------------------------------------
SIGA_LACLA        ------------------------------------------------------------
SIGA_STRMU        ------------------------------------------------------------
SIGA_STRPN        ------------------------------------------------------------
SIGA_STRR6        ------------------------------------------------------------
E3DLQ7_HALPG      ------------------------------------------------------------
SIGA_CLOAB        ------------------------------------------------------------
SIGA_ENTFA        ------------------------------------------------------------
SIGA_STAES        ------------------------------------------------------------
SIGA_STAEQ        ------------------------------------------------------------
SIGA_STAA8        ------------------------------------------------------------
SIGA_STAAC        ------------------------------------------------------------
SIGA_STAAM        ------------------------------------------------------------
SIGA_STAAR        ------------------------------------------------------------
SIGA_STAAS        ------------------------------------------------------------
SIGA_STAAW        ------------------------------------------------------------
SIGA_STAAN        ------------------------------------------------------------
SIGA_BACSP        ------------------------------------------------------------
SIGA_LISIN        ------------------------------------------------------------
SIGA_LISMO        ------------------------------------------------------------
SIGA_BACHD        ------------------------------------------------------------
SIGA_BACSU        ------------------------------------------------------------
                                                                              

Q7NB90_MYCGA      KDKVEDNVKAFLGTLGSSKILNFGEEIQIAKLLGSTDPETREYAINQLVTSNLRLVTSIA
SIGA_MYCGE        RDKVDDNVRFFLGSLDFSKMLDFESEQRIAKVLNSTDEESRKYAINQLVTSNLRLVVSIA
SIGA_MYCPN        RDKVDDNVRFFLGSLDSSKMLDFESEQRIAKVLNSTDEESRKYAINQLVTSNLRLVVSIA
Q9PQE2_UREPA      -----------------------------------DPSLVKI-GKNQLYTSNMRLVTSIA
RPOD_HELPY        VYMDLKKLFLTKEASEEGFDLAPNKLKEILEQIKRGKLISDR-AKNKMAKSNLRLVVSIA
RPOD_HELPJ        VYMDLKKLFLTKEASEEGFDLAPNKLKEILEQIKRGKLISDR-AKNKMAKSNLRLVVSIA
RPOD_BORBU        QITEAQLAQKELERIEMYYEYPTDKIISMSEEIAKGKQMMQH-AKDQLIKANLRLVVSIA
Q1ATP3_RUBXD      -------------------------------------------SKDKLVEANLRLVVSIA
Q6YPU7_ONYPE      --------KQAKQKLAKHKTKEIELSEEQLQEAHDQIEQARR-AKDILVESNYRLVVSIA
RPOD_TREPA        IYTQIQKVTRRLRRIEYDFENTIDGILSMARAIHRGHVMLKK-AKDKLINANLRLVVSIA
A9WAH7_CHLAA      -----QEAERKLATLPPDS----PEAARLKQLKAKGEE-----ARQQMAAANLRLVVSIA
A2C7M0_PROM3      LAEQFNSDHGHYPNNKEWAALVEMPNIKFRRRLMLGRR-----AKEKMVQSNLRLVVSIA
SIGA_SYNY3        IDSYLANPDNELSLENEWSQQPNKNFAAFRRRLFLDRR-----AKDKMVQSNLRLVVSIA
SIGA1_SYNE7       IRDELLEQLDRLPSDAEWAAAVDSPLDEFRRRLFRGRR-----AKDKMVQSNLRLVVSIA
SIGA_NOSS1        RLSEKLERDPRDSEWAEAVQLPLPAFRYRLHIGRR--------AKDKMVQSNLRLVVSIA
SIGA_MICAE        IKAYLGKTELTAPLLEEWLAKSKEYLSAFKRRLYHGRR-----AKEKMVQSNLRLVVSIA
B8G6G0_CHLAD      --------AIARQRLDREEYASARERFELERAVQQGQD-----ARHHLIQANLRLVVSIA
D1C328_SPHTD      -----KIAEERLANGDYASEAERAELLAD-------KEDGEK-ARAHLIQANLRLVVSVA
RPOD_NEIGO        FRHAILEKQTELADMEKETRISIEELKEINKNMVSSEKVSAA-AKQEMIQANLRLVISIA
SIGA_THEMA        ------------------------------------DKK----AKEKLITSNLRLVVSIA
B9L102_THERP      WCDPLERRLPPIPPLNELGLDRTALIAHWQRLRRDGEA-----ARRKLTEANLRLVVSIA
RPOD_COXBU        YSKEIYRAQRNLAQLEEQNNLNIQEIKEINRRVAIGEAKSRR-AKKEMIEANLRLVISIA
RPOD_XYLFA        IKDQITAEQQASIDLEKANSLTLADIKEINRMMVYGEAKASK-AKKEMVEANLRLVISIA
RPOD_XYLFT        IKDQITAEQQASIDLEKVNSLTLADIKEINRMMVYGEAKASK-AKKEMVEANLRLVISIA
RPOD_XANAC        VKDQIISEQQGSIEMEKANYLTLGEIKEISRAMAYGEAKARK-AKKEMVEANLRLVISIA
RPOD_XANCP        VKDQIVSEQQGSIEMEKANYLTLAEIKDISRAMAYGEAKARK-AKKEMVEANLRLVISIA
RPOD_HAEIN        YEDRIYEALNNLAITEENTKLTITQMRDICDAVARGEQKARR-AKKEMVEANLRLVISIA
RPOD_PSEPU        KDAAIVACQQKLIDLETETGLTVAEIKEINRRMSIGEAKARR-AKKEMVEANLRLVISIA
RPOD_PSEAE        LRDDILRNQQKLAALESEVELTVAEIKEINRAMSIGEAKARR-AKKEMVEANLRLVISIA
RPOD_PSEPH        LQPDIIRCQQKLTALEVETGLKIAEIKDINRRMSIGEAKARR-AKKEMVEANLRLVISIA
RPOD_SHEVD        IEPDVRRCRFKLDIIEKETGLAIASIKDINRRMSIGEAKARR-AKKEMVEANLRLVISIA
RPOD_BUCBP        IKPDIQMILKKLQKVEEETGLTIHQVKNINKRISLGEAKAKR-AKKEMVEANLRLVISIA
RPOD_ECOLI        VSEEVHRALQKLQQIEEETGLTIEQVKDINRRMSIGEAKARR-AKKEMVEANLRLVISIA
RPOD_SALTI        VAEEVQRCLQKLRQIEEETGLTIEQVKDINRRMSIGEAKARR-AKKEMVEANLRLVISIA
RPOD_SALTY        VAEEVQRCLQKLRQIEEETGLTIEQVKDINRRMSIGEAKARR-AKKEMVEANLRLVISIA
