CLUSTAL format seed alignment for MF_00965

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DBPA_ECOLI            -------MTAFSTLNVLPPAQLTNLNELGYLTMTPVQAAALPAILAGKDVRVQAKTGSGK
B2U0Z0_SHIB3          -------MTAFSTLNVLPPAQLTNLNELGYLTMTPVQAATLPAILAGKDVRVQAKTGSGK
A0A0H3HG78_KLEOK      -------MTAFSTLNVLPAAQLTNLNELGYLSMTPVQAAALPAILAGKDVRVQAKTGSGK
D2TK76_CITRI          -------MTAFSILNVLPAAQLANLRELGYLSMTPVQAAALPAILAGQDVRVQAKTGSGK
D2BZV7_DICZ5          -------MTSFAELNALAAEQLTTLNELGYLSMTPIQAAALPAILAGKDVRAQAKTGSGK
B4EU48_PROMH          -------MTSFADLHALPAEQLTNLNELGYLTMTPVQEASLPAILAGKDVRAQAKTGSGK
E6WAQ2_PANSA          -------MTAFSTLTQLPASQLDNLREMGFDAMTPIQAAALPAILQGRDVRAQAKTGSGK
E1SEL6_PANVC          -------MTAFSTLNSLPDSQLDNLREMGYTSMTPVQAATLPAILQGRDVRAQAKTGSGK
D2TAQ6_ERWP6          -------MTAFSTLTQLPASQIDNLNELGYLAMTPVQAESLPAILAGRDVRAQAKTGSGK
A0A0E1NNE3_YERPA      -----MSTTSFSSLT-LPAEQLSNLNELGYTEMTPVQAAVLPAILNGQDVRAKAKTGSGK
DBPA_BACSU            -------MS-HFKNYQISHDILRALEGLGYTEPTKVQQSVIPAALERKDLVVKSQTGSGK
D5DAX4_BACMD          -----MNQR-SFSQYGLSDKVAKALSSLQYNHPTEVQSKVLPIALEERDVVVKSQTGSGK
G7VTU1_PAETH          -----MSQK-HFTDYRLSEEIVRALDSLGYETPTEVQTKVIPVALEKKDLVAKSQTGSGK
B1YG35_EXIS2          -----MSKK-PFTDFQLSTPILEAIEQLGYHTPTDVQQAVIPVALSEKDIIVKSRTGSGK
F4BN83_CARS1          MKEVIMNKKKTFEEFAISDEIIAALTSLRYFHPTKVQEEVIPLALEGKDVIVESQTGSGK
A0A0H3GFT7_LISM4      -----------MNNLKLSEEIKRAINELGYTEATPVQKAVIPVALTGEDIVAKSQTGSGK
Q97FI9_CLOAB          ------MSELSFRDLGLSEEILKSIEKLGYKKPSSIQEKVIPVILNGKDIIAKAKTGSGK
A0A0H2YR10_CLOP1      ---------MKFNELNLSDDIIKALNNLGYKNPSEVQEASIPKLLKGEDIIVKSQTGSGK
                                      :.      :  : :   : :*   :*  *  .*: .:::*****

DBPA_ECOLI            TAAFGLGLLQQIDASLFQTQALVLCPTRELADQVAGELRRLARFLPNTKILTLCGGQPFG
B2U0Z0_SHIB3          TAAFGLGLLQQIDASLFQTQALVLCPTRELADQVAGELRRLARFLPNTKILTLCGGQPFG
A0A0H3HG78_KLEOK      TAAFGLGLLQHVDASLFQTQSLVLCPTRELADQVAGELRRLARFMANIKILTLCGGQPFG
D2TK76_CITRI          TAAFGLGLLQHIDAALFKTQSLVLCPTRELADQVAGELRRLARSMPNTKILTLCGGQPFG
D2BZV7_DICZ5          TAAFGLGLLQHLDAGQFKTQSLVLCPTRELADQVANELRRLARGMPNIKVLVLCGGVPFS
B4EU48_PROMH          TAAFGLGLLQRIDAKQFNTQSLVLCPTRELADQVANELRRLARFLPNIKILTLCGGVPFS
E6WAQ2_PANSA          TAAFGIGLLQRIDNSQFHTQALVLCPTRELADQVSNVLRQLARFTRNIKILTLCGGQPMS
