CLUSTAL format seed alignment for MF_00966

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

G6PD_ENCCU        ------------------------------------------------------------
A0JXU9_ARTS2      ------------------------------------------------------------
F0M529_PSEPM      ------------------------------------------------------------
G6PD_HELPY        ------------------------------------------------------------
G6PD_HELPJ        ------------------------------------------------------------
A1UN45_MYCSK      --------------------------------------------------MTSSPGWPP-
A6W799_KINRD      ------------------------------------------------MTTAPQTAQSGS
C8X971_NAKMY      ---------------------------------------------------MAQ------
D2S8C7_GEOOG      ------------------------------------------------------------
G6PD2_SCHPO       ------------------------------------------------------------
G6PD3_SCHPO       ------------------------------------------------------------
G6PD4_ARATH       MSLSSCLLPFSQSATAPSSSVCSCHLAASFSNFPVSSRDYSFSRSGSLVLNGGGSNLCRR
G6PD_SCHPO        ------------------------------------------------------------
G6PDC_TOBAC       ----------MVTLYSSPSTHSSGPVASYSNSSIGLYNYHHNKQIAVSSILSRKFGSLQI
G6PD2_ARATH       ----------MAALSSSVTTRSYHSGYLASFSPVNGDRHRSLSFLSASPQGLNPLDLCVR
G6PD3_ARATH       MSSLSCPTYRSRTSSSSPFLSNHHHSSL-INVVDPRRSLSFHYASP-QGLNLAELCVVRS
G6PD1_ARATH       --MATHSMI-IPSPSSSSSSLATAASPFKETLPLFSRSLTF------PRKSLFSQVRLRF
G6PDC_SPIOL       MEELVSCHHLPLLCLQSSVPPNGCLTFFQDSACQRCSHSEFSNGHPLNDVSLQNDVAVNP
G6PDC_SOLTU       -----MGVQ-LRLNPCSSSSAATSPSTFHNGTPYFCKKFNFLPFRT-QPLNWVSGIYSRI
G6PD_ASPNG        ---------------------------------------------------MASTIARTE
G6PD_EMENI        ---------------------------------------------------MSATIARAE
G6PD_CYBJA        ------------------------------------------------------------
G6PD_KLULA        ------------------------------------------------------------
G6PD_YEAST        ------------------------------------------------------------
G6PD_DICDI        ------------------------------------------------------------
G6PD_MEDSA        ---------------------------------------------------MGTNEWHVE
G6PD_SOLTU        ----------------------------------------------------MAASWCIE
G6PD5_ARATH       ---------------------------------------------------MGSGQWHME
G6PD6_ARATH       ---------------------------------------------------MGSGQWHVE
G6PD_CAEEL        MACKRH-----------------------------------------SVSDPISKDLVEC
G6PD_CERCA        MATQHFTNG--------------------------------------SATDDGETALEHI
G6PD_DROME        MATQK----------------------------------------------EDHTALDLI
G6PD_TAKRU        -----------------------------------------------MMIILFNCFFCAS
G6PD2_MOUSE       MAEQVT---------------------------------------------LSRTQVCGI
G6PD_MACRO        MAEQVA---------------------------------------------LSRTQVCGI
G6PD_HUMAN        MAEQVA---------------------------------------------LSRTQVCGI
G6PD_RAT          MAEQVA---------------------------------------------LSRTQVCGI
G6PD_CRIGR        MAEQVA---------------------------------------------LSRTQVCGI
G6PD1_MOUSE       MAEQVA---------------------------------------------LSRTQVCGI
O66787_AQUAE      ---------------------------------------------------MSSG-----
G6PD1_MYCTU       ------------------------------------------------------------
G6PD1_MYCBO       ------------------------------------------------------------
E8PQ82_THESS      ------------------------------------------------------------
G6PD_BORBU        ------------------------------------------------------------
G6PD2_MYCTU       -----------------------------------------------MKPAHAAASWRNP
G6PD2_MYCBO       -----------------------------------------------MKPAHAAASWRNP
G6PD_PSEAE        ------------------------------------------------------------
G6PD_DICD3        ------------------------------------------------------------
G6PD_ECOLI        ------------------------------------------------------------
G6PD_ECOL6        ---------------------------------------------------MA-------
G6PD_ECO57        ---------------------------------------------------MA-------
G6PD_BUCBP        ------------------------------------------------------------