RPOD_BUCAI        VKEDVFISVKKLIKIEEETGLTIEQVKDINKRMSIGEAKARR-AKKEMVEANLRLVISIA
RPOD_BUCAP        IKEKVFSSMKKLKQIEKETGLTIEQVKDINKRMSIGEAKAKR-AKKEMVEANLRLVISIA
RPOD_LEPIC        VIKDIRNNERKLRRMEQEAGSTVQEIKDWGEKIIKGEREISQ-AKKELVKANLRLVVSIA
RPOD_LEPIN        VIKDIRNNERKLRRMEQEAGSTVQEIKDWGEKIIKGEREISQ-AKKELVKANLRLVVSIA
SIGA_CHLPN        -AAKLAAAKRKLYKREVAAGRTLEEFKKDVRMLQRWMDKSQE-AKKEMVESNLRLVISIA
SIGA_CHLMU        -AAKLAAARRKLYKREVAAGRTLEEFKKDVRMLQRWMDKSQE-AKKEMVESNLRLVISIA
SIGA_CHLTR        -AAKLAAARRKLHKREVAAGRTLEEFKKDVRMLQRWMDKSQE-AKKEMVESNLRLVISIA
RPOD_RICBR        ESDYIDQMIAELSAIEINTGLLVNDFKKLVNAIQKSERQTLQ-AKKDMIEANLRLVISIA
RPOD_RICPR        ESDYIDQMINELSVIESNTGLLVNDFKKLVNTIQKSERQTLQ-AKKDMIEANLRLVISIA
RPOD_RICTY        ESDYIDQMINELSVIESNTGLLVNDFKKLVNTIQKSERQTLQ-AKKDMIEANLRLVISIA
RPOD_RICCN        ESDYIDQMIAELSVIESKTGLLVNDFKKLVNTIQKSERQTLQ-AKKDMIEANLRLVISIA
RPOD_RICFE        ESDYIDQMIAELSVIESNTGLLVNDFKKLVNTIQKSERQTLQ-AKKDMIEANLRLVISIA
RPOD_RHOCA        SRHKVEDLRHEMAQVGQYVGVDISEFRRIVNQVQKGEKEARQ-AKKEMVEANLRLVISIA
RPOD_RHOCB        SRDKVEDLRHEMAQVGQYVGVDISEFRRIVNQVQKGEKEARQ-AKKEMVEANLRLVISIA
RPOD_CAUVC        DSQSVTDIRSEIAALATETGVPIDDYRRIVQTVQKGEREARQ-AKKEMVEANLRLVISIA
RPOD_AGRFC        ESNTIREIRQEIQNLSTETGISIAEFRRIVSMVQKGEREARI-AKKEMVEANLRLVISIA
RPOD_RHIEC        ENTTIRDIRQEIQNLATETGISISEFRRIVHMVQKGEREARI-AKKEMVEANLRLVISIA
RPOD_RHIME        ENQTIRDIRQEIQNLATETGISIAEFRRIVSMVQKGEREARI-AKKEMVEANLRLVISIA
SIGA_THET2        PGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEA-----ARQHLIEANLRLVVSIA
SIGA_THEAQ        PGLKEKPDPKTVEEVDGKLKSLPKELKRYLHIAREGEA-----ARQHLIEANLRLVVSIA
RPOD_MYXXA        LDRDVRTAVRKIKKVEEEANLPVESLRRNYDAIRLGERRAER-AKSELVEANLRLVVSIA
D7AZB5_NOCDD      --------------LYAQHCAPVEGVRTAEELACLVEEGRR--AKRSLIEANLRLVVSIA
SIGA_MYCTU        ----LYATQLMTELSERGEKLPAAQRRDMMWICRDGDR-----AKNHLLEANLRLVVSLA
SIGA_MYCBO        ----LYATQLMTELSERGEKLPAAQRRDMMWICRDGDR-----AKNHLLEANLRLVVSLA
SIGA_LACLA        ---------------------------------GEGAEF----AKQMLAEANLRLVVSIA
SIGA_STRMU        ------------------------------------DLE----AKQRLAEANLRLVVSIA
SIGA_STRPN        ------------------------------------DIE----AKQRLAEANLRLVVSIA
SIGA_STRR6        ------------------------------------DIE----AKQRLAEANLRLVVSIA
E3DLQ7_HALPG      ------------------------------------DQR----AREQLTEANLRLVVSIA
SIGA_CLOAB        ------------------------------------DRS----ARKKLAEANLRLVVSIA
SIGA_ENTFA        ------------------------------------DQE----AKQRLAEANLRLVVSIA
SIGA_STAES        ------------------------------------DEI----AKSRLAEANLRLVVSIA
SIGA_STAEQ        ------------------------------------DEI----AKSRLAEANLRLVVSIA
SIGA_STAA8        ------------------------------------DEV----AKSRLAEANLRLVVSIA
SIGA_STAAC        ------------------------------------DEV----AKSRLAEANLRLVVSIA
SIGA_STAAM        ------------------------------------DEV----AKSRLAEANLRLVVSIA
SIGA_STAAR        ------------------------------------DEV----AKSRLAEANLRLVVSIA
SIGA_STAAS        ------------------------------------DEV----AKSRLAEANLRLVVSIA
SIGA_STAAW        ------------------------------------DEV----AKSRLAEANLRLVVSIA
SIGA_STAAN        ------------------------------------DEV----AKSRLAEANLRLVVSIA
SIGA_BACSP        ------------------------------------DEE----AKRRLAEANLRLVVSIA
SIGA_LISIN        ------------------------------------DIE----AKGRLAEANLRLVVSIA
SIGA_LISMO        ------------------------------------DIE----AKGRLAEANLRLVVSIA
SIGA_BACHD        ------------------------------------DEE----AKRRLAEANLRLVVSIA
SIGA_BACSU        ------------------------------------DEE----SKRRLAEANLRLVVSIA
                                                             .   :  :* *** *:*

Q7NB90_MYCGA      KKYLNRGLDFVDLIQEGSIGLMKAISKFNYKLGNKFSTYATWWIRQAITRAIADQARTVR
SIGA_MYCGE        KKHLERGLDFNDLIQEGNLGLLKAISKFNWSLGNKFSTYATWWIKQAITRAIADQARTVR
SIGA_MYCPN        KKHLERGLDFNDLIQEGNLGLLKAISKFNWSLGNKFSTYATWWIKQAITRAIADQARTVR
Q9PQE2_UREPA      KKYLNRGLDLEDLIQEGSSGLLKAIDKFDHEKGHKFSTYATWWIRQSITRAIADQARQIR
RPOD_HELPY        KRFTSRGLPFLDLIQEGNIGLMKAVDKFEHEKGFKFSTYATWWIKQAISRAIADQARTIR
RPOD_HELPJ        KRFTSRGLPFLDLIQEGNIGLMKAVDKFEHEKGFKFSTYATWWIKQAISRAIADQARTIR
RPOD_BORBU        KKYANRGLHFFDLVQEGNIGLIKAVEKFEYKRGFKFSTYATWWIRQAITRSISDQARTIR
Q1ATP3_RUBXD      KKYRNRGVSFLDLIQEGNIGLIRAAEKFDYRKGFKFSTYATWWIRQAITRAIADKGRTIR
Q6YPU7_ONYPE      KRYIGRGILFLDLIQEGNMGLMRAVDKFDYQKGFKFSTYATWWIRQAITRAIADQARTIR
RPOD_TREPA        KKYTNRGLLFFDLVQEGNIGLIKAVEKFEYRKGYKFSTYATWWIRQAITRSISDQARTIR
A9WAH7_CHLAA      KRYRDRGLPLLDLIQEGSLGLLRAIEKFDYTKGYKFSTYATWWIKQALSRALADQSRLVR
A2C7M0_PROM3      KKYMNRGLSFQDLIQEGSLGLIRAAEKFDHEKGYKFSTYATWWIRQAITRAIADQSRTIR
