CLUSTAL format seed alignment for MF_00964

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DEAD_ECOLI        ------------------------------------------------------------
Q8ZLT4_SALTY      ------------------------------------------------MMSYVDWPPLIL
Q32BH1_SHIDS      ------------------------------------------------MMSYVDWPPLIL
D0ZB80_EDWTE      ------------------------------------------------------------
Q8D1D0_YERPE      -----------------------------------------------------------M
Q0WBG1_YERPE      ------------------------------------------------------------
DEAD_BUCAI        ------------------------------------------------------------
DEAD_BUCAP        ------------------------------------------------------------
DEAD_BUCBP        ------------------------------------------------------------
Q057K4_BUCCC      ------------------------------------------------------------
Q8D2Y1_WIGBR      ------------------------------------------------------------
DEAD_HAEIN        ------------------------------------------------------------
Q8P7G9_XANCP      ------------------------------------------------------------
Q3RD00_XYLFS      ------------------------------------------------------------
Q8KET5_CHLTE      --------------------------------------------MAATFLSMTRKETMNE
A1BHB4_CHLPD      ------------------------------------------------------------
K0NS32_DESTT      ------------------------------------------------------------
DEAD_MYCTU        ------------------------------------------MAFPEYSP----------
A0R2A4_MYCS2      ------------------------------------------MTSQEPDPSPVTN-----
Q5YQK7_NOCFA      ------------------------------------------MSTNQVDSVPGDDDRDSG
Q6NHW2_CORDI      ----MSITDNATSGENELDIKILSESQDNSQVDEGTTINNDVVADVDDSRVANTSEATDS
Q5ZT20_LEGPH      ------------------------------------------------------------
Q3AX69_SYNS9      MTEQQQQHEDPSCAVDLSASALPEDKKEVDQEEVLTTTIESSTAEPSTTEASTTEVTAEV
Q7VBJ8_PROMA      MAKTKSNE-------DISTSNVSSNS-------------DPSISIESETEEHISITEVDA
Q31AC4_PROM9      MALKKDGN---------SVDNGQEKSQ-----------HDDASLLEIKNLENKTDIKSQP
Q5NEY5_FRATT      ------------------------------------------------------------
Q5E0J2_ALIF1      ------------------------------------------------------------
Q9KLE2_VIBCH      ---------------------------------------------MVGNGKARGTLVISS
E1STD6_FERBD      ------------------------------------------------------------
Q4K8U0_PSEF5      ------------------------------------------------------------
A5W761_PSEP1      ------------------------------------------------------------
Q9I003_PSEAE      ------------------------------------------------------MGLCGC
Q8EA75_SHEON      ------------------------------------------------------------
                                                                              

DEAD_ECOLI        -----MAEFETTFADLGLKAPILEALNDLGYEKPSPIQAECIPHLLNGRDVLGMAQTGSG
Q8ZLT4_SALTY      RHTYYMAEFETTFADLGLKAPILEALTDLGYEKPSPIQAECIPHLLGGRDVLGMAQTGSG
Q32BH1_SHIDS      RHTYYMAEFETTFADLGLKAPILEALNDLGYEKPSPIQAECIPHLLNGRDVLGMAQTGSG
D0ZB80_EDWTE      -----MAEFETTFADLGLAAPIIEALNDLGYEKPSPIQAACIPHLLNGRDVLGMAQTGSG
Q8D1D0_YERPE      RHVYMTTELETSFADLGLSAPILSALTDLGYEKPSPIQLECIPHLLNGRDVLGMAQTGSG
Q0WBG1_YERPE      ----MTTELETSFADLGLSAPILSALTDLGYEKPSPIQLECIPHLLNGRDVLGMAQTGSG
DEAD_BUCAI        -----MTHIESTFSFLGLNPFIIQSLNEMGYVKPSPIQASCIPLLLEGRDVLGMAQTGSG
DEAD_BUCAP        -----MTHTESTFSFLGLNPFIIKSLSKMGYVKPSPIQAACIPLLLEGRDVLGMAQTGSG
DEAD_BUCBP        -----MTHTNMTFSSFGLNSCIITALNDIGYVQPSPIQAACIPYLIKGKDVLGMAQTGSG
Q057K4_BUCCC      -----MTQIHLSFSVFGLNSFLLKSLKILGYEKPSPIQSACIPYLLSGKDVLGMAQTGSG
Q8D2Y1_WIGBR      -----MNKKELSFSELGLKDFILLALNDLGYKKPSPIQEKCIPFLLKGYDVLGIAQTGSG
DEAD_HAEIN        ------MTDKITFNDLGLPEFILKAVSDLGFETPSPIQQSCIPHLLNGNDVLGMAQTGSG
Q8P7G9_XANCP      --MTQESSAPLLFADLGLSDAVMKAVAAVGYETPSPIQAATIPALLAGRDVLGQAQTGTG
Q3RD00_XYLFS      --MSNPSSTPLLFADLGLSDAVMQAVTKIGYETPSPIQAATIPALLAGRDVLGQAQTGTG
Q8KET5_CHLTE      PTMSEQQDNSVNFRSLELAEPLLRALEAVGYENPTPIQASTIPLLLEGRDVLGQAQTGTG
A1BHB4_CHLPD      --MSEETVIAQNFRSLQLIEPLMKALEEVGYENPTPIQAQTIPLLLEGRDLLGQAQTGTG
K0NS32_DESTT      --MPQNNLPLTGFDEMNLSPPVFSALQDVGYETPTPIQAMTIPHLIRNKDVLGQARTGTG
DEAD_MYCTU        ------AASAATFADLQIHPRVLRAIGDVGYESPTAIQAATIPALMAGSDVVGLAQTGTG
A0R2A4_MYCS2      ---SDSAPTEPTFADLQIHPAVLQAVTDVGYESPSAIQAATIPPMLAGSDVVGLAQTGTG
Q5YQK7_NOCFA      GAESGSGSAGPSFADLGIDDRILRAIADVGYESPSPIQAATIPPLLDGADVVGLAQTGTG
Q6NHW2_CORDI      AQQEADSAEKDGFEALGLPDAILKAVAKVGFETPSPIQAQTIPVLMQGHDVMGLAQTGTG
Q5ZT20_LEGPH      -----MNQEISNFSTFNFSNALNKALEDMKFITPSPIQAQTIPLILQGRDAIALAQTGTG