G6PD_BUCAI        ------------------------------------------------------------
G6PD_BUCAP        ------------------------------------------------------------
G6PD_ZYMMO        ------------------------------------------------------------
G6PD_MYCS2        ---------------------------------------------------MNR------
G6PD_RHIME        -----------------------------------------------MSS----------
G6PD_TREPA        ---------------------------------------------------MGKIS----
G6PD_AGGAC        ------------------------------------------------------------
G6PD_HAEIN        ------------------------------------------------------------
G6PD_THEMA        ----------------------------------------------MKCSLGLEKCPDDT
G6PD_SYNE7        -----------------------------------------------MTPKLLENPLRIG
G6PD_SYNY3        ------------------------------------------------MVTLLENPFRTG
G6PD_NOSS1        ------------------------------------------------MVSLLENPLRVG
G6PD_NOSP7        ------------------------------------------------MVSLLENPLRVG
G6PD_CHLMU        ---------------------------------------------------MEEIKEMGP
G6PD_CHLPN        ------------------------------------------------MTNVVQETIGGL
G6PD_LEUME        ------------------------------------------------------------
G6PD_STRPN        ------------------------------------------------------------
G6PD_BACSU        ------------------------------------------------------------
                                                                              

G6PD_ENCCU        ------------------------------------------------------------
A0JXU9_ARTS2      ------------------------------------------------------------
F0M529_PSEPM      ------------------------------------------------------------
G6PD_HELPY        ------------------------------------------------------------
G6PD_HELPJ        ------------------------------------------------------------
A1UN45_MYCSK      ------------------------------------------------------------
A6W799_KINRD      PAD---------------------------------------------------------
C8X971_NAKMY      ------------------------------------------------------------
D2S8C7_GEOOG      ------------------------------------------------------------
G6PD2_SCHPO       ------------------------------------------------------------
G6PD3_SCHPO       ------------------------------------------------------------
G6PD4_ARATH       FCGLKLWILKSLNRRQGNNRKHQPVNELTTHSKHTFLSDDERGFAEETRAEDLRPEENIL
G6PD_SCHPO        ------------------------------------------------MSSA--------
G6PDC_TOBAC       NQKPFWNAVRMQDGAVATPPSKIENETPLKKLKNGILPVAPPKEQKDTIDFD--------
G6PD2_ARATH       FQRKSGRASVFMQDGAIVTNSNSSESKTSLKGLKDEVLSALSQEAAKVGVES--------
G6PD3_ARATH       QRRSVQSSVVVQDGSVATESSSSEEAKDV-----GVLTIPSLEADKVVAESD--------
G6PD1_ARATH       FAEK-HSQLDTSNGCATNFAS--------------LQDSGDQ-----LTEEH--------
G6PDC_SPIOL       IVAKSIDPSADLQLLPLLE-----------------------------------------
G6PDC_SOLTU       QPRK-HFEVFSSNGFPLNAVS--------------VQDVQ-------VPLTE--------
G6PD_ASPNG        ERQNAG------------------------------------------------------
G6PD_EMENI        EQQNGS------------------------------------------------------
G6PD_CYBJA        ---------------------------------------------------S--------
G6PD_KLULA        ---------------------------------------------------M--------
G6PD_YEAST        ------------------------------------------------MSEG--------
G6PD_DICDI        -------------------------------------------------MTS--------
G6PD_MEDSA        RRD-----------SIGTESP--------------------------VAR----------
G6PD_SOLTU        KRG-----------SIRNDSF---------------------------RDND--------
G6PD5_ARATH       KRS-----------TLKNDSF--------------------------VKEYN--------
G6PD6_ARATH       KRS-----------TFRNDSF--------------------------VREYG--------
G6PD_CAEEL        LRE-----------------S--------------------------MQRDL--------
G6PD_CERCA        IKS------------LETPTM--------------------------KCEGT--------
G6PD_DROME        IKS------------LKSPTM--------------------------VCEGT--------
G6PD_TAKRU        FREDGQHPTVSLGGVWGAAKE--------------------------LHEDK--------
G6PD2_MOUSE       LRE-----------------E--------------------------LYQND--------
G6PD_MACRO        LRE-----------------E--------------------------LYQGD--------