SIGA_SYNY3        KKYMNRGLSFQDLIQEGSLGLIRAAEKFDHEKGYKFSTYATWWIRQAITRAIADQSRTIR
SIGA1_SYNE7       KKYMNRGLSFQDLIQEGSLGLIRAAEKFDHEKGYKFSTYATWWIRQAITRAIADQSRTIR
SIGA_NOSS1        KKYMNRGLSFQDLIQEGSLGLIRAAEKFDHEKGYKFSTYATWWIRQAITRAIADQSRTIR
SIGA_MICAE        KKYMNRGLSFQDLIQEGSLGLIRAAEKFDHEKGYKFSTYATWWIRQAITRAIADQSRTIR
B8G6G0_CHLAD      KKYTSYGLTMMDLVQEGNIGLMRAVEKFDYKKGHKFSTYATWWIRQAITRAIADQSRTIR
D1C328_SPHTD      KKYVGRGLSFLDLIQEGNIGLMKATDKFDYKRGFKFSTYATWWIRQAITRAISDQSRTIR
RPOD_NEIGO        KKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIR
SIGA_THEMA        KRYMGRGLSFQDLIQEGNIGLLKAVEKFDWRKGYKFSTYATWWIRQAITRAIADQARTIR
B9L102_THERP      KRYTGRGLTLLDLIQEGNLGLMRAVDKFQTHKGFKFSTYATWWIRQAITRALADHARTIR
RPOD_COXBU        KKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIR
RPOD_XYLFA        KKYTNRGLQFLDLIQEGNIGLMKAVCKFEHRRGFKFSTYATWWIRQAITRSIADQARTIR
RPOD_XYLFT        KKYTNRGLQFLDLIQEGNIGLMKAVCKFEHRRGFKFSTYATWWIRQAITRSIADQARTIR
RPOD_XANAC        KKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIR
RPOD_XANCP        KKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIR
RPOD_HAEIN        KKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIR
RPOD_PSEPU        KKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIR
RPOD_PSEAE        KKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIR
RPOD_PSEPH        KKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIR
RPOD_SHEVD        KKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIR
RPOD_BUCBP        KKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIR
RPOD_ECOLI        KKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIR
RPOD_SALTI        KKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIR
RPOD_SALTY        KKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIR
RPOD_BUCAI        KKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIR
RPOD_BUCAP        KKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIR
RPOD_LEPIC        KRYANRGMHFFDLIQEGNIGLIKAVDKFEYKKGYKFSTYATWWIRQAITRAISDQARTIR
RPOD_LEPIN        KRYANRGMHFFDLIQEGNIGLIKAVDKFEYKKGYKFSTYATWWIRQAITRAISDQARTIR
SIGA_CHLPN        KKYTNRGLSFLDLIQEGNMGLMKAVEKFEYRRGYKFSTYATWWIRQAVTRAIADQARTIR
SIGA_CHLMU        KKYTNRGLSFLDLIQEGNMGLMKAVEKFEYRRGYKFSTYATWWIRQAVTRAIADQARTIR
SIGA_CHLTR        KKYTNRGLSFLDLIQEGNMGLMKAVEKFEYRRGYKFSTYATWWIRQAVTRAIADQARTIR
RPOD_RICBR        KKYANRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRAIADQARTIR
RPOD_RICPR        KKYANRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRAIADQARTIR
RPOD_RICTY        KKYANRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRAIADQARTIR
RPOD_RICCN        KKYANRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRAIADQARTIR
RPOD_RICFE        KKYANRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRAIADQARTIR
RPOD_RHOCA        KKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIR
RPOD_RHOCB        KKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIR
RPOD_CAUVC        KKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIR
RPOD_AGRFC        KKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIR
RPOD_RHIEC        KKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIR
RPOD_RHIME        KKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIR
SIGA_THET2        KKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIR
SIGA_THEAQ        KKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIR
RPOD_MYXXA        KKYTNRGLQFLDLIQEGNIGLMKAVDKFEYKRGYKFSTYATWWIRQAITRAIADQARTIR
D7AZB5_NOCDD      KRYMGRGLLLLDLVQEGNLGLIRAVEKFDYGKGFKFSTYATWWIRQAITRAIADQARTIR
SIGA_MYCTU        KRYTGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIR
SIGA_MYCBO        KRYTGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIR
SIGA_LACLA        KRYSGRGMQFLDLIQEGNMGLMKAVDKFDHTKGFKFSTYATWWIRQAITRAIADQARTIR
SIGA_STRMU        KRYVGRGMQFLDLIQEGNMGLMKAVDKFDYSKGFKFSTYATWWIRQAITRAIADQARTIR
SIGA_STRPN        KRYVGRGMQFLDLIQEGNMGLMKAVDKFDYSKGFKFSTYATWWIRQAITRAIADQARTIR
SIGA_STRR6        KRYVGRGMQFLDLIQEGNMGLMKAVDKFDYSKGFKFSTYATWWIRQAITRAIADQARTIR
E3DLQ7_HALPG      KKYIGQGMSFLDLIQEGNKGLMKAVEKFDYTKGYKFSTYATWWIRQSITRALADQARTIR
SIGA_CLOAB        KRYVGRGMLFLDLIQEGNLGLIKAVEKFDFKKGFKFSTYATWWIRQAITRAIADQARTIR
SIGA_ENTFA        KRYVGRGMQFLDLIQEGNMGLMKAVEKFDYRKGFKFSTYATWWIRQAITRAIADQARTIR
SIGA_STAES        KRYVGRGMLFLDLIQEGNMGLIKAVEKFDFSKGFKFSTYATWWIRQAITRAIADQARTIR
SIGA_STAEQ        KRYVGRGMLFLDLIQEGNMGLIKAVEKFDFSKGFKFSTYATWWIRQAITRAIADQARTIR
SIGA_STAA8        KRYVGRGMLFLDLIQEGNMGLIKAVEKFDFNKGFKFSTYATWWIRQAITRAIADQARTIR
SIGA_STAAC        KRYVGRGMLFLDLIQEGNMGLIKAVEKFDFNKGFKFSTYATWWIRQAITRAIADQARTIR