Q3AX69_SYNS9      TADEAKSEPQSGFDGFGFSEALLKTLADKGYSDPSPIQKAAFPELMLGRDLVGQAQTGTG
Q7VBJ8_PROMA      SQLENVEKASNGFEGFGFSEALLKTLKNKGYEEPTPIQKASIPELMLGRDLLGQAQTGTG
Q31AC4_PROM9      LEISIGNDNENGFLDFGFNQSILNSLSNKGYKNPTPIQKAAIPELMLGRDLLGQAQTGTG
Q5NEY5_FRATT      ----MNSETKKDFSQLGLNQDIVDTVIKLGYENPTPIQQYAIPYILSGRDVLGQAQTGTG
Q5E0J2_ALIF1      -----MSESITEFRQLALDESILSALDDMGFVAPTPIQAASIPLLLEGRDALGKAQTGTG
Q9KLE2_VIBCH      FSGIPMQDTAIQFSDLALNSAILSALTEMGFVSPTPIQAAAIPVLLEGRDALGKAQTGTG
E1STD6_FERBD      ------MSNSVEFSSLGLPESLLSALSAMGFTSPTPIQAQAIPFMLDGHDILGEAATGTG
Q4K8U0_PSEF5      -----MTQEIGGFAALELHPNIVAAVVATGYEEPSAIQQQSIPIILAGHDMIGQAQTGTG
A5W761_PSEP1      -----MTQETGGFAALDLNPNIVAAVVATGYEEPSAIQQQSIPIILAGHDMIGQAQTGTG
Q9I003_PSEAE      IRGKPMTQETVGFAALGIHPNVLAAIVAVGYEEPSPIQAQSIPLILEGHDMIGQAQTGTG
Q8EA75_SHEON      -----MSSDERTFRELGLSENLLRALDELGYEKPTPIQSASIDPLMAGKDILGQAQTGTG
                              *  : :   :  ::    :  *:.**   :  :: . * :. * **:*

DEAD_ECOLI        KTAAFSLPLLQNLDP--ELKAPQILVLAPTRELAVQVAEAMTDFSKHMRGVNVVALYGGQ
Q8ZLT4_SALTY      KTAAFSLPLLNNLDP--ELKAPQILVLAPTRELAVQVAEAMTDFSKHMRGVNVVALYGGQ
Q32BH1_SHIDS      KTAAFSLPLLQNLDP--ELKAPQILVLAPTRELAVQVAEAMTDFSKHMRGVNVVALYGGQ
D0ZB80_EDWTE      KTAAFSLPLLNNIDP--SLKAPQVLVLAPTRELAVQVAEAMADFSKHMHGINVVALYGGQ
Q8D1D0_YERPE      KTAAFGLPLLHNIKA--DLKSPQVLVLAPTRELAVQVAEALSSFSKHINGVNVVALYGGQ
Q0WBG1_YERPE      KTAAFGLPLLHNIKA--DLKSPQVLVLAPTRELAVQVAEALSSFSKHINGVNVVALYGGQ
DEAD_BUCAI        KTAAFSLPLLHNLNI--NLKAPQILVLAPTRELAVQVAEAFSDFSKYMIGIHVLPLYGGQ
DEAD_BUCAP        KTAAFSLPLLHNLNI--NLKAPQILVLAPTRELAVQVAEAFSDFSKYIMGIHVLPLYGGQ
DEAD_BUCBP        KTAAFALPLLHNIKL--DVRVPQILVLTPTRELAVQVAEAFSNFSKKLIGVHVLALYGGQ
Q057K4_BUCCC      KTAAFALPLLNNINI--SLKFPQILVLVPTRELAVQVAKSFSDFSKYLIGTQVLALYGGQ
Q8D2Y1_WIGBR      KTAAFFLPLLNNIDL--KLKLPQIIILTPTRELALQIKFACCSLSKYIKEINIIALYGGQ
DEAD_HAEIN        KTAAFALPLLAQIDP--SEKHPQMLVMAPTRELAIQVADACELFVKYAQGTRIVTLYGGQ
Q8P7G9_XANCP      KTAAFALPVLSNADL--NQVKPQALVLAPTRELAIQVAEAFQKYAEAIPGFRVLPVYGGQ
Q3RD00_XYLFS      KTAAFALPLLTRTVL--NQVKPQVLVLAPTRELAIQVAEAFQRYAASISGFRVLPVYGGQ
Q8KET5_CHLTE      KTAAFALPVLSNIDL--SATDPQALVLAPTRELAIQVAEAFHTYAEFMPGFHVLPIYGGQ
A1BHB4_CHLPD      KTAAFALPILSNITI--ARREPQALVLAPTRELAIQVAEAFHRYAEYLKGFHVLPIYGGQ
K0NS32_DESTT      KTAAFALPLLSRIDL--DNKRPQVLVLTPTRELAIQVAESFKTYGARMKGLNVLSVYGGQ
DEAD_MYCTU        KTAAFAIPMLSKIDI--TSKVPQALVLVPTRELALQVAEAFGRYGAYLSQLNVLPIYGGS
A0R2A4_MYCS2      KTAAFAIPILSKIDT--SRRDTQALVLAPTRELALQVAEAFGRYGSHLPQVNVLPIYGGS
Q5YQK7_NOCFA      KTAAFAIPILMGLEV--TGRQPRALVLAPTRELAIQVAEAFGRYAAHMPGLHVLPIYGGQ
Q6NHW2_CORDI      KTAAFALPILSRIDV--KKRHPQALILAPTRELALQVADSFQSFADHLGDIHVLPIYGGQ
Q5ZT20_LEGPH      KTAAFALPILQNLSP--EISTTQALILAPTRELAIQVAEQFELLSKYQRNVTIAVLCGGQ
Q3AX69_SYNS9      KTAAFALPLLERLE--SGQKTPQVLVLAPTRELAMQVADSFKAYAAGHPHLKVLAVYGGT
Q7VBJ8_PROMA      KTAAFALPLLERIN--SKERNPQVLVLTPTRELAMQVAESFKAYSEGHANINILAVYGGS
Q31AC4_PROM9      KTAAFALPLIEKLAD-NKELNAKVLVMTPTRELATQVAESFKSYSSESTNFKTIAIYGGT
Q5NEY5_FRATT      KTAAFALPLINNMDLASRDRAPQVLVLAPTRELAIQVAEQFEAFAKNVPNLDVACIYGGQ
Q5E0J2_ALIF1      KTAAFSLPLLNKINL--KQHNPQAIIMAPTRELAIQVAAEVKNLGRNIKGLKVLEIYGGA
Q9KLE2_VIBCH      KTAAFSLPLLNKLNL--SQYKPQAIVMAPTRELAIQVAAEIKNLGQNIKGLKVLEIYGGA
E1STD6_FERBD      KTAAFGLPALAGIDP--RQRAAQMLVLAPTRELAIQVATALEEFAVNMKGMRVTTLYGGQ
Q4K8U0_PSEF5      KTAAFALPILHRIDP--SKREPQALILAPTRELALQVATAFETYAKQMPGVTVVAVYGGA
A5W761_PSEP1      KTAAFALPILNKIDV--SKREPQALILAPTRELALQVATAFETYAKQMPGVNVVAVYGGA
Q9I003_PSEAE      KTAAFALPLLSRIDP--SRREPQMLVLVPTRELALQVATACETYSKQLPGVGVVAVYGGA
Q8EA75_SHEON      KTGAFALPLLNKVT---SQTTPQILVLAPTRELAVQVAEAFSSYAKFMKNFHVLPIYGGQ
                  **.** :* :           .: :::.****** *:                  : ** 

DEAD_ECOLI        RYDVQLRALRQGPQIVVGTPGRLLDHLKRGTLDLSKLSGLVLDEADEMLRMGFIEDVETI
Q8ZLT4_SALTY      RYDVQLRALRQGPQIVVGTPGRLLDHLKRGTLDLSKLSGLVLDEADEMLRMGFIEDVETI
Q32BH1_SHIDS      RYDVQLRALRQGQQIVVGTPGRLLDHLKRGTLDLSKLSGLVLDEADEMLRMGFIEDVETI
D0ZB80_EDWTE      RYDVQLRALRQGPQIVVGTPGRLLDHLKRGTLSLTSLRGLVLDEADEMLRMGFIEDVETI
Q8D1D0_YERPE      RYDVQLRALRQGPQVVVGTPGRLLDHLKRGTLNLSNLSGLVLDEADEMLRMGFIEDVETI
Q0WBG1_YERPE      RYDVQLRALRQGPQVVVGTPGRLLDHLKRGTLNLSNLSGLVLDEADEMLRMGFIEDVETI
DEAD_BUCAI        RYELQLRALRQGPQIVVGTPGRLLDHLKRGTLNLSNLHGLVLDEADEMLRMGFIEDVETI
DEAD_BUCAP        RYEVQLRALRQGPQIVVGTPGRLLDHLKRGTLNLSNLYALVLDEADEMLRMGFIEDVETI
DEAD_BUCBP        RYDLQLKSLRKGPQIIVGTPGRLLDHLKRRTLSLSNLHSLVLDEADEMLRMGFIEDVETI
Q057K4_BUCCC      RYEIQLHALRRGPQIIVGTPGRLLDHLKRGTLSLIHLSSLVLDEADEMLRMGFIEDVETI
Q8D2Y1_WIGBR      NYSIQIKSLKRNPQIVVGTPGRILDLLNKKYLNLSEITSFVLDEADEMLRMGFIEDVENI
DEAD_HAEIN        RYDIQLRALKQGAQVVVGTPGRILDHIRRGTLNLSELRFIVLDEADEMLRMGFIDDVETV