G6PD_HUMAN        LRE-----------------E--------------------------LFQGD--------
G6PD_RAT          LRE-----------------E--------------------------LYQGD--------
G6PD_CRIGR        LRE-----------------E--------------------------LYQGD--------
G6PD1_MOUSE       LRE-----------------E--------------------------LYQGD--------
O66787_AQUAE      ------------------------------------------------------------
G6PD1_MYCTU       ------------------------------------------------------------
G6PD1_MYCBO       ------------------------------------------------------------
E8PQ82_THESS      ------------------------------------------------------------
G6PD_BORBU        ------------------------------------------------------------
G6PD2_MYCTU       LRDKRDKR----------------------------------------------------
G6PD2_MYCBO       LRDKRDKR----------------------------------------------------
G6PD_PSEAE        ------------------------------------------------------------
G6PD_DICD3        ------------------------------------------------------------
G6PD_ECOLI        ------------------------------------------------------------
G6PD_ECOL6        ------------------------------------------------------------
G6PD_ECO57        ------------------------------------------------------------
G6PD_BUCBP        ------------------------------------------------------------
G6PD_BUCAI        ------------------------------------------------------------
G6PD_BUCAP        ------------------------------------------------------------
G6PD_ZYMMO        ------------------------------------------------------------
G6PD_MYCS2        ------------------------------------------------------------
G6PD_RHIME        ------------------------------------------------------------
G6PD_TREPA        ------------------------------------------------------------
G6PD_AGGAC        ------------------------------------------------------------
G6PD_HAEIN        ------------------------------------------------------------
G6PD_THEMA        LRC---------------------------------------------------------
G6PD_SYNE7        LR----------------------------------------------------------
G6PD_SYNY3        LR----------------------------------------------------------
G6PD_NOSS1        LQ----------------------------------------------------------
G6PD_NOSP7        LQ----------------------------------------------------------
G6PD_CHLMU        ------------------------------------------------------------
G6PD_CHLPN        N-----------------------------------------------------------
G6PD_LEUME        ------------------------------------------------------------
G6PD_STRPN        ------------------------------------------------------------
G6PD_BACSU        ------------------------------------------------------------
                                                                              

G6PD_ENCCU        ---------------------------------MKVVIFGSSGDLAKRKL--------FP
A0JXU9_ARTS2      --------------------------MAAQTTVKTLLILGASGDLTGRLL--------LP
F0M529_PSEPM      --------------------------MTSQSTVRTLLILGASGDLTGRLL--------LP
G6PD_HELPY        ------------------------------MLDFDLVLFGATGDLAMRKL--------FV
G6PD_HELPJ        ------------------------------MLDFDLVLFGATGDLAMRKL--------FV
A1UN45_MYCSK      --------------------------RPRSPSPTPHPVRIRTGSRRKNSIPTSSCCSGRP
A6W799_KINRD      --------------------------GSGPEQPTIFVMYGATGDLSRRLV--------SP
C8X971_NAKMY      --------------------------LTAPDAPVIIVLFGATGDLAKRMV--------LP
D2S8C7_GEOOG      ---------------------------MTDLPPTVFVLFGATGDLARRMV--------LP
G6PD2_SCHPO       --------------------------------MLSIIVFGASGDLATKMT--------FP
G6PD3_SCHPO       --------------------------------MVTFMVFGASGNLANKKT--------FP
G6PD4_ARATH       GTDLNDGFHNVGDLPPVSKQLSDDLSDVRRRASLCIAVVGATGELARGKI--------FP
G6PD_SCHPO        --------------------------NLSIKENGAMVVFGASGDLSKKKT--------FP
G6PDC_TOBAC       --------------------------SNKAKSTVSITVVGASGDLAKKKI--------FP
G6PD2_ARATH       --------------------------DGQSQSTVSITVVGASGDLAKKKI--------FP
G6PD3_ARATH       --------------------------GGEQLSTVSITVVGASGDLAKKKI--------FP
G6PD1_ARATH       --------------------------VTKGESTLSITVVGASGDLAKKKI--------FP