SIGA_STAAM        KRYVGRGMLFLDLIQEGNMGLIKAVEKFDFNKGFKFSTYATWWIRQAITRAIADQARTIR
SIGA_STAAR        KRYVGRGMLFLDLIQEGNMGLIKAVEKFDFNKGFKFSTYATWWIRQAITRAIADQARTIR
SIGA_STAAS        KRYVGRGMLFLDLIQEGNMGLIKAVEKFDFNKGFKFSTYATWWIRQAITRAIADQARTIR
SIGA_STAAW        KRYVGRGMLFLDLIQEGNMGLIKAVEKFDFNKGFKFSTYATWWIRQAITRAIADQARTIR
SIGA_STAAN        KRYVGRGMLFLDLIQEGNMGLIKAVEKFDFNKGFKFSTYATWWIRQAITRAIADQARTIR
SIGA_BACSP        KRYVGRGMLFLDLIQEGNMGLIKAVEKFDHNKGFKFSTYATWWIRQAITRAIADQARTIR
SIGA_LISIN        KRYVGRGMLFLDLIQEGNMGLMKAVEKFDFNKGFKFSTYATWWIRQAITRAIADQARTIR
SIGA_LISMO        KRYVGRGMLFLDLIQEGNMGLMKAVEKFDFNKGFKFSTYATWWIRQAITRAIADQARTIR
SIGA_BACHD        KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYNKGFKFSTYATWWIRQAITRAIADQARTIR
SIGA_BACSU        KRYVGRGMLFLDLIQEGNMGLMKAVEKFDYRKGYKFSTYATWWIRQAITRAIADQARTIR
                  *..   *: : **:***. **:.*  **:     **********.*::.*:::*:.* :*

Q7NB90_MYCGA      IPVHMVETINKLIKTERMLTQQLGRDPTLEELTEAMGGQVNG-------FTPKKVADIKK
SIGA_MYCGE        IPVHMVETINRLAKAERALYQELGREPTDEELAEKMGGQAEG-------FNVKKIAEIKR
SIGA_MYCPN        IPVHMVETINRLAKAERALNQELGREPTAEELAEKMGGQAEG-------FTVKKIAEIKR
Q9PQE2_UREPA      IPVHMVETINKLTKAERNLIQELGRDPTAEEIAQAMNKVSQAKNQKEQLITAQKVVEIKK
RPOD_HELPY        IPIHMIDTINRINKVMRKHIQENGKEPDLEVVAEEVG------------LSLDKVKNVIK
RPOD_HELPJ        IPIHMIDTINRINKVMRKHIQETGKEPDLEVVAEEVG------------LSLDKVKNVIK
RPOD_BORBU        VPVHMIEQINRLNRETRYLIQVLGKDPTDEELSDRLG------------WELKKVKTVKS
Q1ATP3_RUBXD      IPVHMVEKVNKYHRTQRRMTQALGREPTDEEVAEELG------------VPVEEVLRLQE
Q6YPU7_ONYPE      IPVHIVETINKMALCTRKLTQKLKKKPTVEELADKMN------------ISAEKIRSIQY
RPOD_TREPA        VPVHMIEQINKVTRESRQLLQKFGREPSDEEIAQQLC------------WTVEKVKQVKS
A9WAH7_CHLAA      LPVHLGETLNRIQSARRQLTQSLGREPTDTELANHLG------------MSEEKLRELRR
A2C7M0_PROM3      LPVHLYETISRIKKTTKVLSQEFGRKPTEEEIAESME------------MTIEKLRFIAK
SIGA_SYNY3        LPVHLYETISRIKKTTKLLSQEMRRKPTEEEIAEKME------------MTIEKLRFIAK
SIGA1_SYNE7       LPVHLYETISRIKKTTKLLSQEMGRKPTEEEIATRME------------MTIEKLRFIAK
SIGA_NOSS1        LPVHLYETISRIKKTTKLLSQEMGRKPTEEEIATRME------------MTIEKLRFIAK
SIGA_MICAE        LPVHLYETISRIKKTTKILSQEMRRKPTEEEIATKME------------MTIEKLRFIAK
B8G6G0_CHLAD      LPVHMGEAISQVKRTSHRLQQTMQREPTPEEIADAMG------------ISAGKVRRTLE
D1C328_SPHTD      LPVHVGETINRVKKTSQRLQQIFEREPTFEEVARAMD------------IPEEKVRQVLD
RPOD_NEIGO        IPVHMIETINKMNRISRQHLQETGEEPDSAKLAELMQ------------MPEDKIRKIMK
SIGA_THEMA        IPVHMVETINKLNRLRREYYQKHGEEPSIEELAKMMG------------KPPEKIKEILE
B9L102_THERP      LPVHLVETLNRVSRVARQLTQELGREPTTSELAAAVN------------MPLDRLRELLQ
RPOD_COXBU        IPVHMIETINKLNRISRQILQETGIEATPEELGRRMD------------MPEEKVRKVLK
RPOD_XYLFA        IPVHMIETINKLNRISRQMLQQFGREATPEELAKEMD------------MPEDKIRKVMK
RPOD_XYLFT        IPVHMIETINKLNRISRQMLQQFGREATPEELAKEMD------------MPEDKIRKVMK
RPOD_XANAC        IPVHMIETINKLNRISRQMLQQFGREATPEELAKEMD------------MPEDKIRKVMK
RPOD_XANCP        IPVHMIETINKLNRISRQMLQQFGREATPEELAKEMD------------MPEDKIRKVMK
RPOD_HAEIN        IPVHMIETINKLNRISRQLLQEMGREATPEELAERMG------------MPEDKIRKVLK
RPOD_PSEPU        IPVHMIETINKLNRISRQMLQEMGREPTPEELGERME------------MPEDKIRKVLK
RPOD_PSEAE        IPVHMIETINKLNRISRQMLQEMGREPTPEELGERMD------------MPEDKIRKVLK
RPOD_PSEPH        IPVHMIETINKLNRISRQMLQEMGREPTPEELGERME------------MPEDKIRKVLK
RPOD_SHEVD        IPVHMIETINKLNRISRQMLQEMGREPTPEELAERML------------MPEDKIRKVLK
RPOD_BUCBP        IPVHMIETINKLNRISRQILQEIGREPTPEELSERML------------IPEDKIRKVLK
RPOD_ECOLI        IPVHMIETINKLNRISRQMLQEMGREPTPEELAERML------------MPEDKIRKVLK
RPOD_SALTI        IPVHMIETINKLNRISRQMLQEMGREPTPEELAERML------------MPEDKIRKVLK
RPOD_SALTY        IPVHMIETINKLNRISRQMLQEMGREPTPEELAERML------------MPEDKIRKVLK
RPOD_BUCAI        IPVHMIETINKLNRISRQMLQEIGREPTPEELSEKML------------IPEDKIRKVLK
RPOD_BUCAP        IPVHMIETINKLNRISRQMLQEIGREPTPEELSEKML------------IPEDKIRKVLK
RPOD_LEPIC        VPVHMIEQVNKVIRETRLFIQEFGRDPNNEEIAERLG------------WPVQKVKMVKN
RPOD_LEPIN        VPVHMIEQVNKVIRETRLFIQEFGRDPNNEEIAERLG------------WPVQKVKMVKN
SIGA_CHLPN        IPVHMIETINKVLRGAKKLMMETGKEPTPEELAEELG------------LTPDRVREIYK
SIGA_CHLMU        IPVHMIETINKVLRGAKKLMMETGKEPTPEELGEELG------------FTPDRVREIYK
SIGA_CHLTR        IPVHMIETINKVLRGAKKLMMETGKEPTPEELGEELG------------FTPDRVREIYK
RPOD_RICBR        IPVHMIETINKIIRTSRQMLNELGYEPTPAEIAARLS------------MPIDKVRKVMK
RPOD_RICPR        IPVHMIETINKILRTSRQMLNELGYEPTATEIANRLS------------MPLDKVRKVMK
RPOD_RICTY        IPVHMIETINKILRTSRQMLNELGYEPTATEIANRLS------------MPLDKVRKVMK
RPOD_RICCN        IPVHMIETINKILRTSRQMLNELGYEPTATEIANRLS------------MPLDKVRKVMK
RPOD_RICFE        IPVHMIETINKILRTSRQMLNELGYEPTATEIANRLS------------MPLDKVRKVMK