E1SEL6_PANVC          TAAFGIGLLHHIDSTRFQTQALILCPTRELADQVGNVLRQLARFTRNIKVLTLCGGQPMS
D2TAQ6_ERWP6          TAAFGLGVMHRVDASQYVTQALVLCPTRELADQVTKELRRLARFTSNIKILTLCGGQPVG
A0A0E1NNE3_YERPA      TAAFGIGLLDKIAVGEFVTQALVLCPTRELADQVSKELRRLARFTQNIKILTLCGGQPMG
DBPA_BACSU            TASFGIPLCELANWDENKPQALILTPTRELAVQVKEDITNIGRF-KRIKATAVFGKSSFD
D5DAX4_BACMD          TASFGIPLCELVNWEENKPQALVLTPTRELAAQVKEDITNIGRF-KRIKAAAVYGKSPFA
G7VTU1_PAETH          TASYGIPLCELVDWNENKPQALILTPTRELALQVTEDITNIGRF-KRIKATPLYGKHPFH
B1YG35_EXIS2          TASFGIPLCELVEWEENKPQALILTPTRELALQVTEDVMNIGRY-KRIKATAVFGKQPFR
F4BN83_CARS1          TVSYGVPLCEKVDWEENKPQVLVLVPTRELAIQVKEDLMNVGRL-KRVKATAVYGKASFD
A0A0H3GFT7_LISM4      TAAFAIPIAEQVEWEENKPQALIIVPTRELAMQVKTECTNIGRF-KRVKAAAIYGQSPFA
Q97FI9_CLOAB          TAAFAIPVCEKIELEEREPQVLVLAPTRELAYQIKEDFLNIGRF-KRLRCISIFGKEPIS
A0A0H2YR10_CLOP1      TASFGIPVCEKINIEEKKVQCLVLTPTRELAIQVKDELSNIGRI-KKVRCAAIFGKQPFN
                      *.::.: : .         * *:: ****** *:     .:.*   . :   : *  .. 

DBPA_ECOLI            MQRDSLQHAPHIIVATPGRLLDHLQKGTVSLDALNTLVMDEADRMLDMGFSDAIDDVIRF
B2U0Z0_SHIB3          MQRDSLQHAPHIIVATPGRLLDHLQKGTVSLDALNTLVMDEADRMLDMGFSDAIDDVIRF
A0A0H3HG78_KLEOK      AQRDSLQHAPHIIVATPGRLLDHLQKGTVSLDALQTLVMDEADRMLDMGFSDAIDEVIRF
D2TK76_CITRI          AQRDSLQHAPHIIVATPGRLLDHLQKGTVSLEGLTTLVMDEADRMLDMGFSDAIDEVIRF
D2BZV7_DICZ5          IQRDSLIHAPHIIVATPGRLLDHLKKETVSLDALQTLVLDEADRMLDMGFADAIDEVIHH
B4EU48_PROMH          IQRDSLIHAAHIIVATPGRLLDHLNKQTVTLADVKTLVLDEADRMLDMGFFDDISDIISQ
E6WAQ2_PANSA          AQRDSLVHAPHIVVGTPGRILDHLKRDNLDLNQLQTLVLDEADRMLEMGFRDDMEAIIGF
E1SEL6_PANVC          AQRDSLVHPPHIVVGTPGRILDHINRENLKLDQLSTLVLDEADRMLEMGFLNDMETIIEA
D2TAQ6_ERWP6          AQRDSLLHAPHIVVGTPGRILDHLKRETLKLDAISTLVLDEADRMLEMGFREDIDTIISH
A0A0E1NNE3_YERPA      HQLDSLVHAPHIVVGTPGRIQEHLRKKTLVLDELKTLVLDEADRMLDMGFSDAIDDVIAY
DBPA_BACSU            KQKAELKQKSHIVVGTPGRVLDHIEKGTLPLDRLSYLVIDEADEMLNMGFIEQVEAIIKH
D5DAX4_BACMD          KQKVELKQKTHIVVGTPGRVLDHIEKETLALEKIRYLVIDEADEMLNMGFIDQVEAIIQH
G7VTU1_PAETH          IQKAELKQRTHMAVGTPGRVLDHIERGTLSLDRMAYLVIDEADEMLNMGFIEQVQSIIQA
B1YG35_EXIS2          GQVAELKQKTHIVVGTPGRVLDHLERGTLSLEKVKYLVLDEADEMLNMGFLDQVDTILKQ
F4BN83_CARS1          TQKSELKQKSHIVVGTPGRVLDHLQKGTFKIEKIECLVLDEADEMLNMGFADQVEAIINF