G6PDC_SPIOL       --------------------------SVKEEPTLSIIVVGASGDLAKKKI--------FP
G6PDC_SOLTU       --------------------------LGSGDTTVSITVIGASGDLAKKKI--------LP
G6PD_ASPNG        --------------------------TMELKDDTVIIVLGASGDLAKKKT--------FP
G6PD_EMENI        --------------------------TVELKDDTVIVVLGASGDLAKKKT--------FP
G6PD_CYBJA        --------------------------YDSFGDRVTIIVFGASGDLARKKT--------FP
G6PD_KLULA        --------------------------ATQFDENTVITIFGASGDLSKKKT--------FP
G6PD_YEAST        --------------------------PVKFEKNTVISVFGASGDLAKKKT--------FP
G6PD_DICDI        --------------------------TPDSRSVLTVIILGASGDLAKKKT--------YP
G6PD_MEDSA        --------------------------EVLETGTLSIVVLGASGDLAKKKT--------FP
G6PD_SOLTU        --------------------------NIPETGCLSIIVLGASGDLAKKKT--------FP
G6PD5_ARATH       --------------------------PVTETGSLSIIVLGASGDLAKKKT--------FP
G6PD6_ARATH       --------------------------IVPETGCLSIIVLGASGDLAKKKT--------FP
G6PD_CAEEL        --------------------------KFE--TPYVFVIFGASGDLAKKKI--------YP
G6PD_CERCA        --------------------------HFDSHVPHTFVIFGASGDLAKKKI--------YP
G6PD_DROME        --------------------------HFDGKIPHTFVIFGASGDLAKKKI--------YP
G6PD_TAKRU        --------------------------EFHQSDVHVFIIMGASGDLAKKKI--------YP
G6PD2_MOUSE       --------------------------AFHQADTHIFIIMGASGDLAKKKI--------YP
G6PD_MACRO        --------------------------AFHQSDTHIFIIMGASGDLAKKKI--------YP
G6PD_HUMAN        --------------------------AFHQSDTHIFIIMGASGDLAKKKI--------YP
G6PD_RAT          --------------------------AFHQADTHIFIIMGASGDLAKKKI--------YP
G6PD_CRIGR        --------------------------AFHQADTHIFIIMGASGDLAKKKI--------YP
G6PD1_MOUSE       --------------------------AFHQADTHIFIIMGASGDLAKKKI--------YP
O66787_AQUAE      --------------------------DTELRKRIEFIIFGGTGDLSRNKL--------IP
G6PD1_MYCTU       ------------------------MVDGGGGASDLLVIFGITGDLARKMT--------FR
G6PD1_MYCBO       ------------------------MVDGGGGASDLLVIFGITGDLARKMT--------FR
E8PQ82_THESS      -----------------------------------MVVLGISGDLARRLL--------VP
G6PD_BORBU        -------------------------MKERSVSNFDIVIFGVTGNLSRKKL--------IP
G6PD2_MYCTU       --------------------------LPRIAGPCGMVIFGVTGDLARKKV--------MP
G6PD2_MYCBO       --------------------------LPRIAGPCGMVIFGVTGDLARKKV--------MP
G6PD_PSEAE        -------------------------MPDVRVLPCTLALFGALGDLALRKL--------FP
G6PD_DICD3        ------------------------MAVTSTAQACDLVIFGAKGDLARRKL--------LP
G6PD_ECOLI        ------------------------MAVTQTAQACDLVIFGAKGDLARRKL--------LP
G6PD_ECOL6        --------------------------VTQTAQACDLVIFGAKGDLARRKL--------LP
G6PD_ECO57        --------------------------VTQTAQVCDLVIFGAKGDLARRKL--------LP
G6PD_BUCBP        --------------------------MKNKNSGYDLVIFGAKGDLSCRKL--------LP
G6PD_BUCAI        -------------------------MIIETNHACDLVIFGAKGDLTKRKL--------LP
G6PD_BUCAP        -------------------------MIIETNQACDLVIFGTKGDLARRKL--------LP
G6PD_ZYMMO        ----------------------------MTNTVSTMILFGSTGDLSQRML--------LP
G6PD_MYCS2        --------------------------TPSPVDPCDFVIFGGTGDLAARKL--------LP
G6PD_RHIME        --------------------------QIIPVEPFDYVVFGGTGDLAERKL--------LP
G6PD_TREPA        --------------------------GSGTVAPHILVIFGASGDLAARKL--------IP
G6PD_AGGAC        ----------------------------MKAENCCIVIFGASGDLTYRKL--------IP
G6PD_HAEIN        ----------------------------MQTDNNCIVIFGASGDLTHRKL--------IP
G6PD_THEMA        --------------------------FPKIEQPFGIVIFGASGDLTKRKL--------IP
G6PD_SYNE7        --------------------------QDKVPEPQILVIFGATGDLTQRKL--------VP
G6PD_SYNY3        --------------------------QERTPEPLILTIFGASGDLTQRKL--------VP
G6PD_NOSS1        --------------------------QQGMPEPQIIVIFGASGDLTWRKL--------VP
G6PD_NOSP7        --------------------------QQGMPEPQIIVIFGASGDLTWRKL--------VP
G6PD_CHLMU        --------------------------TLPACPPCVMVIFGATGDLTARKL--------FP
G6PD_CHLPN        --------------------------SPRTCPPCILVIFGATGDLTARKL--------LP
G6PD_LEUME        ---------------------------MVSEIKTLVTFFGGTGDLAKRKL--------YP
G6PD_STRPN        -----------------------------MSSKVIVTIFGASGDLAKRKL--------YP
G6PD_BACSU        -------------------------MKTNQQPKAVIVIFGATGDLAKRKL--------YP
                                                       .    *.                