RPOD_RHOCA        IPVHMIETINKLVRTGRQMLHEIGREPTPEELAEKLQ------------MPLEKVRKVMK
RPOD_RHOCB        IPVHMIETINKLVRTGRQMLHEIGREPTPEELAEKLQ------------MPLEKVRKVMK
RPOD_CAUVC        IPVHMIETINKIVRTSRQMLHEIGREPTPEELAEKLA------------MPLEKVRKVLK
RPOD_AGRFC        IPVHMIETINKIVRTSRQMLHEIGREPTPEELAEKLA------------MPLEKVRKVLK
RPOD_RHIEC        IPVHMIETINKIVRTSRQMLHEIGREPTPEELAEKLA------------MPLEKVRKVLK
RPOD_RHIME        IPVHMIETINKIVRTSRQMLHEIGREPTPEELAEKLA------------MPLEKVRKVLK
SIGA_THET2        IPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPG----------WDAKRVEETLK
SIGA_THEAQ        IPVHMVETINKLSRTARQLQQELGREPSYEEIAEAMGPG----------WDAKRVEETLK
RPOD_MYXXA        IPVHMIETINKLIRTSRYLVQEIGREPTPEEIAEKME------------LPLDKVRKVLK
D7AZB5_NOCDD      IPVHMVETINKVVRVQHQLHQQLGREPSVEEISSAAG------------FVGQRVVEIQR
SIGA_MYCTU        IPVHMVEVINKLGRIQRELLQDLGREPTPEELAKEMD------------ITPEKVLEIQQ
SIGA_MYCBO        IPVHMVEVINKLGRIQRELLQDLGREPTPEELAKEMD------------ITPEKVLEIQQ
SIGA_LACLA        IPVHMVETINKLIRVQRNLLQELGRDPSPEEIGKELH------------MAPDKVREVLK
SIGA_STRMU        IPVHMVETINKLVREQRNLLQELGQDPTPEQIAERMD------------MTPDKVREILK
SIGA_STRPN        IPVHMVETINKLVREQRNLLQELGQDPTPEQIAERMD------------MTPDKVREILK
SIGA_STRR6        IPVHMVETINKLVREQRNLLQELGQDPTPEQIAERMD------------MTPDKVREILK
E3DLQ7_HALPG      IPVHMVETMNKLRRIEKRLKKDLEREPTLEEIGEEMN------------MEPEKVLEIQK
SIGA_CLOAB        IPVHMVETINKLIRVSRQLLQELGREPQPEEIAKIMD------------MPVDKVREIMK
SIGA_ENTFA        IPVHMVETINKLIRIQRQLLQDLGREPTPEEIGAEMD------------LPTEKVREILK
SIGA_STAES        IPVHMVETINKLIRVQRQLLQDLGRDPAPEEIGEEMD------------LPPEKVREILK
SIGA_STAEQ        IPVHMVETINKLIRVQRQLLQDLGRDPAPEEIGEEMD------------LPPEKVREILK
SIGA_STAA8        IPVHMVETINKLIRVQRQLLQDLGRDPAPEEIGEEMD------------LPAEKVREILK
SIGA_STAAC        IPVHMVETINKLIRVQRQLLQDLGRDPAPEEIGEEMD------------LPAEKVREILK
SIGA_STAAM        IPVHMVETINKLIRVQRQLLQDLGRDPAPEEIGEEMD------------LPAEKVREILK
SIGA_STAAR        IPVHMVETINKLIRVQRQLLQDLGRDPAPEEIGEEMD------------LPAEKVREILK
SIGA_STAAS        IPVHMVETINKLIRVQRQLLQDLGRDPAPEEIGEEMD------------LPAEKVREILK
SIGA_STAAW        IPVHMVETINKLIRVQRQLLQDLGRDPAPEEIGEEMD------------LPAEKVREILK
SIGA_STAAN        IPVHMVETINKLIRVQRQLLQDLGRDPAPEEIGEEMD------------LPAEKVREVLK
SIGA_BACSP        IPVHMVETINKLIRVSRQLLQELGREPTPEEIAAEME------------LSVEKVREIMK
SIGA_LISIN        IPVHMVETINKLIRVQRSLLQDLGRDPSPEEIGEEMD------------LPTEKVREILK
SIGA_LISMO        IPVHMVETINKLIRVQRSLLQDLGRDPSPEEIGEEMD------------LPTEKVREILK
SIGA_BACHD        IPVHMVETINKLIRVQRQLLQDLGREPSPEEVAEEMD------------LTPEKVREILK
SIGA_BACSU        IPVHMVETINKLIRVQRQLLQDLGREPTPEEIAEDMD------------LTPEKVREILK
                  :*:*: : :..     .        ..    :                      :     

Q7NB90_MYCGA      LN--QEPVSLDKPIGH-DEE-SQFVDFVKDRDILKPDEYTEKLIVTEHINELFINTLTKK
SIGA_MYCGE        LS--LDPVSLDKTVGH-DEE-SQFGDFVKDTDAQTPDEFTESRSNSEKIDELLNNNLSEQ
SIGA_MYCPN        LS--LDPVSLDKTVGH-DEE-SQFGDFVRDTDAQMPDEFTESRSNYEKIDELLNNCLSEQ
Q9PQE2_UREPA      LN--VDPVSLDKQIGH-DEE-SQFSDFISDDEIISPEKYTEKKALNDQINEMFEKVLNDN
RPOD_HELPY        VT--KEPISLETPVGN-DDD-GKFGDFVEDKNIVSSIDHIMREDLKAQIESVLD-QLNER
RPOD_HELPJ        VT--KEPISLETPVGN-DDD-GKFGDFVEDKNIVSSIDHIMREDLKAQIESVLD-QLNER
RPOD_BORBU        VS--REPVSLETPIGE-EED-SVLSDFIEDKAIKNPANHTSFVVLQDQIRAILG-TLPER
Q1ATP3_RUBXD      IS--QRSISLETPVGD-DES-SSLGDFLEDASAVTPTDAVSESLLKLHLREALD-ELPER
Q6YPU7_ONYPE      IE--KKPISLEAPARENEEDETSLGDFISDPNILSPHEYMMKEVTQKLLDEVLENTLTDR
RPOD_TREPA        VA--REPISLETPIGE-EED-SSLGDFVPDADVENPSRVTERVLLKEEVRSILS-ALPAR
A9WAH7_CHLAA      TA--QDPVSLATPVGE-EAD-STLADFIPDPHALDADDAAASGMLRQQITAALD-QLSER
A2C7M0_PROM3      SA--QLPISLETPIGK-EED-SRLGDFIE-SDTENPEQDVAKNLLREDLEGVLA-TLSPR
SIGA_SYNY3        SA--QLPISLETPIGK-EED-SRLGDFIE-ADGETPEDEVSKNLLREDLENVLD-TLSPR
SIGA1_SYNE7       SA--QLPISLETPIGK-EED-SRLGDFIE-ADGETPEDEVAKNLLREDLEGVLS-TLSPR
SIGA_NOSS1        SA--QLPISLETPIGK-EED-SRLGDFIE-SDGETPEDQVSKNLLREDLEKVLD-SLSPR
SIGA_MICAE        SA--QLPISLETPIGK-EED-SRLGDFIE-ADGETPEDEVSKNLLREDLENVLD-TLSPR
B8G6G0_CHLAD      AS--MHPLSLEMPVGQ-EGE-GRMGDFIEDDRISTPAEAAAASLLREQLEEVLM-KLPER
D1C328_SPHTD      AS--RHPVSLEAPVGQ-EGD-AFLGDFIEDDTMPPPLELASQELLKHQISDALS-KLTER
RPOD_NEIGO        IA--KEPISMETPIGD-DDD-SHLGDFIEDANNVAPADAAMYTSLHEVTKEILE-SLTPR
SIGA_THEMA        AA--KETISLESPIGE-DED-SSIEDFVADDSIASPKKEAMRMLMREELEKVLK-TLSPR
B9L102_THERP      AA--QDPVSLEAPVGQ-EEE-STLGDFLEDERAVAPLDAAALSLLREQVQSLLA-TLTER
RPOD_COXBU        IA--KEPISMETPIGE-DED-SNLGDFIEDINMESPVDFATSAGLMEATREILS-TLTPR
RPOD_XYLFA        IA--KEPISMETPIGD-DED-SHLGDFIEDPNVESPVDTTTNVNLSETVREVLA-GLTPR