Q8P7G9_XANCP      PYAQQLSALKRGVHVVVGTPGRVIDHLDRGTLDLSQLKTLVLDEADEMLRMGFIDDVEAV
Q3RD00_XYLFS      SYGQQLAALKRGVHVIVGTPGRVIDHLERGTLDLSELKTLVLDEADEMLRMGFIEDVEEV
Q8KET5_CHLTE      DYGVQIRNLKRGVHVVVGTPGRVMDHMRKGTLNLDNLKCLVLDEADEMLRMGFIDDVEWI
A1BHB4_CHLPD      DYGIQLRMLKQGVHVVVGTPGRVMDHMRRGSLNLDGLQCLVLDEADEMLRMGFIDDVEWI
K0NS32_DESTT      SYGIQLNQLKKGVHVVVGTPGRLMDHMRKKTVSFADLFCVILDEADEMLHMGFIDDVEWI
DEAD_MYCTU        SYAVQLAGLRRGAQVVVGTPGRMIDHLERATLDLSRVDFLVLDEADEMLTMGFADDVERI
A0R2A4_MYCS2      SYTVQLSGLRRGAQVVVGTPGRVIDHLERGTLDLSKLDYLVLDEADEMLTMGFAEEVERI
Q5YQK7_NOCFA      SYGVQLSGLRRGAHVVVGTPGRVIDHLEKGTLDLSQLQYLVLDEADEMLKMGFQEDVERI
Q6NHW2_CORDI      AYGIQLSGLRRGAQIIVGTPGRVIDHLEKGSLDISNLRFLVLDEADEMLNMGFQEDVERI
Q5ZT20_LEGPH      EYGRQLKQLRSGAQVVVGTPGRILDHIDKGTLLLNNLKTFILDEADEMLRMGFIEDVETI
Q3AX69_SYNS9      DFRSQISTLRRGVDVVVGTPGRVMDHMRQGTLDTSGLTSLVLDEADEMLRMGFIDDVEWI
Q7VBJ8_PROMA      DFRSQIYSLKRGVEIIVGTPGRVMDHIRQGTLNQDSLQCLVLDEADEMLRMGFIDDIEWI
Q31AC4_PROM9      DYRNQIYALKRKVDVVVGTPGRIMDHIRQGTFKVNSINCLVLDEADEMLNMGFLEDIEWI
Q5NEY5_FRATT      EYGSQIRALKQGVKVVVGTTGRVMDHIEKGTLQLDNLRALVLDEADEMLRMGFIDDVKFV
Q5E0J2_ALIF1      SIVDQMRALSRGAHIIVGTPGRVKDLLNRDRLNLGEVHTFILDEADEMLKMGFVDDVTWI
Q9KLE2_VIBCH      SILDQMRALKSGAHIVVGTPGRVKDLITRDRLHLDECHTFILDEADEMLKMGFVDDVTWI
E1STD6_FERBD      PYGPQLRDLERGTQVVVATPGRLMDHIRRGSIELDSIQCCVLDEADEMLNMGFLEDIEWI
Q4K8U0_PSEF5      PMGPQLKAIRNGAQIVVATPGRLCDHLRRDEKVLATVNHLVLDEADEMLKLGFMDDLEVI
A5W761_PSEP1      PMGPQLRAIRNGAQIVVATPGRLCDHLRRDEKVLSTVQYLVLDEADEMLKLGFMDDLEVI
Q9I003_PSEAE      PMGPQLKALRQGAQILVATPGRLCDHLRRDEKLLATVQRLVLDEADEMLKLGFMDDLEVI
Q8EA75_SHEON      SMQQQLNALKRGPQVIVGTPGRVMDHMRRGTLKLETLQALVLDEADEMLKMGFIDDIEWI
                      *:  :    .::*.*.**: * : :           :******** :** :::  :

DEAD_ECOLI        MAQIPEGHQTALFSATMPEAIRRITRRFMKEPQEVRIQSSVTTRPDISQSYWTVWG-MRK
Q8ZLT4_SALTY      MAQIPEGHQTALFSATMPEAIRRITRRFMKEPQEVRIQSSVTTRPDISQSYWTVWG-MRK
Q32BH1_SHIDS      MAQIPEGHQTALFSATMPEAIRRITRRFMKEPQEVRIQSSVTTRPDISQSYWTVWG-MRK
D0ZB80_EDWTE      MAQIPAEHQTALFSATMPEAIRRITRRFMNEPQEVRIQSSVTTRPDISQSYWTVYG-MRK
Q8D1D0_YERPE      MAQIPAEHQTALFSATMPEAIRRITRRFMKEPQEVRIQSSVTTRPDISQSYWRVGGGYRK
Q0WBG1_YERPE      MAQIPAEHQTALFSATMPEAIRRITRRFMKEPQEVRIQSSVTTRPDISQSYWRVGGGYRK
DEAD_BUCAI        MAQIPKEHQTALFSATMPEAIRRISKRFMRNPKEIKIQSNITTRPDIKQSYWMVYG--RK
DEAD_BUCAP        MSQIPKEHQTALFSATMPEAIRRISKRFMKNPQEIKIQSNITTRPDIKQSYWMVYG--RK
DEAD_BUCBP        MTEIPDRHQTALFSATMPEAIRRISRRFMKNPKEIRIQSNITTRPDIQQSYWMVYG--KK
Q057K4_BUCCC      MSKIPRKHQTALFSATMPNIIRRISRRFMNTPKEIKIQSTGITRPDIQQSYWIVRG--RK
Q8D2Y1_WIGBR      FLKSSKQHQTILFSATMPAAIHRITKRFMKKPKEIRIKASENTRPNIKQNYWIVYG-LCK
DEAD_HAEIN        MAELPENHQTALFSATMPEPIRRITKRFMNDPQEVKIKVNNENAPDIDQSCWYVHG-VRK
Q8P7G9_XANCP      LKKLPEKRQVALFSATMPPAIRRIAQTYLKDPAEVTIAAKTTTSANIRQRYWWVSG-LHK
Q3RD00_XYLFS      LRKLPASRQVALFSATMPPQIRRIAQTYLQDPIEVTIATKTTTAANIRQRYWWVSG-LHK
Q8KET5_CHLTE      LDQTPESRQVALFSATMPQPIVRIARKYLKAPAEITIQTKTTTVETIRQRYWMVGG-HHK
A1BHB4_CHLPD      LDQTPKGRQVALFSATLPVPIRRIAQKYLNNPAEITIQNKTTTVEAIRQRYWIVGG-SHK
K0NS32_DESTT      LDRTPPDSQTALFSATMPRPIQKIAQKYLTSPEEFFIKPDNTELNTIKQQYWMVNG-AKK
DEAD_MYCTU        LSETPEYKQVALFSATMPPAIRKLSAKYLHDPFEVTCKAKTAVAENISQSYIQVA---RK
A0R2A4_MYCS2      LADTPEYKQVALFSATMPAAIRKITTKYLHDPVEVTVKAKTATAENISQRFIQVAG-PRK
Q5YQK7_NOCFA      LADTPREKQVALFSATMPAAIRKISKQYLREPVEITVKAKTQTNTNITQRWVQVSH-QRK
Q6NHW2_CORDI      LEDTPEDKQVALFSATMPNGIRRLSRDYMKDPHEIQVKSQTRTNTNITQRYLNVAH-RNK
Q5ZT20_LEGPH      LEKLPEKKQMALFSATMPYRIRQIANTYLNDPASIEIRMETATVKSIEQRFLFASV-HQK
Q3AX69_SYNS9      LEQLPKERQVVLFSATMPPEIRRLSKRYLNDPAEVTIKTKDQDGKLIRQRAITVPM-SHK
Q7VBJ8_PROMA      LEQLPNERQMVLFSATMPPEIRKLSKRYLRDPAEITIKAKKKEAQLIRQHYITVQN-SYK
Q31AC4_PROM9      IDQLPKNKQMVLFSATMPNEIRNIAKKYLNDPAEILIKSVKKETQLISQKFLYVQR-HHK
Q5NEY5_FRATT      LSHVSEQCQRLLFSATIPTDIADIIEEYLRNPCKIQVKAKTKTANTVTQKFIVIKG-FRK
Q5E0J2_ALIF1      LEKAPDTAQRILFSATMPPMVKTIVDRYLREPARVDVAGTNHTVDKVEQNFWVVKG-VEK
Q9KLE2_VIBCH      MEQAPESAQRVLFSATMPPMVKEIVERFLRNPECVDVAGSNQTVAKVEQQYWVVKG-VEK
E1STD6_FERBD      LEHLPDQTQMALFSATMPNQIRRIAERFLKDPKHVKIASDRTQKANIVQKAWKVSG-LNK
Q4K8U0_PSEF5      FKAMPETRQTVLFSATLPQSIRAIAERHLKDPKHVKIQSKTQTVTAIEQAHLLVHA-DQK
A5W761_PSEP1      FDAIPATRQTVLFSATLPSSIRSIAERHLREPKHVKIQTKTQTVTAIEQAHLMVHA-DQK
Q9I003_PSEAE      FEALPESRQTVLFSATLPASIRGIAERHLKQPKHVKIAAKTQTVARIEQVHLMVHA-DQK
Q8EA75_SHEON      LEHTPPQRQLALFSATMPEQIKRVANKHLKNATNISIAASHTTVDSIEQRFVQVSQ-HNK
                  :   .   *  *****:*  :  :   .:  .  .           : *          *

DEAD_ECOLI        NEALVRFLEAEDFDAAIIFVRTKNATLEVAEALERNGYNSAALNGDMNQALREQTLERLK