G6PD_ENCCU        ALSRIDLEGVG------VVGYARTKYN--IEFSEVL-------QEV------------GN
A0JXU9_ARTS2      GLARLAARGR--ADGLTLVGAGSDPWT-QEQWLERV-------ETSFADSNSQADAAGKR
F0M529_PSEPM      GLARLAATGR--AAGLRLVGAGSDPWT-PEQWRERV-------HESFAAASASAGPEGKE
G6PD_HELPY        SLYEIYTHYGF-KNDSRIIASGRKELS-NEEFLTLL-------CEKTQLHS-------RE
G6PD_HELPJ        SLYEIYIHYGF-KNDSRIIASGRKELS-NEEFLALL-------CEKTQLHS-------RE
A1UN45_MYCSK      AIWRNANSCPGWPTWSSPRWRPRSGWS-ARHWRTSAATSSGRWREAVDAFGSHELSD--E
A6W799_KINRD      AFFELARLGRL-PRQWRLIGCGRGEKT-HEEFRDFI-------REALEEFGPQ--PA-DG
C8X971_NAKMY      AFYTLAEQHLM-PENYLLIGTGRGQVS-DEQFAQHI-------HDALTEFATA--PQ-PD
D2S8C7_GEOOG      AFFELAQRGLL-PEDWRLVGNGRGDVS-HEDFAGRV-------RDALTEFGPH--PD-QG
G6PD2_SCHPO       ALFALYVRKII-PEDFQIIGYARSKLS-QEAANKIV-------TAHIPIDDTVG-AS-QK
G6PD3_SCHPO       ALFHLFKRNLVDRSSFYVLGYARSKIP-IGEFRESI-------RESVKPDT----ES-KQ
G6PD4_ARATH       ALFALYYSGYL-PEDVAIFGVSRKNLT-DEDLRSII-------ASTLTCRVDHQENC-GG
G6PD_SCHPO        ALFSLFSEGRL-PKDIRIVGYARSKIE-HEDFLDRI-------TQNIKIDEEDS-QA-KE
G6PDC_TOBAC       ALFALYYEGCL-PEHFTIFGYARSKMT-DAELRNMV-------SKTLTCRIDKRENC-GE
G6PD2_ARATH       ALFALYYEGCL-PEHFTIFGYSRSKMT-DVELRNMV-------SKTLTCRIDKRANC-GE
G6PD3_ARATH       ALFALYYEGCL-PEHFTIFGYARSKMT-DAELRVMV-------SKTLTCRIDKRANC-GE
G6PD1_ARATH       ALFALFYEGCL-PQDFSVFGYARTKLT-HEELRDMI-------SSTLTCRIDQREKC-GD
G6PDC_SPIOL       ALFALFYENCL-PENFTVFGFSRTEMN-DEELRTMI-------SKTLTCRIDQRENC-GE
G6PDC_SOLTU       ALFALFYEDCL-PENFVVFGYSRTKLS-DEELRNMI-------STTLTCRIDKRENC-DA
G6PD_ASPNG        ALFGLYRNKFL-PKGIKIVGYARTNMD-HEEYLRRV-------RSYIKTPT----KEIEE
G6PD_EMENI        ALFGLFRNKFL-PKGIKIVGYARTQMD-HNEYLKRV-------RSYIKTPT----KEIEE
G6PD_CYBJA        ALFGLFREKQL-PSTVQIIGYARSHLS-DKDFKDYI-------SSHFKGGD-------DK
G6PD_KLULA        ALFGLYREGYL-NPTTKIIGYARSKLS-NEDLREKV-------KPFLKKPN--GAKD-DA
G6PD_YEAST        ALFGLFREGYL-DPSTKIFGYARSKLSMEEDLKSRV-------LPHLKKPH--GEAD-DS
G6PD_DICDI        ALFGLYLRDLL-PSNTIIYGYARSHIE-IGDFKARI-------SKGLK-------GD-EE
G6PD_MEDSA        ALFHLYKQELLPPDEVHIFGYARSKIS-DDELRNKL-------RSYLVPEKGASPKQ-LD
G6PD_SOLTU        ALFNLYRQGFLQSNEVHIFGYARTKIS-DDDLRSRI-------RGYLSQGK----EN-EG