RPOD_XYLFT        IA--KEPISMETPIGD-DED-SHLGDFIEDPNVESPVDTTTNVNLSETVREVLA-GLTPR
RPOD_XANAC        IA--KEPISMETPIGD-DED-SHLGDFIEDTNVESPIDNTTNINLSETVRDVLA-GLTPR
RPOD_XANCP        IA--KEPISMETPIGD-DED-SHLGDFIEDTNVESPIDNTTNINLSETVRDVLA-GLTPR
RPOD_HAEIN        IA--KEPISMETPIGD-DDD-SHLGDFIEDSTLELPLDSATAQSLKVATHEVLE-GLTPR
RPOD_PSEPU        IA--KEPISMETPIGD-DED-SHLGDFIEDSTMQSPIYVATVESLKEATRDVLS-GLTAR
RPOD_PSEAE        IA--KEPISMETPIGD-DED-SHLGDFIEDSTMQSPIEMATSESLKESTREVLA-GLTAR
RPOD_PSEPH        IA--KEPISMETPIGD-DED-SHLGDFIEDSTMQSPIDVATVESLKEATREVLS-GLTAR
RPOD_SHEVD        IA--KEPISMETPIGD-DED-SHLGDFIEDTTLELPLDSATGESLRNATHEVLA-GLTAR
RPOD_BUCBP        IA--KEPISMETPIGE-DDD-SHLGDFLEDTNIELPLDSATSASLRSATKNVLS-GLTTR
RPOD_ECOLI        IA--KEPISMETPIGD-DED-SHLGDFIEDTTLELPLDSATTESLRAATHDVLA-GLTAR
RPOD_SALTI        IA--KEPISMETPIGD-DED-SHLGDFIEDTTLELPLDSATTESLRAATHDVLA-GLTAR
RPOD_SALTY        IA--KEPISMETPIGD-DED-SHLGDFIEDTTLELPLDSATTESLRAATHDVLA-GLTAR
RPOD_BUCAI        IA--KEPISMETPIGD-DDD-SHLGDFIEDTTLELPLDSATSESLRSATHDVLS-GLTAR
RPOD_BUCAP        IA--KEPISMETPIGD-DDD-SHLGDFIEDTTLELPLDSATSESLRSATHDVLS-GLTAR
RPOD_LEPIC        VA--REPISLEIPVGS-EED-SELGDFIPDTEVETPVNAAASSILAEQIRQVLH-TLPAR
RPOD_LEPIN        VA--REPISLEIPVGS-EED-SELGDFIPDTEVETPVNAAASSILAEQIRQVLH-TLPAR
SIGA_CHLPN        IA--QHPISLQAEVGE-GSE-SSFGDFLEDTAVESPAEATGYSMLKDKMKEVLK-TLTDR
SIGA_CHLMU        IA--QHPISLQAEVGD-SGE-SSFGDFLEDTAVESPAEATGYSMLKDKMKEVLK-TLTDR
SIGA_CHLTR        IA--QHPISLQAEVGD-GGE-SSFGDFLEDTAVESPAEATGYSMLKDKMKEVLK-TLTDR
RPOD_RICBR        IA--KEPISLENPVGD-GDDNSYLGDFIEDKNAVAPIDAAIQSNLREVTTRVLA-TLTPR
RPOD_RICPR        IA--KEPISLENPVGD-DSDGGQLGDFIEDKNAVAPIDAAIQSNLREVTTRVLA-TLTPR
RPOD_RICTY        IA--KEPISLENPVGD-DSDGGQLGDFIEDKNAVAPIDAAIQSNLREVTTRVLA-TLTPR
RPOD_RICCN        IA--KEPISLENPVGD-DSDGGQLGDFIEDKNAVAPIDAAIQSNLREVTTRVLA-TLTPR
RPOD_RICFE        IA--KEPISLENPVGD-DSDGGQLGDFIEDKNAVAPIDAAIQSNLREVTTRVLA-TLTPR
RPOD_RHOCA        IA--KEPISLETPIGH-EED-SQLGDFIEDKNAILPLDSAIQENLKETTTRVLP-SLTPR
RPOD_RHOCB        IA--KEPISLETPIGD-EED-SQLGDFIEDKNAILPLDSAIQENLKETTTRVLA-SLTPR
RPOD_CAUVC        IA--KEPISLETPIGD-EED-SHLGDFIEDKNAILPIDAAIQSNLRETTTRVLA-SLTPR
RPOD_AGRFC        IA--KEPISLETPVGD-EED-SHLGDFIEDKNALLPIDAAIQANLRETTTRVLA-SLTPR
RPOD_RHIEC        IA--KEPISLETPVGD-EED-SHLGDFIEDKNALLPIDAAIQANLRETTTRVLA-SLTPR
RPOD_RHIME        IA--KEPISLETPVGD-EED-SHLGDFIEDKNALLPIDAAIQANLRETTTRVLA-SLTPR
SIGA_THET2        IA--QEPVSLETPIGD-EKD-SFYGDFIPDEHLPSPVDAATQSLLSEELEKALS-KLSER
SIGA_THEAQ        IA--QEPVSLETPIGD-EKD-SFYGDFIPDENLPSPVEAAAQSLLSEELEKALS-KLSER
RPOD_MYXXA        IA--KEPISLETPIGE-EED-SHLGDFIEDKSLVSPADAVINMNLAEQTRKVLA-TLTPR
D7AZB5_NOCDD      IA--REPVSLQSPIGE-EE--SDFGDFIEDSDAVAPVEAAAFTVLQEQLGAILG-GLSDR
SIGA_MYCTU        YA--REPISLDQTIGD-EGD-SQLGDFIEDSEAVVAVDAVSFTLLQDQLQSVLD-TLSER
SIGA_MYCBO        YA--REPISLDQTIGD-EGD-SQLGDFIEDSEAVVAVDAVSFTLLQDQLQSVLD-TLSER
SIGA_LACLA        IA--QEPVSLETPIGE-EDD-SHLGDFIEDDVIESPVDYTNRILLREQLDEVMD-TLTDR
SIGA_STRMU        IA--QEPVSLETPIGE-EDD-SHLGDFIEDEVIENPVDYTTRVVLREQLDEVLD-TLTDR
SIGA_STRPN        IA--QEPVSLETPIGE-EDD-SHLGDFIEDEVIENPVDYTTRIVLREQLDEILD-TLTDR
SIGA_STRR6        IA--QEPVSLETPIGE-EDD-SHLGDFIEDEVIENPVDYTTRIVLREQLDEILD-TLTDR
E3DLQ7_HALPG      LAMNQQPTSLDTPIGE-EKD-SHLKDFIEDQDAPAPEMLASSELLKDQLETVLD-TLTDR
SIGA_CLOAB        IA--QEPVSLETPIGE-EED-SHLGDFIPDDEAPAPADAAAFRMLKEQLLKILN-TLTPR
SIGA_ENTFA        IA--QEPVSLETPIGE-EDD-SHLGDFIEDQDATSPAEHAAYELLKEQLEDVLD-TLTDR
SIGA_STAES        IA--QEPVSLETPIGE-EDD-SHLGDFIEDQEAQSPSDHAAYELLKEQLEDVLD-TLTDR
SIGA_STAEQ        IA--QEPVSLETPIGE-EDD-SHLGDFIEDQEAQSPSDHAAYELLKEQLEDVLD-TLTDR
SIGA_STAA8        IA--QEPVSLETPIGE-EDD-SHLGDFIEDQEAQSPSDHAAYELLKEQLEDVLD-TLTDR
SIGA_STAAC        IA--QEPVSLETPIGE-EDD-SHLGDFIEDQEAQSPSDHAAYELLKEQLEDVLD-TLTDR
SIGA_STAAM        IA--QEPVSLETPIGE-EDD-SHLGDFIEDQEAQSPSDHAAYELLKEQLEDVLD-TLTDR
SIGA_STAAR        IA--QEPVSLETPIGE-EDD-SHLGDFIEDQEAQSPSDHAAYELLKEQLEDVLD-TLTDR
SIGA_STAAS        IA--QEPVSLETPIGE-EDD-SHLGDFIEDQEAQSPSDHAAYELLKEQLEDVLD-TLTDR
SIGA_STAAW        IA--QEPVSLETPIGE-EDD-SHLGDFIEDQEAQSPSDHAAYELLKEQLEDVLD-TLTDR
SIGA_STAAN        IA--QEPVSLETPIGE-EDD-SHLGDFIEDQEAQSPSDHAAYELLKEQLEDVLD-TLTDR
SIGA_BACSP        IA--QEPVSLETPIGE-EDD-SHLGDFIEDQEALTPADAAAYELLKEQLEDVLD-TLTER
SIGA_LISIN        IA--QEPVSLETPIGE-EDD-SHLGDFIEDQDATSPSDHAAYELLKEQLEDVLD-TLTDR
SIGA_LISMO        IA--QEPVSLETPIGE-EDD-SHLGDFIEDQDATSPSDHAAYELLKEQLEDVLD-TLTDR
SIGA_BACHD        IA--QEPVSLETPIGE-EDD-SHLGDFIEDQDALAPSDAAAYELLKEQLEDVLD-TLTDR
SIGA_BACSU        IA--QEPVSLETPIGE-EDD-SHLGDFIEDQEATSPSDHAAYELLKEQLEDVLD-TLTDR
                        . *:               **:       .                :   *  .