Q8ZLT4_SALTY      NEALVRFLEAEDFDAAIIFVRTKNATLEVAEALERSGYNSAALNGDMNQALREQTLERLK
Q32BH1_SHIDS      NEALVRFLEAEDFDAAIIFVRTKNATLEVAEALERNGYNSAALNGDMNQALREQTLERLK
D0ZB80_EDWTE      NEALVRFLEAEDFDAAIIFVRTKNATLEVAEALERNGYSSAALNGDMNQALREQTLERLK
Q8D1D0_YERPE      NEALVRFLEAEDFDAAIIFVRTKNATLEVAEALERSGYNSAALNGDMNQALREQTLERLK
Q0WBG1_YERPE      NEALVRFLEAEDFDAAIIFVRTKNATLEVAEALERSGYNSAALNGDMNQALREQTLERLK
DEAD_BUCAI        TDALIRFLEAEDFSATIIFVRTKNATLEVSEALERNGYNSAALNGDMNQALREQTLERLK
DEAD_BUCAP        TDALIRFLEVEDFSATIIFVKTKNATLEVSEALERNGYNSAALNGDMNQALREQTLERLK
DEAD_BUCBP        TDALIRFLEAEDFSATIIFVRTKNATLEVSEVLERYGYNSAALNGDMNQSLREQTLEKLK
Q057K4_BUCCC      TDALIRFLEVEDFSATIIFVRTKNATLEVSEALEKNGYNSAALNGDMNQVLREQTLERLK
Q8D2Y1_WIGBR      IEALLRFLEVEIFDAVIIFVRTKNATLEVSDVLEKNGYNSSSLNGDMNQILREKTLNRFK
DEAD_HAEIN        NEALLRFLEVEDFDAAIIFARTKTGTLDITELLEKNGFRSAALNGDMTQQLREQTLDRLR
Q8P7G9_XANCP      LDALTRILEVEPFDGMIIFARTKAATEELAQKLQARGLAAAAINGDMQQAAREKTIAQLK
Q3RD00_XYLFS      LDALTRILEVETFDAMIIFVRTKAATEELAEKLQARGLTAAAINGDMQQAQRERTIHQLK
Q8KET5_CHLTE      LDALTRILEVEPFDGIIIFVRTKTETVALAEKLQARGYAAAALNGDMVQSARERTIEQLK
A1BHB4_CHLPD      LDVLTRILEVEPFDGILIFVRTKTMTLELAEKLQARGYDASALNGDMAQNMRERTVEQLK
K0NS32_DESTT      AHALTRILEAVSFDGVIVFVKTKTATLELAKILEDKGFKAEALNGDLAQNARERTVNRLK
DEAD_MYCTU        MDALTRVLEVEPFEAMIVFVRTKQATEEIAEKLRARGFSAAAISGDVPQAQRERTITALR
A0R2A4_MYCS2      MDALTRILEVEEGDAMIVFVRTKQATEEVADRLKARGFAAAAINGDINQAQRERTISALK
Q5YQK7_NOCFA      LDALTRVLEVEPFEAMIIFVRTKQGTEELAEKLRARGFSAAAINGDIAQNQRERTIGQLK
Q6NHW2_CORDI      LDALTRILEVTEFEAMIMFVRTKHETEEVAEKLRARGFSAAAINGDIAQAQRERTVDQLK
Q5ZT20_LEGPH      PDALIRVLEVEDYQGVIVFVRTKSSTEEVAELLQQHGLRAMAIHGDITQSLRERIIAQFK
Q3AX69_SYNS9      LEALQRVLDACGGEGVIIFARTKVITLTVAETLEAAGHQVAVLNGDVPQNQRERTVERLR
Q7VBJ8_PROMA      LEVLRRVLELNYGEGVIIFARTKAITLKLAESLEASNHNVAVLNGDVPQNLRERTVERLR
Q31AC4_PROM9      LDALKRILELN-NEGVIIFVRTKLLTTSIAEALENLGHSVAVLNGDIPQNQRENTVDRLK
Q5NEY5_FRATT      IDALDRLLETEETDGVIIFVKTKTSTIEVADNLKALGYKVAAINGDMQQSQREYIVDQFR
Q5E0J2_ALIF1      DEAMSRLLETEETDASIVFVRTRQDTERLADWLSARGFKAAALHGDIPQSQRERTVDNIK
Q9KLE2_VIBCH      DEAMARLLETEETDASIVFVRTRQDTERLADWLCARGFKAAALHGDIPQSLRERTVDHIK
E1STD6_FERBD      LTALERLSETLDYDAMIVFVRTRNDTMELANHLNNMGFKAAALNGDMSQQQREHTVAQLH
Q4K8U0_PSEF5      TSAVLSLLEVEDFDALIMFVRTKQATLDLASALEAKGYKAAALNGDIAQNQRERVIDSLK
A5W761_PSEP1      IPAVLRLLEVEEFDALIAFVRTKQATLDLAAALEAKGYKAAALNGDIAQNQRERVIDSLK
Q9I003_PSEAE      AGSIQRLLEVEQFDALIAFVRTKQATLDYAELLERQGYRAAALNGDMPQAQRERVIESLK
Q8EA75_SHEON      LEALVRVLEVENTEGIIIFVRTRNSCVELAEKLEARGYASSPLHGDMNQQARERAVEQLK
                     :  . :    .. : *.:*:      :  *   .     : **: *  **  :  ::

DEAD_ECOLI        DGRLDILIATDVAARGLDVERISLVVNYDIPMDSESYVHRIGRTGRAGRAGRALLFVENR
Q8ZLT4_SALTY      DGRLDILIATDVAARGLDVERISLVVNYDIPMDSESYVHRIGRTGRAGRAGRALLFVENR
Q32BH1_SHIDS      DGRLDILIATDVAARGLDVERISLVVNYDIPMDSESYVHRIGRTGRAGRAGRALLFVENR
D0ZB80_EDWTE      DGRLDILIATDVAARGLDVDRISLVVNYDIPMDAESYVHRIGRTGRAGRAGRALLFVDNR
Q8D1D0_YERPE      DGRLDILIATDVAARGLDVERISLVVNYDIPMDSESYVHRIGRTGRAGRAGRALLFVENR
Q0WBG1_YERPE      DGRLDILIATDVAARGLDVERISLVVNYDIPMDSESYVHRIGRTGRAGRAGRALLFVENR
DEAD_BUCAI        NGRLDILIATDVAARGLDVDRISFVINYDIPMDSESYVHRIGRTGRAGRAGRALLFVENR
DEAD_BUCAP        SGRLDILIATDVAARGLDVDRISFVINYDIPMDSESYVHRIGRTGRAGRAGRALLFVENR
DEAD_BUCBP        DGRLDILIATDVAARGLDVDRISFVINYDIPMDSESYVHRIGRTGRAGRKGKALLFVENR
Q057K4_BUCCC      NGKLDILIATDVAARGLDVDRISFVINYDIPTDAESYVHRIGRTGRAGRTGRALLFVEYR
Q8D2Y1_WIGBR      TGLLDILVATDVAARGLDVDRISLVINYDIPLDVESYIHRIGRTGRAGRTGKALMFVENR
DEAD_HAEIN        NGSLDIVVATDVAARGIDIERISLVVNYDIPLDAESYVHRIGRTGRAGRSGRALLFVEPR
Q8P7G9_XANCP      DGKLDILVATDVAARGLDVERVSHVLNYDIPYDTESYVHRIGRTGRAGRNGDAILFVTPR
Q3RD00_XYLFS      DGKLDILVATDVAARGLDVERISHVLNYDIPYDVESYVHRIGRTGRAGRSGEAILFVTPR
Q8KET5_CHLTE      DGTLNIVIATDVAARGLDVERISHVINYDIPTDTESYVHRIGRTGRAGRSGEAILFVSPR
A1BHB4_CHLPD      SGALNIVIATDVAARGLDVDRISHVINYDIPSDTESYVHRIGRTGRAGRSGEAILFVSPR
K0NS32_DESTT      NSHIDILVATDVAARGLDVDRISHVINYDMPSKVDPYVHRIGRTGRAGRTGEAILFVSRN
DEAD_MYCTU        DGDIDILVATDVAARGLDVERISHVLNYDIPHDTESYVHRIGRTGRAGRSGAALIFVSPR
A0R2A4_MYCS2      DGTIDILIATDVAARGLDVERISHVINYDIPHDTESYVHRIGRTGRAGRSGHAVLFVTPR
Q5YQK7_NOCFA      SGALDILVATDVAARGLDVDRISHVVNYDIPHDTESYVHRIGRTGRAGRSGQALLFVAPR
Q6NHW2_CORDI      DGRLDILVATDVAARGLDVERITHVFNYDIPNDTESYVHRIGRTGRAGRSGEAILFVTPR
Q5ZT20_LEGPH      QGAIDILVATDVAARGLDVERVTHVINYDMPHDNETYVHRIGRTGRAGRSGVTILFVTPK
Q3AX69_SYNS9      SGSVDVLVATDVAARGLDVERIGLVINYDMPFDSEAYVHRIGRTGRAGRTGEAVLFMTPR
Q7VBJ8_PROMA      QGGINILVATDVAARGLDVERIGLVINYDMPFDSEAYVHRIGRTGRAGRSGEAILFISPR