G6PD5_ARATH       ALFNLFHQGFLNPDEVHIFGYARSKIT-DEELRDKI-------RGYLVDEKNAS-KK-TE
G6PD6_ARATH       ALFNLYRQGFLNPDEVHIFGYARTKIS-DEELRDRI-------RGYLVDEKNA--EQ-AE
G6PD_CAEEL        TLWWLFRDNLL-PVNIKFIGYARSDLT-VFKLRESF-------EKNCKVRE----NE-KC
G6PD_CERCA        TLWWLYRDNLL-PKSTKFCGYARSKLT-IEELRAKC-------HQYMKVQP----DE-QA
G6PD_DROME        TLWWLYRDDLL-PKPTKFCGYARSMLT-VDSIKEQC-------LPYMKVQP----HE-QK
G6PD_TAKRU        TLWWLFRDGLL-PEQTYFVGFARSALT-VDAIRTSC-------MPYLKVTE----TE-SD
G6PD2_MOUSE       TIWWLFRDGLL-PKETFIVGYARSQLT-VDDIQKQS-------EPFFKATP----EE-RP
G6PD_MACRO        TIWWLFRDGLL-PEDTFIVGYARSNLT-VDDIRKQS-------EPYFKATP----EE-NL
G6PD_HUMAN        TIWWLFRDGLL-PENTFIVGYARSRLT-VADIRKQS-------EPFFKATP----EE-KL
G6PD_RAT          TIWWLFRDGLL-PEDTFIVGYARSRLT-VDDIRKQS-------EPFFKVTP----EE-RP
G6PD_CRIGR        TIWWLFRDGLL-PEDTFIVGYARSRLT-VDDIRKQS-------EPFFKATP----EE-RP
G6PD1_MOUSE       TIWWLFRDGLL-PEDTFIVGYARSRLT-VDDIRKQS-------EPFFKATP----EE-RP
O66787_AQUAE      AILKLKDKIDL--KKIYILGRNRKKFE-EIK----------------------------E
G6PD1_MYCTU       ALYRLERHQLL---DCPILGVASDDMS-VGQLVKWA-------RESIGRTE---KID-DA
G6PD1_MYCBO       ALYRLERHQLL---DCPILGVASDDMS-VGQLVKWA-------RESIGRTE---KID-DA
E8PQ82_THESS      ALVRLQGQGQL--PPLRIWGFGAESWD-TGELLAHL-------EAALREKP---GLD-LS
G6PD_BORBU        SLFNLFKNKCI--SNFRVIGFSRKIFT-DKEFRLYI-------KDSLWQ------EETDS
G6PD2_MYCTU       AVYDLANRGLL-PPTFSLVGFARRDWS-TQDFGQVV-------YNAVQEHC-RTPFR-QQ
G6PD2_MYCBO       AVYDLANRGLL-PPTFSLVGFARRDWS-TQDFGQVV-------YNAVQEHC-RTPFR-QQ
G6PD_PSEAE        ALYQLDRENLL-HRDTRVLALARDEGA-PAEHLATL-------EQRLRLAVPAKEWD-DV
G6PD_DICD3        SLYQLEKAGHI-HPETRIIGVGRAEWD-RDAYIKVV-------REALETFL-KEPLD-PA
G6PD_ECOLI        SLYQLEKAGQL-NPDTRIIGVGRADWD-KAAYTKVV-------REALETFM-KETID-EG
G6PD_ECOL6        SLYQLEKAGQL-NPDTRIIGVGRADWD-KAAYTKVV-------REALETFM-KETID-EG
G6PD_ECO57        SLYQLEKAGQL-NPDTRIIGVGRADWD-KAAYTKVV-------REALETFM-KETID-EG
G6PD_BUCBP        SLYQLEKKNKL-CTHTRIIGVGRANWD-KIIYTNVV-------YKSLIKFL-NETII-ES
G6PD_BUCAI        ALYKLEKSKKI-HKYTRIIASGRADWS-TEDYIEKI-------KTEVKNFL-NEEIN-DL
G6PD_BUCAP        ALYKLEKSQKI-HPDTRIIGTGRADWN-TEDYIKIV-------KKAIKMFL-NEKID-EK
G6PD_ZYMMO        SLYGLDADGLL-ADDLRIVCTSRSEYD-TDGFRDFA-------EKALDRFVASDRLN-DD