A0A0H3GFT7_LISM4      KQKLELSQKNHIVVGTPGRLLDHIEKGSLNVDKVAHLVLDEVDEMLSMGFIDQVEDILSR
Q97FI9_CLOAB          NQIRELKQRVHIVVGTPGRVLDHIERGTLNLEKVKYFIIDEADEMLNMGFIEQVESILIK
A0A0H2YR10_CLOP1      EQIRELKQRVHIVVGTPGRVFDHMERGTLDLSEVNYVVIDEADKMLSMGFIDQIKDILGE
                       *  .* :  *: *.****: :*:.: .. :  :  .::**.*.**.*** : :. ::  

DBPA_ECOLI            APASRQTLLFSATWPEAIAAISGRVQRDPLAIEIDSTDALP--PIEQQFYETSSKGKIPL
B2U0Z0_SHIB3          APASRQTLLFSATWPEAIAVISGRVQRDPLAIEIDSTDALP--PIEQQFYETSSKGKIPL
A0A0H3HG78_KLEOK      APASRQTLLFSATWPEAIAAISGRVQNNPQTIEIDAVDALP--AIEQQFFETSQHGKIAL
D2TK76_CITRI          APASRQTLLFSATWPEAIAAISARVQRDPVTIEIDAVDALP--AIEQQFFETSTQGKIPR
D2BZV7_DICZ5          APAERQTLLFSATWPEAIAAISRRIQRDPLVIEIDTVDELP--AVEQQFYEVSRNGKLDL
B4EU48_PROMH          MSTQRQTLLFSATWPDEIAKISRKIQQDPVTIEINSPDELP--AVEQQFYEISRYGKLGL
E6WAQ2_PANSA          TPAARQTLLFSATWPDTIASLSERYQRDALAVATETEAELP--AIEQRFIEVSASERTNL
E1SEL6_PANVC          TPASRQTLLFSATWPDGITAISTRFQRDALSVVTEDVSELP--SIDQQFFEASHNEKLGL
D2TAQ6_ERWP6          SPQARQTLLFSATWPQAIAQISQSIQRDPLTIETGDVSDLP--AIEQTFYEAGAREKLTA
A0A0E1NNE3_YERPA      TPPQRQTLLFSATYPSGIEQISARVQRQPLNVEVGDTDEEP--AIEQVFFETTREKRLPL
DBPA_BACSU            LPTERTTMLFSATLPQDIEKLSRQYMQNPEH-IEVKAAGLTTRNIEHAVIQVREENKFSL
D5DAX4_BACMD          LPSERVTMLFSATLPEDIEELSRKYMKKPVD-VEIKANGLTTSTIDHSVISVGNERKFEL
G7VTU1_PAETH          LPSDRATMLFSATFPEDVARLSRKYMNDPVE-IEIKAAGITTATIDHSLIQVAEADKLVL
B1YG35_EXIS2          LPKQRTTMLFSATFPQDIHQLSDRYMQSPKQ-VEITTKATEIAEIEHSYIKVTDKTKFAV
F4BN83_CARS1          LPAERQTLLFSATMPKEIERIASFYMKPDKQSIVIETTELSKPKIIQSSVKVQEDKKEQQ
A0A0H3GFT7_LISM4      LPKQRQNLFFSATMPEEMQDLIKRYQDNPMV---IEMASEKTNPIFHVEMQTDNKEK--T
Q97FI9_CLOAB          MPKNKNTFLFSATLPEEIVMLSKKYMKNFEN-IEVQNEGKTKGGIHQVYYEVESREKFDL
A0A0H2YR10_CLOP1      LRLNKTTALFSATFSKEIEEICEEYMRNPML-LEVKSKVFNRDRIEESAIEIEEKNKGKA
                          : . :**** .. :  :                       : .   .     :   

DBPA_ECOLI            LQRLLSLHQPSSCVVFCNTKKDCQAVCDALNEVGQSALSLHGDLEQRDRDQTLVRFANGS
B2U0Z0_SHIB3          LQRLLSLHQPSSCVVFCNTKKDCQAVCDALNEVGQSALSLHGDLEQRDRDQTLVRFANGS
A0A0H3HG78_KLEOK      LQKLLSQHQPASCVVFCNTKKDCQAVCDSLNAAGQSALSLHGDLEQRDRDQTLVRFANGS