Q31AC4_PROM9      KGFIDILVATDVAARGLDVERIKLVVNYDFPFDKETYTHRIGRTGRAGRSGEAILFVNHR
Q5NEY5_FRATT      SAKSDILVATDVVARGIDLERISHVINYDMPNDTDTYVHRIGRTGRAGREGTSISLVPLK
Q5E0J2_ALIF1      NGVIDILVATDVVARGLDVPRITHVFNYDIPFDVESYIHRIGRTGRAGRKGKAILLVRTN
Q9KLE2_VIBCH      QGVIDILVATDVVARGLDVPRITHVYNYDIPFDVESYIHRIGRTGRAGRKGKAILLVRTN
E1STD6_FERBD      KGKINILIATDVVARGLDVPRITHVLNFDLPMDSESYVHRIGRTGRAGRSGEAILFARPR
Q4K8U0_PSEF5      DGRLDIVVATDVAARGLDVPRITHVFNVDMPYDPESYVHRIGRTGRAGREGRALLLVTPR
A5W761_PSEP1      DGRLDIVVATDVAARGLDVPRITHVFNVDMPYDPESYVHRIGRTGRAGRDGRALLLVTPR
Q9I003_PSEAE      DGSLDIVIATDVAARGLDVPRITHVLNIDMPYDPESYVHRIGRTGRAGREGRALLLVTPR
Q8EA75_SHEON      NGKLDILIATDVAARGLDVERIGHVVNYDIPYDTEAYVHRIGRTGRAGRTGMAILFVTSR
                   .  ::::****.***:*: *:  * * *:* . :.* *********** * :: :   .

DEAD_ECOLI        ERRLLRNIERTMKLTIPEVELPNAELLGKRRLEKFAAKVQQQLE-----SSDLDQYRALL
Q8ZLT4_SALTY      ERRLLRNIERTMKLTIPEVELPNAELLGKRRLEKFAAKVQQQLE-----SSDLDQYRALL
Q32BH1_SHIDS      ERRLLRNIERTMKLTIPEVELPNAELLGKRRLEKFAAKVQQQLE-----SSDLDQYRALL
D0ZB80_EDWTE      ERRLLRNIERTMKLTIPEVELPNAELLSTRRLAKFAARVQQQLE-----SSDLDQYRALL
Q8D1D0_YERPE      ERRLLQNIERTMKLTIPEVELPNADLLSERRLAKFAAKVSQQLE-----SSDLDMYRALL
Q0WBG1_YERPE      ERRLLQNIERTMKLTIPEVELPNADLLSERRLAKFAAKVSQQLE-----SSDLDMYRALL
DEAD_BUCAI        ERRLLRNIERTMKQSIPEVQLPKVELLCQRRLEQFAKKVQQQLE-----SRDLDEYSALL
DEAD_BUCAP        ERRLLRNIERTINQTIPEVQLPKIEVLCKRRLERFAKKVQEQLE-----SRDLDEYSALL
DEAD_BUCBP        ERRLLRNIERAMNISISEVNLPKSDFLSKRRLEKFAQKVQIQLD-----SKDLHEYRGLL
Q057K4_BUCCC      EYRLLKNIERIIKHPIHEIQLPKSEILIEKRLQNISNKIQEQLN-----NKNLKLYKSLL
Q8D2Y1_WIGBR      ERKILYNIERNIKEKLSQIKLPSVELLCKKRLNNFSEKIKNQIN-----SLDLNKYQNLL
DEAD_HAEIN        ERRLLRNIEHLMKKGINEVELPNHLVLQECRRKKFVAKITKQLE-----HHDLEQYRSLL
Q8P7G9_XANCP      EKGMLRAIERATRQPIEEMQLPSVDAVNDTRVARFMTRITETLA-----GGQIEMYRDLL
Q3RD00_XYLFS      EKGMLRQIERATHQPIEAMQLPSVDAVNDTRVTKFFGRISNALVV----GAEIDFYRKLL
Q8KET5_CHLTE      ERGMLFAIERATRKRIELMELPSTEIVNDKRIAKFKQRITDTVG-----AEDLEFYIGLI
A1BHB4_CHLPD      EKNMLYAIEKATRKRIELMELPSTEIINNKRISKFKQRITDTIA-----AGELDFYSRLI
K0NS32_DESTT      ERWMLKVIEKATKQKIQEISLPSNKTINKKRIADFKQAITQTLE-----SKDLNVFQELL
DEAD_MYCTU        ELHLLKAIEKATRQTLTEAQLPTVEDVNTQRVAKFADSITNALG-----GPGIELFRRLV
A0R2A4_MYCS2      ERHLLKSIEKATRSKLIEAELPSVEDVNAQRVAKFRDSISDSLN-----APGIDLFRRLI
Q5YQK7_NOCFA      ERHLLKAIERATRHPLEEMQLPSVEDVNAQRVSKFGDAITENLS-----SANLPLFRKLI
Q6NHW2_CORDI      ERRMLRSIERATNAKLIEMDLPTVDEVNESRKAKFADSITESLE-----DDQVAIFRSLI
Q5ZT20_LEGPH      ESRLISSIERHTRQRIEKVQVPNDHMIQMARQQRFMSNITTRLN-----HEHVYSYKRIV
Q3AX69_SYNS9      ERRFIRNLERATGQPIEMMEVPGNTAINQGRLDRLRKRLSEAANGVAGNSEEGALIQELM
Q7VBJ8_PROMA      ERSYLNNLERAVGQSIERMEIPNNESINNHRIQKIKRDLLTTASQKRKDQEETNLIKEVI
Q31AC4_PROM9      EKHFLRNLENSTRTKIEEINIPSNKIINEKRMEKLIENVNESSLAKEDNEENKALIIDVL
Q5NEY5_FRATT      EMRFLRTLERFTGSPMQEVFMPSAKELAQSRVEHFKARIISALD----KNKSLDKYKEII
Q5E0J2_ALIF1      QMRMLRTIERVTKSTMEEIQLPHRDQVAECRLAALAAELQADKEF-----VALDAFTDLI
Q9KLE2_VIBCH      QIRMLRTIERVTRSSMEEIQLPHRDKVAESRLTKLGQELAADKEF-----SSLERFADLV
E1STD6_FERBD      ELRQLRFYERSTGGTIEMMEMPTAEELGKHRVAKLSVELAECVAQ-----TDLAEMTGML
Q4K8U0_PSEF5      ERRMLQVIERVTGQKVAEVRLPDAQAVLDARIKKLTNSLSPLVAD-----AEATH-GDLL
A5W761_PSEP1      ERRMLQVIERVTGQKVAEARLPNAQAVLDARIKKLTSSLAPLVAE-----AEATH-GELF
Q9I003_PSEAE      ERRMLQVIERVTGQKVGEVRLPDAETVLEARLARLAASLTPLLDS-----AVEQR-GAVR
Q8EA75_SHEON      EMRMLRTIERATNSRISPMKVPSPETVAERRLSRLGEQLAQTMN------NDLEFMREAV
                  :   :   *.     :    :*    :   *   :   :                     

DEAD_ECOLI        SKIQPTAEGEELDLETLAAALLKMAQGERTLIVPPD---APM---------------RPK
Q8ZLT4_SALTY      AKIQPSAEGEELDLETLAAALLKMAQGERPLILPPD---APM---------------RPK
Q32BH1_SHIDS      SKIQPTAEGEELDLETLAAALLKMAQGERTLIVPPD---APM---------------RPK
D0ZB80_EDWTE      AKLQPEDE---QDMETLAAALLKMAQGERPLILPPD---PVVER-------------RPR
Q8D1D0_YERPE      AKLQPEEE---FDIETLAAALLKMAQGERPLILPPE---APR---------------RPQ
Q0WBG1_YERPE      AKLQPEEE---FDIETLAAALLKMAQGERPLILPPE---APR---------------RPQ
DEAD_BUCAI        DKLYSTDD---LDIKTLAAALLKMAQGERPLIIKPD-----VIK-------------RQS
DEAD_BUCAP        DKLYSPDD---LDIKTLASALLKMAQGGRPLIIKKD-----LLQ-------------RPS
DEAD_BUCBP        PKLQPNNNS--LDIESLAAALLKMAQGERSLIVKPE-----SIV-------------R-A
Q057K4_BUCCC      SKLKLKDG---WNFENLSAALLKLVQNERPLIIPPDKKSSPLSF-------------KRN
Q8D2Y1_WIGBR      SKIISFIGI--SDVKIISAALLKVAQKNKPLIISPD------------------------
DEAD_HAEIN        EDLFTADQ----DQENIAAAMLMLLQGKQKLILPPD----PPME-------------KRR
Q8P7G9_XANCP      QRYESENN---VPAIDIAAAMAKLLQGNAPFLLTPPVRGAREDFAPRER--------NDR
Q3RD00_XYLFS      QRFESEHN---VPAIEIAAALARLLQGDSPFLLSVPTRPQRE----RSE--------LAS