Q7NB90_MYCGA      EEQIIRMRYGLHPWHQQMTLEEVGQKFNVTRERIRQIESKALRKLK-HPSKNARLR-SFL
SIGA_MYCGE        EELIVRMRIGMPPYNEPKTLDEVGQKILIPREKIRQIENKAIRKLR-HAVRNNPISMSFL
SIGA_MYCPN        EELIVRMRIGMPPYNETKTLDEVSQKIKIPREKIRQIETKAIRKLR-QAVRNNHMSLSFM
Q9PQE2_UREPA      EQRVIKMRYGLLPFERPYTLEEVGEYLGVTRERARQIESKAIRKLK-HPSKTAKLR-SFI
RPOD_HELPY        EKAVIRMRFGLLDDESDRTLEEIGKELNVTRERVRQIESSAIKKLR-SPQYGRILR-NYL
RPOD_HELPJ        EKAVIRMRFGLLDDESDRTLEEIGKELNVTRERVRQIESSAIKKLR-SPQYGRILR-NYL
RPOD_BORBU        EQEVVKMRFGL-EDGYSLTLEEVGLHFNVTRERIRQIESKALRRLK-NPKKTQKLK-DYL
Q1ATP3_RUBXD      ERQIIEMRFGM-KDDRPRTLEEVGREFDITRERVRQIQMKTLNLLR-EQRRTQNLR-EYL
Q6YPU7_ONYPE      EEKVLKMRYGL-LDGKTHTLEEVGTLFGVTRERIRQIESKALRRLR-TPAKQSKLK-SLY
RPOD_TREPA        EHEVLRMRFGL-DGDYSQTLEEVGLYFDVTRERIRQIEAKALKRLR-HPRHSRRLK-DFL
A9WAH7_CHLAA      ERRVLELRYGL-VDGQPRTLEEVGKAFGVTRERVRQIEVKALRKLR-HPRLGKLLK-DYL
A2C7M0_PROM3      ERDVLRLRYGL-DDGRMKTLEEIGQIFEVTRERIRQIEAKALRKLR-HPNRNGVLK-EYI
SIGA_SYNY3        ERDVLRLRYGL-DDGRMKTLEEIGQIFNVTRERIRQIEAKALRKLR-HPNRNSILK-EYI
SIGA1_SYNE7       ERDVLRLRYGL-DDGRMKTLEEIGQLFNVTRERIRQIEAKALRKLR-HPNRNSILK-EYI
SIGA_NOSS1        ERDVLRLRYGL-DDGRMKTLEEIGQIFNVTRERIRQIEAKALRKLR-HPNRNSVLK-EYI
SIGA_MICAE        ERDVLRLRYGL-DDGRMKTLEEIGQIFNVTRERIRQIEAKALRKLR-HPNRNSILK-EYI
B8G6G0_CHLAD      ERKIIQLRYGL-KDGRYRTLEEVGIEFGITRERIRQIEAVALRKLR-HPHLGKKLR-GYL
D1C328_SPHTD      ERRIIILRFGL-EDGQFRTLEEVGREFGITRERIRQIEAKALRKLR-HPTYSHRLR-GYL
RPOD_NEIGO        EAKVLRMRFGI-DMNTDHTLEEVGRQFDVTRERIRQIEAKALRKLR-HPTRSDRLR-SFL
SIGA_THEMA        EAMVLRMRYGL-LDGKPKTLEEVGQYFNVTRERIRQIEVKALRKLR-HPSRSKYLK-SLL
B9L102_THERP      ERRVLAMRFGL-EDGQTYTLEEVGRAFGVTRERVRQIEAKALRKLR-HPQRARALR-DFL
RPOD_COXBU        EAKVLRMRFGI-DMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLR-HPSRAEKLH-SFI
RPOD_XYLFA        EAKVLRMRFGI-DMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLR-HPSRSEQLR-SFL
RPOD_XYLFT        EAKVLRMRFGI-DMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLR-HPSRSEQLR-SFL
RPOD_XANAC        EAKVLRMRFGI-DMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLR-HPSRSEQLR-SFL
RPOD_XANCP        EAKVLRMRFGI-DMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLR-HPSRSEQLR-SFL
RPOD_HAEIN        EAKVLRMRFGI-DMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLR-HPSRSETLR-SFL
RPOD_PSEPU        EAKVLRMRFGI-DMNTDHTLEEVGKQFDVTRERIRQIEAKAWRKLR-HPTRSEHLR-SFL
RPOD_PSEAE        EAKVLRMRFGI-DMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLR-HPSRSEHLR-SFL
RPOD_PSEPH        EAKVLRMRFGI-DMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLR-HPTRSEHLR-SFL
RPOD_SHEVD        EAKVLRMRFGI-DMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLR-HPSRSEILK-SFL
RPOD_BUCBP        EAKVLRMRFGI-DMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLR-HPSRSEILR-SFL
RPOD_ECOLI        EAKVLRMRFGI-DMNTDYTLEEVGKQFDVTRERIRQIEAKALRKLR-HPSRSEVLR-SFL
RPOD_SALTI        EAKVLRMRFGI-DMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLR-HPSRSEVLR-SFL
RPOD_SALTY        EAKVLRMRFGI-DMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLR-HPSRSEVLR-SFL
RPOD_BUCAI        EAKVLRMRFGI-DMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLR-HPSRSEVLR-SFL
RPOD_BUCAP        EAKVLRMRFGI-DMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLR-HPSRSEVLR-SFL
RPOD_LEPIC        EQKVIRMRFGL-DDGYPQTLEEVGYQFKVTRERIRQIEAKALRRLR-HPSRSKKLK-DYI
RPOD_LEPIN        EQKVIRMRFGL-DDGYPQTLEEVGYQFKVTRERIRQIEAKALRRLR-HPSRSKKLK-DYI
SIGA_CHLPN        ERFVLIHRFGL-LDGKPKTLEEVGSAFNVTRERIRQIEAKALRKMR-HPIRSKQLR-AFL
SIGA_CHLMU        ERFVLIHRFGL-LDGRPKTLEEVGSAFNVTRERIRQIEAKALRKMR-HPIRSKQLR-AFL
SIGA_CHLTR        ERFVLIHRFGL-LDGRPKTLEEVGSAFNVTRERIRQIEAKALRKMR-HPIRSKQLR-AFL
RPOD_RICBR        EERVLRMRFGI-GMNTDHTLEEVGQQFKVTRERIRQIESKALRKLQ-HPIRSKKLN-SFR
RPOD_RICPR        EERVLRMRFGI-GMNTDHTLEEVGQQFKVTRERIRQIESKALRKLQ-HPIRSKKLN-SFR
RPOD_RICTY        EERVLRMRFGI-GMNTDHTLEEVGQQFKVTRERIRQIESKALRKLQ-HPIRSKKLN-SFR
RPOD_RICCN        EERVLRMRFGI-GMNTDHTLEEVGQQFKVTRERIRQIESKALRKLQ-HPIRSKKLN-SFR
RPOD_RICFE        EERVLRMRFGI-GMNTDHTLEEVGQQFKVTRERIRQIESKALRKLQ-HPIRSKKLN-SFR
RPOD_RHOCA        EERVLRMRFGI-GMNTDHTLEEVGQQFSVTRERIRQIEAKALRKLK-HPSRSRKLP-SFL
RPOD_RHOCB        EERVLRMRFGI-GMNTDHTLEEVGQQFSVTRERIRQIEAKALRKLK-HPSRSRKLR-SFL
RPOD_CAUVC        EERVLRMRFGI-GMNTDHTLEEVGQQFSVTRERIRQIEAKALRKLK-HPSRSRKLR-SFL
RPOD_AGRFC        EERVLRMRFGI-GMNTDHTLEEVGQQFSVTRERIRQIEAKALRKLK-HPSRSRKLR-SFL
RPOD_RHIEC        EERVLRMRFGI-GMNTDHTLEEVGQQFSVTRERIRQIEAKALRKLK-HPSRSRKLR-SFL
RPOD_RHIME        EERVLRMRFGI-GMNTDHTLEEVGQQFSVTRERIRQIEAKALRKLK-HPSRSRKLR-SFL
SIGA_THET2        EAMVLKLRKGL-IDGREHTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLR-DFL
SIGA_THEAQ        EAMVLKLRKGL-IDGREHTLEEVGAYFGVTRERIRQIENKALRKLKYHESRTRKLR-DFL
RPOD_MYXXA        EEKVLRMRFGI-GEKSDHTLEEVGQDFEVTRERIRQIEAKALRKLR-HPSRSKRLR-SFV
D7AZB5_NOCDD      ERRIIRLRFGM-ADGHPHTLEEVGREFGVTRERIRQIEAKTLAKLR-HPSRAGSLR-DFI
SIGA_MYCTU        EAGVVRLRFGL-TDGQPRTLDEIGQVYGVTRERIRQIESKTMSKLR-HPSRSQVLR-DYL
SIGA_MYCBO        EAGVVRLRFGL-TDGQPRTLDEIGQVYGVTRERIRQIESKTMSKLR-HPSRSQVLR-DYL