D2TK76_CITRI          LQTLLSLHQPASCVVFCNTKKDCQAVCDALNASGQSALALHGDLEQRERDMTLVRFANGS
D2BZV7_DICZ5          LQKLLSREQPASCVVFCNTKKDCQAVYDALTHSNQSVLALHGDMEQRDRDQTLVRFANGS
B4EU48_PROMH          LQKLLSHHQPNSCVVFCNTKRDCQDVYEALTESNQSVLALHGDMEQKERDQTLIRFANGS
E6WAQ2_PANSA          LSALLSQQQPTSCVVFCNTKRECDDIAAALNDRQISALALHGDLEQRDRERVLIRFANGS
E1SEL6_PANVC          LIALLSDRQPSSCVVFCNTKRECDDVAAALNARDISALPLHGDLEQRDRERVLIRFANGS
D2TAQ6_ERWP6          LIGLLSERQPSSCVVFCNTKRECDEIAYALDKAQISAQPLHGDLEQRERDRMLIRFANGS
A0A0E1NNE3_YERPA      LISVLSHYQPASCVVFCNTKKDCQSVYESLESRGISVLALHGDLEQRDRDQVLVRFANRS
DBPA_BACSU            LKDVLMTENPDSCIIFCRTKEHVNQLTDELDDLGYPCDKIHGGMIQEDRFDVMNEFKRGE
D5DAX4_BACMD          LKDVTTVENPDSCIIFCRTQEQVNTLLDDLDDLGYPCDKIHGAMVQEDRFEVMNDFKKGK
G7VTU1_PAETH          LQNLLIVENPESCIIFCRTQENVDKLFRALADLEYPCDRIHGGMEQEERFEVMNAFRRGQ
B1YG35_EXIS2          LKDVTVVENPDRCMIFCRTKEHVDFVAQGLASMDYPVEKIHGGMEQDERLAVMKAFRAGE
F4BN83_CARS1          LLDLLTVENADSCMIFCNTQEAVNNLYTFLNKAGLPIDKIHGGMVQEDRFSVMDDFRQGR
A0A0H3GFT7_LISM4      LKDVLITENPDSAIIFCNTKNQVDELTDLLD---VKASKIHGGLRQEDRFRAMDDFKSGK
Q97FI9_CLOAB          LKKVIYKEVPGSSIIFCRTKNNVEDVLVKMKNMKFSCMAIHGGMLQENRIAVMNAFKRGE
A0A0H2YR10_CLOP1      LWKCLYSYHPESAIVFCNTRNKVKSVYKMLKDEGITCNELHGDMEQKKRIEVMENFRDKH
                      *        .  .::**.*:.  . :   :         :** : * .*   :  *    

DBPA_ECOLI            ARVLVATDVAARGLDIKSLELVVNFELAWDPEVHVHRIGRTARAGNSGLAISFCAPEEAQ
B2U0Z0_SHIB3          ARVLVATDVAARGLDIKSLELVVNFELAWDPEVHVHRIGRTARAGNSGLAISFCAPEEAQ
A0A0H3HG78_KLEOK      ARVLVATDVAARGLDIKSLELVVNYELAWDPEVHVHRIGRTARAGESGLAISLCAPEEAQ
D2TK76_CITRI          ARVLVATDVAARGLDIKALELVVNFELAWDPEVHVHRIGRTARAGNRGLAISFCAPAEAQ
D2BZV7_DICZ5          SRVLVATDVAARGLDIKALEMVINYELSWDPEVHVHRIGRTARAGEQGLAISLCAPEEAQ
B4EU48_PROMH          CRVLVATDVAARGLDIKALEMVINYELSHDPEVHIHRIGRTARAGESGLAISFCAPEEIP
E6WAQ2_PANSA          IRVLIATDVAARGLDIKSLALVVNYHLAWDPEVHLHRIGRTGRAGESGLAVSFVAADEMA
E1SEL6_PANVC          GRVLVATDVAARGLDIKSLAMVVNYQLAWDPEVHLHRIGRTARAGEHGVAVSLVAADEMA
D2TAQ6_ERWP6          CRVLVATDVAARGLDIKALAMVVNYQLSFDPEVHVHRIGRTARAGQEGCAVSFVAPDEMI
A0A0E1NNE3_YERPA      CRVLVATDVAARGLDIKDLELVINFELAFDPEIHIHRIGRTGRAGMSGLAVSLCTPQEMV
DBPA_BACSU            YRYLVATDVAARGIDIENISLVINYDLPLEKESYVHRTGRTGRAGNKGKAISFVTAFEKR