Q8KET5_CHLTE      GQYCQEHD---VSELEAAAALAKLLQGDEPFLLSAKPERERP-----------------V
A1BHB4_CHLPD      EQYCHEHD---VPELDAAAALASLLQGETPLLLSAKPER--------------------T
K0NS32_DESTT      EGYAQEQD---IPVVQVAAALAKLAHGDSPFLLPADKDKKTATAKPARKKQAAPKNISNN
DEAD_MYCTU        EEYEREHD---VPMADIAAALAVQCRGGEAFLMAPDP-PLSR------------------
A0R2A4_MYCS2      EDYERESN---VPLADIAAALAVQTRNGEEFLMTEPP-PDKR------------------
Q5YQK7_NOCFA      EDYEREHN---IPLVDIAAALAVGSYDGDNFFMEAEPEPERRE--------------RVP
Q6NHW2_CORDI      KSYAEEHD---VPLEDIAAALATQARAGSEFLMKEPP-PEKR---------------RER
Q5ZT20_LEGPH      EEYIKEHD---VSAVDVAAALALLLHKDMPWRKELNMPKAASAFKEERARAGEKG--LDL
Q3AX69_SYNS9      QRVATELQ---LTPEQIALAALNLAIGPNGLLRKGDDDWIQNTQ-------------RMD
Q7VBJ8_PROMA      NEIESELE---ITPKEIALAAINLSIGESPLLINTDESWINQAE-------------RFR
Q31AC4_PROM9      DNLKEKHS---MDDSNIAMAAINLVIGNKAFFVNEDDSWIHKQN-------------NTD
Q5NEY5_FRATT      TSIRDELQ---LDSEELLAGLTLLAQGKKTFFPKEIQAKEEKPA-------------RDN
Q5E0J2_ALIF1      NKLQETLE---IDATTIAAMLLKRQQGKRPLFYKGPDPMIAA----------------ME
Q9KLE2_VIBCH      EKLQASLE---IDATTLAAILLKRQQGKRPLFYVGADPMIEA----------------ME
E1STD6_FERBD      QEMAEQNE---LSMEQLAAALLFQRQRSKPL-----KPKADP----------------AP
Q4K8U0_PSEF5      DRLTADIG---CSPRALAAALLRKATNGQAL-NLAAIEKERP----------------LV
A5W761_PSEP1      DRLTTDLG---CSARALASALLRKATNGQAL-DLAAVEREQP----------------LV
Q9I003_PSEAE      DELCRRLG---CDAETLAAALLARLTAGKAL-DLESVRREQP----------------LT
Q8EA75_SHEON      AQLCQQLE---VDTDLLAAALLHQVQQERPLQLPAIQERVRD----------------ER
                                                                              

DEAD_ECOLI        REFRDRD----DRGPRDRND---------RGPRGDRE-DRPRR-ERRDV-----------
Q8ZLT4_SALTY      REFRDRD----DRGPRDRND---------RGPRGDRE-ERPRR-ERRDV-----------
Q32BH1_SHIDS      REFRDRD----DRGPRDRND---------RGPRGDRE-DRPRR-ERRDV-----------
D0ZB80_EDWTE      REFRERD----ERG-GDRFA---------RRERDERGGDRPRR-ERREV-----------
Q8D1D0_YERPE      REFNSRDDRGNDRGSRDRGDSRRDNRSDSRSADSRDGGERPARRERRDV-----------
Q0WBG1_YERPE      REFNSRDDRGNDRGSRDRGDSRRDNRSDSRSADSRDGGERPARRERRDV-----------
DEAD_BUCAI        RDLLFQD--------------------DRRREDNR--NSRTRRDRRDIN-----------
DEAD_BUCAP        REFSFKD--------------------DRRREDNHRNNNRNRRERREL------------
DEAD_BUCBP        RHLKIKD--------------------TYR---NNNYKSLNYVSRYNRD-----------
Q057K4_BUCCC      SFISFNN--------------------QKKYTNNRRFLNNKSNKNYKKM-----------
Q8D2Y1_WIGBR      NFFNKNK--------------------KINLLINKNNKRKKLNIIKNKK-----------
DEAD_HAEIN        RERNDRG---------------------DRRENPRSAERRGERKGYGNP-----------
Q8P7G9_XANCP      ADRGERPRF------------------EPKFERGPRAPDGERGARPPRPDRPAYGEDAGA
Q3RD00_XYLFS      EHHVKRP---------------------SSFKQTERPNNTEHPKRPQRN-----------
Q8KET5_CHLTE      RREEREPRY------------------DREHGRDSFRDDFRKEREPRRQ-----------
A1BHB4_CHLPD      RDHDDRPRS------------------QSDSG-------FAKKRK---------------
K0NS32_DESTT      RNTTERTNK------------------PGNTARKQTPKPMKKQTSSQKANITPTKETNIA
DEAD_MYCTU        RNRDQ---------------------------RRDRPQRPKRRP----------------
A0R2A4_MYCS2      RDRDRDR-----------------------DDRGDRGPRKERPPRE--------------
Q5YQK7_NOCFA      RERPARR-----------------------FDEERGGGSHHRATGT--------------
Q6NHW2_CORDI      RDRDDRRGG------------------RDRFDRDDRRGGRDRGSRFERN-----------
Q5ZT20_LEGPH      RGRFKEDRK------------------SSFADRKGARGSKKDFAKDFSNERKKFNDG---
Q3AX69_SYNS9      RDR--GDRG------------------DRGERRERRIDRPARAPEED-------------
Q7VBJ8_PROMA      KSN--DRRD------------------NRG-RSRRRNDLDIGTTEKD-------------
Q31AC4_PROM9      RNR--SNR--------------------NGNNRMRNSNRRNNFQNDS-------------
Q5NEY5_FRATT      RNSRDGRRN------------------ERFERRNDQGDRTKRFDKADRK-----------
Q5E0J2_ALIF1      RAKNRRS---------------------DRGERGERGGRGDRPERGERRQYNN-------
Q9KLE2_VIBCH      REKSRRR---------------------ERRDDRRDGDRPARREFGGRDQEN--------
E1STD6_FERBD      RFE--RG---------------------ERGERGERGERGERGERRERKPRPD-------
Q4K8U0_PSEF5      PNSAPRG---------------------DRPERS--GDRPDRGDRERRAPMPLG------
A5W761_PSEP1      PSFAPRG---------------------ERTERGERGERPDRGDRERRAPLPLA------
Q9I003_PSEAE      PS-APR----------------------ERADRGERGERPERSG-ERRPMAPPS------
Q8EA75_SHEON      SERSERGSD----------------RGAERGERRSRESRPMPASLGSAEALKDNP-----
                                                                              

DEAD_ECOLI        ---------------GDMQLYRIEVGRDDGVEVRHIVGAIANEGDISSRYIGNIKLFASH
Q8ZLT4_SALTY      ---------------GDMQLYRIEVGRDDGVEVRHIVGAIANEGDISSRYIGNIKLFASH
Q32BH1_SHIDS      ---------------GDMQLYRIEVGRDDGVEVRHIVGAIANEGDISSRYIGNIKLFASH