G6PD_MYCS2        ALYLRDRDGQL-AGATRIIGVAKAGLD-DAGYRNTV-------RAGLARHVEPDLLD-SD
G6PD_RHIME        ALYHRQMEGQF-TEPTRIIGASRASLS-HDEYRRFA-------SDALKEHLKSGEFN-EA
G6PD_TREPA        SLWDLFEQELL-PRTFGILGAGRTALS-TESFRARL-------AEAVTKHAVRTPHD-PA
G6PD_AGGAC        ALYNLYKIDRL-GEDFSVLGVARTELN-DKSFREKM-------RQTLIKNEGAKGEC---
G6PD_HAEIN        ALYNLYKIGRL-SENFSVLGVARSDLN-DETFREKM-------REALIHNE----ETTPE
G6PD_THEMA        ALNRLFEAGIL-PERFFVLGAARTKMD-DKKFRSRF-------DAN--------------
G6PD_SYNE7        AIYEMHLERRL-PPELTIVGVARRDWS-DDYFREHL-------RQGVEQFGGGIQAE--E
G6PD_SYNY3        AIYQMKRERRL-PPELTVVGFARRDWS-HDHFREQM-------RKGIEEFSTGIGSE--D
G6PD_NOSS1        ALYKLRRERRI-PPETTIVGVARREWS-HEYFREQM-------QKGMEEAH--SSVELGE
G6PD_NOSP7        ALYKLRRERRI-PPETTIVGVARREWS-HEYFREQM-------QKGMEEAH--PDVDLGE
G6PD_CHLMU        ALYNLTKEGRL-SENFVCVGFARRPKS-HEQFREEM-------RQAIQNFSHSSEID-IR
G6PD_CHLPN        ALYHLTKEGRL-SDQFVCVGFARREKS-NELFRQEM-------KQAVIQFS-PSELD-IK
G6PD_LEUME        SVFNLYKKGYL-QKHFAIVGTARQALN-DDEFKQLV-------RDSIKDFT----DD-QA
G6PD_STRPN        SLFRLYQSGNL-SKHFAVIGTARRPWS-KEYFESVV-------VESILDLA----DS-TE
G6PD_BACSU        SIHRLYQNGQI-GEEFAVVGVGRRPWS-NEDLRQTV-------KTSISSSA-------DK
                   .                                                          

G6PD_ENCCU        YSPEFLSKVTYIPGPYDDLSKLKEVS---------------DSETVL--YFSVPSSVYTC
A0JXU9_ARTS2      ELKRIAGSTAYHQLDVTAGGELASLLSGL------------EAPVAV--YFALPPHVSQK
F0M529_PSEPM      ALQSLEKETVYHQLDVTADGALAALLAAL------------DGPTAV--YFALPPRISQL
G6PD_HELPY        KGREFLAHISYLCVRLDNPKDFEELSKIA----------TKNKPLIF--YFSISPSFFAT
G6PD_HELPJ        KGEEFLTHISYLRVRLDNPKDFEELSKIA----------TNNKPLIF--YFSISPSFFAT
A1UN45_MYCSK      EWEGFACRISYVP----QSAGPEALADAV---KAAKAELGPDTRRLH--YLSVPPKAAKA
A6W799_KINRD      PWDEFAANLLFAGGGFTEADS-GELPGVL---AQAREALGGEAELVH--YLAIPPGAFLD
C8X971_NAKMY      EWARFSSRVRFAGGGFTVDDPGELVDAVA----RARQDLGENAQLIN--YLAVPPVAFQG
D2S8C7_GEOOG      LWEGFAARLRFAGGGFEESDPGSLLDVLG----EVREELGGDPQLVH--YLAVPPSAFDK
G6PD2_SCHPO       ALNTFVEHYKYVPGTYDKPESFEMLNSII---AEKETAPASECTRIF--YLVLPPHLFAP
G6PD3_SCHPO       VFQDFIDRVSYFSGQYDQSSSYVEFRKHLE--SVEKKADSSKALRIF--YIALPPSVYVT