D5DAX4_BACMD          FRYLVATDVAARGIDIDNITHVINYDLPLEKESYVHRTGRTGRAGKKGKAITFVTPYEER
G7VTU1_PAETH          FRYLIATDVAARGIDITNITHVINYDIPLERESYVHRTGRTGRAGKTGKAITLVTPKDDR
B1YG35_EXIS2          FRYLVATDVAARGIDIENITHVIQYDMPVEKESYVHRTGRTGRAGALGKAISLVTESDMR
F4BN83_CARS1          FRYLVATDVAARGIDIENVTHVVNFDVPVEKESFVHRTGRTGRAGKTGMALTLVTPKEEK
A0A0H3GFT7_LISM4      SRFLIATDVAGRGIDVDNVSLVINYDLPIEKENYVHRIGRTGRAGKSGKAISFVKTNENP
Q97FI9_CLOAB          FTFLIATDVAARGIDVENVTHVINYDIPMEKESYIHRIGRTGRMGNKGIAITFVTSKEER
A0A0H2YR10_CLOP1      FKVLVCTDIAARGIHVDSIELVINYEVPMETESYVHRIGRTGRAGREGKAITFVNHYEKK
                         *:.**:*.**:.:  :  *:::.:. : * .:** ***.* *  * *:::    :  

DBPA_ECOLI            RANIISDMLQIKLNWQTPPAN----------------------SSIATLEAEMATLCIDG
B2U0Z0_SHIB3          RANIISDMLQIKLNWQTPPAN----------------------SSIVPLEAEMATLCIDG
A0A0H3HG78_KLEOK      RANILAEMLQMKLNWMSGPTN----------------------SSVVPLQAEMATLCIDG
D2TK76_CITRI          RANILAEMLQLTLNWCDAPTN----------------------MAIKPLEAEMMTLCIDG
D2BZV7_DICZ5          RANALEEMLKMKLTWHPLPSG----------------------LRITPLEAAMATLCIDG
B4EU48_PROMH          RANALEEMLNIKLDWQSAPSG----------------------LSITPLVATMATLCIDG
E6WAQ2_PANSA          RAHALEDYLQQSLNWVAASTLK--------------------GSAAKALPATMMTLCIDG
E1SEL6_PANVC          RAHALEDFLQQKLPWVSASTLK--------------------KGSSKPLPAAMMTLCIDG
D2TAQ6_ERWP6          RAHALEDYLQQKLVWCNLSALK--------------------AVAARPLLAEMVTVSLEG
A0A0E1NNE3_YERPA      RAHTIEDYLQIKLKWTPAEQVS--------------------RSTNIMLEPEMVTLCIDG
DBPA_BACSU            FLADIEEYIGFEIQKIEAPSQEEVARKKPEFLAKLNDRPESKKDKSEELNKDIMKLYFNG
D5DAX4_BACMD          MLSEIEEYIGFSIPTSTPPSKEEVQQAESAFTDKINERPEVKKDKSESLNKDIMKLYFNG
G7VTU1_PAETH          RLADIEAYIGFAIPKVKAPSEEAVDRRREDFEQKLHVRTVLKKDKREQLNQQIMKLNFNG
B1YG35_EXIS2          RLREVEQYRGEAIERRQAPTERELIRTADAFEEKITT-ADVRASKTEQLNADIMKLYFNG
F4BN83_CARS1          WWNEVKEYAGQTVIEVSLPTTRLVQSHKSAFEKKLQERPPLKQVRSKELNRGITKVYFNG
A0A0H3GFT7_LISM4      LLRDIEEMLDVTIEKKRKPTVIEVKANEEAFHKKQQKRPTIKKARGEKLNKNIMKLYFNG
Q97FI9_CLOAB          FLKEIEEQFSLEIIKEEPPTREEVKKGQEVFKTASKQLNKTKANKSEKLNKDITKIYLSA
A0A0H2YR10_CLOP1      YLENVEEYIGYEIRKASLPSDEEVKAGRKIFKESQKVQLKESKKPKKEVHVDIVKIHVNG
                          :       :                                   :   : .: ...