D0ZB80_EDWTE      ---------------GDMELYRIEVGRDDGVEVRHIVGAIANEGDISSRYIGNIRLFGSH
Q8D1D0_YERPE      ---------------GEMELYRIEVGRDDGVEVRHIVGAIANEGDISSRYIGNIKLFASH
Q0WBG1_YERPE      ---------------GEMELYRIEVGRDDGVEVRHIVGAIANEGDISSRYIGNIKLFASH
DEAD_BUCAI        ---------------KDAELYRIEVGRNDGVEVRHIVGAIANEGNINSRNIGNIKLFSSY
DEAD_BUCAP        ---------------KDIDLYRIEAGRNDGVEVRHIVGAIANEGNINSRNIGNIKLFSSY
DEAD_BUCBP        ---------------KNVDLYRIDVGRNDGVEVRHIVGAIANEGDISSRKIGNVRLFSNY
Q057K4_BUCCC      ---------------EDMILYRIDIGRNDRVEVRHIVGAIANEGDISSRLIGNIRLFSNY
Q8D2Y1_WIGBR      ---------------KSISLYKAEIGKKDGIESKHIVRTMINLGKIKSNDIGSIKIFFNY
DEAD_HAEIN        ---------------QPMDLYRIEVGRADGVEVRHIVGAIANEGDINSRYIGHIKLYDDY
Q8P7G9_XANCP      ERPRREPSAPRGEPEFGMESYRIEVGHTHGVKPANIVGAIANEAGLESRYIGRIDIQDDY
Q3RD00_XYLFS      -------APARNVPEFGMESYRIEVGRMHGVKPANIVGAIANEAGLESRYIGRIDIRDDH
Q8KET5_CHLTE      -------SKGGLYSDEKRETYRLEVGKVHDVKPGNIAGAIINEIGLDPEAVGKIVINDQY
A1BHB4_CHLPD      --------KGEMYGDEGRQRYRIEVGSTHGVKAGNILGAIINEIGLDPEAVGQISISDTY
K0NS32_DESTT      P----QEQASVPPLEKGMERYRIEVGRLHGVQAGNIVGAIANEAGLDSKHIGHININQDF
DEAD_MYCTU        ----------------DLTTYRVAVGKRHKIGPGAIVGAIANEGGLHRSDFGQIRIGPDF
A0R2A4_MYCS2      ----------------GLATYRIDVGKRHKVGPGHIVGAIANEGGLHRNEFGHITIRLDY
Q5YQK7_NOCFA      ----------------ELATYRISVGKRHRVVPGAIVGAIANEGGLRRSDFGHISIRPDH
Q6NHW2_CORDI      ---------------DDMQLYRLAVGKRQHVRPGAIVGALANEGGLSNKDFGRINIFVDH
Q5ZT20_LEGPH      -------RKAVNQESVAQDLFRIDVGKIHGVKPGNIVGAIANEAGLQSRYITGLKIHEDH
Q3AX69_SYNS9      -----------------MQRYRVAVGHRDRVKPGNLVGAIAGETGLQGRSIGRIQIFDNH
Q7VBJ8_PROMA      -----------------KERFRVDVGHRDRVKPGNIVGAIANESGLNGRMIGRIQIFESY
Q31AC4_PROM9      -----------------FETYKFDFGKFDGVRVANIISSICNSTNINGRSIGKIQIFNDY
Q5NEY5_FRATT      ---------PRRAVNIDLTTYKLDVGRDNDVQARNIVGAIANEGNIDSKHICNISIQKDY
Q5E0J2_ALIF1      ---------------DDFDTYQLEVGREQGVQVKDIVGALANELGFTKGSIGAIKLAPGH
Q9KLE2_VIBCH      ---------------HDWDTYQLQVGRDQGVQVKDIVGALANELGLTKGSIGAIKLAQGH
E1STD6_FERBD      ---------------IQWDTYRLEVGREHGTQVKDIVGAIANEIQLESNYIGQIRLHDAH
Q4K8U0_PSEF5      ---------------EGRARCRTALGARDGIAAKNLLGAILNEGGLAREAIGRIQVRDSF
A5W761_PSEP1      ---------------EGRVRCRTALGARDGIAAKNLLGAILNEGGLARDAIGRIQVRDSF
Q9I003_PSEAE      ---------------EGRARCRTALGARDGVAAKNLLGAILNEGGLSREDIGRIQIRDTF
Q8EA75_SHEON      --------------DLKMCRYVIDVGRENGVGVGNIVGAIANEANIDSRYIGAIQLYDSV
                                           *  .      :  :: .   :    .  : :    

DEAD_ECOLI        STIELPKGMPGEVLQHFTRTRILNK------------PMNMQLLGDAQPHTG--------
Q8ZLT4_SALTY      STIELPKGMPGEVLQHFTRTRILNK------------PMNMQLLGDAVPHAG--------
Q32BH1_SHIDS      STIELPKGMPGEVLQHFTRTRILNK------------PMNMQLLGDAQPHTG--------
D0ZB80_EDWTE      STIELPKGMPGDLLTHFTRTRILNK------------PMNMQLIGDAPAREQRRERS---
Q8D1D0_YERPE      STIELPKGMPGEMLSHFTRTRILNK------------PLNMQLLGDAQPHERRERPAGGN
Q0WBG1_YERPE      STIELPKGMPGEMLSHFTRTRILNK------------PLNMQLLGDAQPHERRERPAGGN
DEAD_BUCAI        STIELPKGMSKDLLQTFNRTRILNK------------PINMKLLRDS--RHY--------
DEAD_BUCAP        AIVELPKGLSKDLLQRLIKTKILNK------------KINIKLLRDI--KNY--------
DEAD_BUCBP        STIELPKGLSNTLPKTFIRTKILNK------------FINIKLLYNSNFKGN--------
Q057K4_BUCCC      STIELPKSYSKHLFTRLLHTRILNK------------PINIKLMSSV-------------
Q8D2Y1_WIGBR      STIEIYKKIPLNLLSILSKSTIFKK------------SLNLKLLNHNKISKK--------
DEAD_HAEIN        TTVELPQGMPKELLQQFAKTRVLNK------------QMQMSFLGAVKSDNSRGSDD--F
Q8P7G9_XANCP      SILDLPADMPRELLTHLKKVWVSGQ------------QLNMRKLEE--------------
Q3RD00_XYLFS      SVLDLPAEMPHEILQHLKKVWVSGQ------------QLQMHRIDT--------------
Q8KET5_CHLTE      STVELPAGMPNDVFQELKKVRVCGR------------QLRVSKMDEHQGGYGDRHDRGFG
A1BHB4_CHLPD      SSVELPEGMPEEVFHELRKVRVCGR------------QLRLTKIE---------------
K0NS32_DESTT      SFVDLPYGMPKEIFRLLKRTWVKSQ------------QMSISKCA---------------
DEAD_MYCTU        SLVELPAKLPRATLKKLAQTRISGV------------LIDLRPY----------------
A0R2A4_MYCS2      SLVELPEKLPKKTLKALENTRISGV------------LINLQPD----------------
Q5YQK7_NOCFA      SLVELPAQLPAETLEALRRTRISGV------------LIQLQLD----------------
Q6NHW2_CORDI      TLVELPKNMDPSVIDRLSDTRISGQ------------LIHIEKDNG--------------
Q5ZT20_LEGPH      STVRLPKGMPKEVMKDLTKAWVCGR------------QLNLTLIGSA-------------
Q3AX69_SYNS9      SLVDLPKGMPEDIFNSLRTLRVMNR------------ELQITQDS---------------
Q7VBJ8_PROMA      SLVDLPKGMPTKIFQSLKRVKVMNK------------ELNINRYT---------------
Q31AC4_PROM9      SLVDLPRDLHRETKNKLKKIKVRN------------------------------------
Q5NEY5_FRATT      TLVDLPANLSPKVINHLKKVWVAGK------------KLNLTAQ----------------