SIGA_LACLA        EENVLRMRFGL-DDGRMHTLEDVGKQFKVTRERIRQIEAKAIKKLR-HPRRSKPLR-DFM
SIGA_STRMU        EENVLRLRFGL-DDGKMRTLEDVGKVFDVTRERIRQIEAKALRKLR-HPSRSKQLR-DFV
SIGA_STRPN        EENVLRLRFGL-DDGKMRTLEDVGKVFNVTRERIRQIEAKALRKLR-QPSRSKPLR-DFI
SIGA_STRR6        EENVLRLRFGL-DDGKMRTLEDVGKVFNVTRERIRQIEAKALRKLR-QPSRSKPLR-DFI
E3DLQ7_HALPG      EKRIIKLRFGL-EDGRQRTLKEVGSQFGVTRERIRQIQAKALRKLR-HPTRSKELR-GYL
SIGA_CLOAB        EEKVLRLRFGL-DDGRARTLEEVGKEFNVTRERIRQIEAKALRKLR-HPSRSKKLK-DYL
SIGA_ENTFA        EENVLRLRFGL-DDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLR-HPSRSKQLK-DFL
SIGA_STAES        EENVLRLRFGL-DDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLR-HPSRSKRLK-DFM
SIGA_STAEQ        EENVLRLRFGL-DDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLR-HPSRSKRLK-DFM
SIGA_STAA8        EENVLRLRFGL-DDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLR-HPSRSKRLK-DFM
SIGA_STAAC        EENVLRLRFGL-DDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLR-HPSRSKRLK-DFM
SIGA_STAAM        EENVLRLRFGL-DDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLR-HPSRSKRLK-DFM
SIGA_STAAR        EENVLRLRFGL-DDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLR-HPSRSKRLK-DFM
SIGA_STAAS        EENVLRLRFGL-DDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLR-HPSRSKRLK-DFM
SIGA_STAAW        EENVLRLRFGL-DDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLR-HPSRSKRLK-DFM
SIGA_STAAN        EENVLRLRFGL-DDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLR-HPSRSKRLK-DFM
SIGA_BACSP        EENVLRLRFGL-DDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLR-HPSRSKRLK-DFL
SIGA_LISIN        EENVLRLRFGL-DDGRTRTLEEVGRVFGVTRERIRQIEAKALRKLR-HPSRSKQLK-DFL
SIGA_LISMO        EENVLRLRFGL-DDGRTRTLEEVGRVFGVTRERIRQIEAKALRKLR-HPSRSKQLK-DFL
SIGA_BACHD        EENVLRLRFGL-DDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLR-HPSRSKRLK-DFL
SIGA_BACSU        EENVLRLRFGL-DDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLR-HPSRSKRLK-DFL
                  *  ::  * *:       **.::.    :.**. ***:  :   :.        :     

Q7NB90_MYCGA      KHDSEN-------------
SIGA_MYCGE        RINEKKD------------
SIGA_MYCPN        RGNEKKD------------
Q9PQE2_UREPA      GESEN--------------
RPOD_HELPY        RI-----------------
RPOD_HELPJ        RI-----------------
RPOD_BORBU        EDLN---------------
Q1ATP3_RUBXD      H------------------
Q6YPU7_ONYPE      HNHK---------------
RPOD_TREPA        DS-----------------
A9WAH7_CHLAA      DQI----------------
A2C7M0_PROM3      K------------------
SIGA_SYNY3        R------------------
SIGA1_SYNE7       R------------------
SIGA_NOSS1        R------------------
SIGA_MICAE        R------------------
B8G6G0_CHLAD      D------------------
D1C328_SPHTD      D------------------
RPOD_NEIGO        DSEDSKL------------
SIGA_THEMA        SLMDENEG-----------
B9L102_THERP      E------------------
RPOD_COXBU        EVEE---------------
RPOD_XYLFA        DID----------------
RPOD_XYLFT        DID----------------
RPOD_XANAC        DID----------------
RPOD_XANCP        DID----------------
RPOD_HAEIN        DE-----------------
RPOD_PSEPU        DE-----------------
RPOD_PSEAE        DE-----------------
RPOD_PSEPH        DE-----------------
RPOD_SHEVD        DE-----------------
RPOD_BUCBP        DD-----------------
RPOD_ECOLI        DD-----------------
RPOD_SALTI        DD-----------------
RPOD_SALTY        DD-----------------
RPOD_BUCAI        DD-----------------
RPOD_BUCAP        DD-----------------
RPOD_LEPIC        DG-----------------
RPOD_LEPIN        DG-----------------
SIGA_CHLPN        DLLEEEKTGTSKVKSLKSK
SIGA_CHLMU        DLLEEEKTGSGKIKSYKN-
SIGA_CHLTR        DLLEEEKIGSGKIKSYKN-
RPOD_RICBR        SGGKRGDGNPSDLLEA---
RPOD_RICPR        NGGKRGDGNPSDLLEA---
RPOD_RICTY        NGGKRGDGNPSDLLEA---
RPOD_RICCN        SGGKRGDGNSSDLLEA---
RPOD_RICFE        SGGKRGEGNPSDLLEA---
RPOD_RHOCA        DQ-----------------
RPOD_RHOCB        DQ-----------------
RPOD_CAUVC        DS-----------------
RPOD_AGRFC        DS-----------------
RPOD_RHIEC        DS-----------------
RPOD_RHIME        DS-----------------
SIGA_THET2        D------------------
SIGA_THEAQ        E------------------
RPOD_MYXXA        ES-----------------
D7AZB5_NOCDD      RTD----------------
SIGA_MYCTU        D------------------
SIGA_MYCBO        D------------------
SIGA_LACLA        -------------------
SIGA_STRMU        ED-----------------
SIGA_STRPN        ED-----------------
SIGA_STRR6        ED-----------------
E3DLQ7_HALPG      NN-----------------
SIGA_CLOAB        D------------------
SIGA_ENTFA        E------------------
SIGA_STAES        D------------------
SIGA_STAEQ        D------------------
SIGA_STAA8        D------------------
SIGA_STAAC        D------------------
SIGA_STAAM        D------------------
SIGA_STAAR        D------------------
SIGA_STAAS        D------------------
SIGA_STAAW        D------------------
SIGA_STAAN        D------------------
SIGA_BACSP        E------------------
SIGA_LISIN        E------------------
SIGA_LISMO        E------------------
SIGA_BACHD        E------------------
SIGA_BACSU        E------------------