DBPA_ECOLI            GKKAKMRPGDVLGALTGDIGLDGADIGKIAVHPAHVYVAVRQAVAHKAWKQLQGGKIKGK
B2U0Z0_SHIB3          GKKAKMRPGDVLGALTGDIGLDGADIGKIAVHPAHVYVAVRQAVAHKAWKQLQGGKIKGK
A0A0H3HG78_KLEOK      GKKAKMRAGDVLGALTGDIGLEGADIGKIAVHPAHVYVAVRQGVAHKAFKQLQNGKIKGK
D2TK76_CITRI          GKKAKMRPGDVLGALTGDMGLDGADIGKITVHPAHVYVAVRQSVAHHAWKQLQNGKIKGK
D2BZV7_DICZ5          GKKAKMRPGDILGALTGDMGLDGADIGKITIHPMHAYVAVKQSLARQVWKQLQQGKIKGK
B4EU48_PROMH          GKKAKMRPGDILGALTGDLGFSGEDIGKINIHPTHAYVAVKQSIAKQVWKSLQQGKIKGK
E6WAQ2_PANSA          GRKAKIRPGDILGALTGEAGFSADQIGKIDLTPTHAYVAIAAAQAKTALIKLKEGKIKGK
E1SEL6_PANVC          GRKAKIRPGDILGALTGEAGYRAEQIGKIVLTPTHAYVAIEANQAKAALVKLKQGKIKGK
D2TAQ6_ERWP6          GRKAKIRPGDILGALTGEGGLNGDQVGKIDIASTLAYVAIRRELARKVMQQLQQVKIKGK
A0A0E1NNE3_YERPA      GRKAKIRPGDILGALTGDAGLTAADVGKIDMFPVHAYVAIRKASAKRALQQLQQGKIKGK
DBPA_BACSU            GKKKKIRAVDFVGTIAKIDGVSADDIGIITIMDNASYVEILNGKGPHVLKVMKNTTVKGK
D5DAX4_BACMD          GKKKKIRAVDFVGTIAKLDGVTADDIGIITIQENVSYVEILNGKGTKVLQAMKNKTIKGK
G7VTU1_PAETH          GKKKKFRAVDFVGTIAKLDGVTADDIGIITILDHVTDVEILNGKGPLVLEIMKNTTVKGK
B1YG35_EXIS2          GKKKKLRAVDFVGTIAKIEGMTAQDIGIITIQDTVTYVEILNGKGPLVLRAMKTTKVKGK
F4BN83_CARS1          GKKKKMRAVDFVGTIAKIPGINADDIGIITIQENVTYIDILNGKGPLVIEEMQDRTIKGK
A0A0H3GFT7_LISM4      GKKKKIRAVDFVGTISKLEGITAEDIGIITIEDHVSFVEILNGKGPAVLEMMRSRKVKGR
Q97FI9_CLOAB          GKKKKIRPGDIAGTISSIDGVSPEDIGIIDIHDNFSYVEILSGKGDIVLNAIEDKTIKGK
A0A0H2YR10_CLOP1      GKKKKIRAFDIVGCFSNLPGLTGEDIGIIDVQDGFSYVDILNGKGDKVLKSFKEVTIKGK
                      *:* *:*. *. * ::   *    ::* * :      : :    .  .   :.  .:**:

DBPA_ECOLI            TCRVRLLK--
B2U0Z0_SHIB3          TCRVRLLK--
A0A0H3HG78_KLEOK      ACRVRLLK--
D2TK76_CITRI          ACRVRLLK--
D2BZV7_DICZ5          AVKVRLLK--
B4EU48_PROMH          SVKVRLFR--
E6WAQ2_PANSA          SVRAILLK--
E1SEL6_PANVC          TCRAILLKD-
D2TAQ6_ERWP6          SCRARLLK--
A0A0E1NNE3_YERPA      NCKARLLK--
DBPA_BACSU            QLKVNKANK-
D5DAX4_BACMD          KLKVHKAIK-
G7VTU1_PAETH          LLKVRKGNK-
B1YG35_EXIS2          QLKVYEAFKK
F4BN83_CARS1          KLKVHKARK-
A0A0H3GFT7_LISM4      RLKVNEARKR
Q97FI9_CLOAB          KVRAEKAQK-
A0A0H2YR10_CLOP1      KVKIQKARK-
                        :