Q5E0J2_ALIF1      TYVQLPKKMSADVAGKLKKLRIRQNETKAVVVEGVDLTIERR-PRTGGG--RDDNRG--G
Q9KLE2_VIBCH      TFVQLPKAMSNDVSSKLRKLRIRQKEVGAVVCDFDDFRESRGGARREGGPRREGGRRPEG
E1STD6_FERBD      SLVQLPAAMPADVLSKLKSVTVRSR---PLAAERTNEVIEPRPRREGGRDDRRGGFRGEG
Q4K8U0_PSEF5      SLVELPEDGLDRLLTKLKDTRVAGK------------QLKLRRYRED-------------
A5W761_PSEP1      SLVELPEDGLEKLLSKLKDTRVAGK------------QLKLRRYRED-------------
Q9I003_PSEAE      SLIELPEANLERLLTKLKDTRVAGK------------ALRLRRYRED-------------
Q8EA75_SHEON      TTVDLPDGMPKDVLQHLKKVRVCGK------------PLNIREAGDQVFVDSGRGARSDR
                  : : :           :    :                                      

DEAD_ECOLI        -GERRGGGRGFGGERREGGRN-----FSGERREGGRGDGRRFSGERR-------EGRAPR
Q8ZLT4_SALTY      -GERRGGGRSFSGERREGGRN-----FSGERREGGRGDGRRFSGERR-------ESRGPR
Q32BH1_SHIDS      -GERRGGGRGFSGERREGGRH-----FSGERREGGRGDGRRFSGERR-------EGRAPR
D0ZB80_EDWTE      -GERGGERRSFGG--RDGGR-------DGDRR--SFGGQRRFSDDRRGDRGFNRDSRSTR
Q8D1D0_YERPE      GGERRGGGRPFSGERREGAGAPPRRSFSGDRAPTGGGERRGNRDGQRSAAPRRDDAAAPA
Q0WBG1_YERPE      GGERRGGGRPFSGERREGAGAPPRRSFSGDRAPTGGGERRGNRDGQRSAAPRRDDAAAPA
DEAD_BUCAI        -ENKTTHRSIFNKDKNSNRR---------------VSDGSFNKSNSP---------KKTE
DEAD_BUCAP        -ETRTHNRSIFNKDKNNKRR---------------FSDNRLNKSSS----------IKNE
DEAD_BUCBP        -YNDIKDVKVYNSNKLRSKK---------------MNNKKFVSSGVR---------KKIK
Q057K4_BUCCC      ---------VQIKENKRRKF---------------IKSKRI-------------------
Q8D2Y1_WIGBR      ------PILKKIGSRLSNRIS-----------------------------------KNTS
DEAD_HAEIN        NGKRKGRGGDFRGERGRERGN------------DNRGNRKFNEKSN----------RTFS
Q8P7G9_XANCP      ---------GEAAAAAASK----------------PKFPRGPRPAGRPNRPMDRAGAPHR
Q3RD00_XYLFS      ---------TETTAPAR-------------------EFKSKPGGAGKFPP------KPHH
Q8KET5_CHLTE      GDRSGNRSFGKDRSGDRGFGG------------DKKKSFGKPSGGGKRKKD----DGAFF
A1BHB4_CHLPD      ---------GQDSASSYAP----------------KKNFRKSA---KPEKD----QQAFF
K0NS32_DESTT      ------------------------------------------------------------
DEAD_MYCTU        ------RPP--DAAR-------------------RHNG-GKPRRKHVG------------
A0R2A4_MYCS2      ------RGPRREGAG-------------------KPSGKYKPHRKVK-------------
Q5YQK7_NOCFA      ------QGPPAQRAFSRGPRR------------DRDAGKRPERRKPRS------------
Q6NHW2_CORDI      ------RPPRRNDDGDRGGYR------------GGDRFDRDDRRGGRGGRDRGGYRGGRD
Q5ZT20_LEGPH      ------------------------------------------------------------
Q3AX69_SYNS9      ------------------------------------------------------------
Q7VBJ8_PROMA      ------------------------------------------------------------
Q31AC4_PROM9      ------------------------------------------------------------
Q5NEY5_FRATT      ------------------------------------------------------------
Q5E0J2_ALIF1      NGRGG----YRGNREN-REGGRG----------GERRFDR-NKGGDHRG--SHRGERAP-
Q9KLE2_VIBCH      NREGG----FRGGREGGREGGRGRGGEGRPFREGERRFER-NRSGESSG--SYRGER---
E1STD6_FERBD      RRRDGDNSNFRGRRDGENSNFRGRRDGDNSNFRGRRDGDNSNFRGRRDGDSNFRGRRDDD
Q4K8U0_PSEF5      ------------------------------------------------------------
A5W761_PSEP1      ------------------------------------------------------------
Q9I003_PSEAE      ------------------------------------------------------------
Q8EA75_SHEON      RPRSD-----------------------------RPAGDRKPRAASGDKPFADRKPRSDK
                                                                              

DEAD_ECOLI        RDDSTGRRRFGGDA-----
Q8ZLT4_SALTY      RDDSTGRRRFGGDA-----
Q32BH1_SHIDS      RDDSTGRRRFGGDA-----
D0ZB80_EDWTE      SDDNGHSRRRFNDA-----
Q8D1D0_YERPE      AAAAAPARRRFGDA-----
Q0WBG1_YERPE      AAAAAPARRRFGDA-----
DEAD_BUCAI        FKSSFFRRRNV--------
DEAD_BUCAP        TKSSFFRRKSV--------
DEAD_BUCBP        TNISCNRRRSV--------
Q057K4_BUCCC      -------------------
Q8D2Y1_WIGBR      NKISYNRQI----------
DEAD_HAEIN        DKPRRDRRSSF--------
Q8P7G9_XANCP      KGPPKPRGPRSE-------
Q3RD00_XYLFS      NKSTKPKPPYSG-------
Q8KET5_CHLTE      TGFTGTKKKRMKD------
A1BHB4_CHLPD      TG---QKKKRRN-------
K0NS32_DESTT      -------------------
DEAD_MYCTU        -------------------
A0R2A4_MYCS2      -------------------
Q5YQK7_NOCFA      -------------------
Q6NHW2_CORDI      RNDRGDRGGYRGGRGGYRD
Q5ZT20_LEGPH      -------------------
Q3AX69_SYNS9      -------------------
Q7VBJ8_PROMA      -------------------
Q31AC4_PROM9      -------------------
Q5NEY5_FRATT      -------------------
Q5E0J2_ALIF1      GGRGRGRSERSEG------
Q9KLE2_VIBCH      -GHSRRREEA---------
E1STD6_FERBD      GQRGRRRDNDSYGNR----
Q4K8U0_PSEF5      -------------------
A5W761_PSEP1      -------------------
Q9I003_PSEAE      -------------------
Q8EA75_SHEON      PAGERRPRKPREE------