G6PD4_ARATH       KMDAFQSRTYYINGGYNNRDGMSRLAERM-----KQIEGESEANRIF--YLSVPQEALVD
G6PD_SCHPO        KLEEFKKRCSYYRGSYDKPEDFEGLNSHL----CEREGDRSTHNRIF--YLALPPDVFVS
G6PDC_TOBAC       KMEQFLERCFYHSGQYDSLENFAELDKKL-----KEHEAGRFSNRLF--YLSIPPNIFIN
G6PD2_ARATH       KMEEFLKRCFYHSGQYDSQEHFTELDKKL-----KEHEAGRISNRLF--YLSIPPNIFVD
G6PD3_ARATH       KMEEFLKRCFYHSGQYDSQEHFVALDEKL-----KEHEGGRLSNRLF--YLSIPPNIFVD
G6PD1_ARATH       KMEQFLKRCFYHSGQYNSEEDFAELNKKL-----KEKEAGKISNRLY--YLSIPPNIFVD
G6PDC_SPIOL       KMDHFLQRCFYHSGQYNSEDDFSGLDCKL-----KEKEAGRLQNRLF--YLSIPPNIFVD
G6PDC_SOLTU       KMEHFLERCFYHSGQYNSEDDFAELDYKL-----KEKEGCRVSNRLF--YLSIPPNIFVD
G6PD_ASPNG        QLDSFCQFCTYISGQYDKDDSFINLNKHL----EEIEKGQKEQNRIY--YMALPPSVFTT
G6PD_EMENI        QLNSFCELCTYISGQYDQDDSFKNLAKHL----EEIEKNQKEQNRVF--YMALPPSVFIT
G6PD_CYBJA        TKEDFLNLCSYISDPYDTDEGYKKLEARCQ--EYESKHNVKVPERLF--YLALPPSVFHT
G6PD_KLULA        KVNEFLSMVSYHAGPYDSDEGYLELKKIIE--EFEAEKKVDEPHRLF--YLALPPSIFID
G6PD_YEAST        KVEQFFKMVSYISGNYDTDEGFDELRTQIE--KFEKSANVDVPHRLF--YLALPPSVFLT
G6PD_DICDI        KKKQFLNLLHYHSGKYDEKASYDEFEKLILA-EEKKQQGVDKFNRLF--YMAIPPSIFIE
G6PD_MEDSA        DVSKFLQLVKYVSGPYDSEDGFRLLDKEISEHEYLKNSKEGSSRRLF--YLALPPSVYPS
G6PD_SOLTU        EVSEFLQLIKYVSGSYDSAEGFTSLDKAISEHEFSKNSTEGSSRRLF--YFALPPSVYPS
G6PD5_ARATH       ALSKFLKLIKYVSGPYDSEEGFKRLDKAILEHEISKKTAEGSSRRLF--YLALPPSVYPP
G6PD6_ARATH       ALSKFLQLIKYVSGPYDAEEGFQRLDKAISEHEISKNSTEGSSRRLF--YLALPPSVYPS
G6PD_CAEEL        AFDDFIKKCSYVQGQYDTSEGFQRLQSSID--DFQKESNNQAVNRLY--YLALPPSVFNV
G6PD_CERCA        KYEEFWQNHDYAAGSYDQRSDFVALKERL----SSLESCNCSCNRIF--YLALPPSVFER
G6PD_DROME        KYEEFWALNEYVSGRYDGRTGFELLNQQL-----EIMENKNKANRIF--YLALPPSVFEE
G6PD_TAKRU        RLSAFFSRNSYISGNYTAGGSFSELNAHI-----MSLPGASDANRLF--YLALPPTIYHS
G6PD2_MOUSE       KLEEFFTRNSYVVGQYDDPASYKHLNSYI-----NALHQGMQANHLF--YLALPPTVYEA
G6PD_MACRO        KLEEFFSRNSYVAGQYDEPASFQRLNAHM-----NSLHHGSQANRLF--YLALPPTVYEA
G6PD_HUMAN        KLEDFFARNSYVAGQYDDAASYQRLNSHM-----NALHLGSQANRLF--YLALPPTVYEA
G6PD_RAT          KLEEFFARNSYVAGQYDDPASYKHLNSHM-----NALHQGMQANRLF--YLALPPTVYEA
G6PD_CRIGR        KLEEFFARNSYVAGQYDDPASYKHLNSHM-----NALHQGMQANRLF--YLALPPTVYEA
G6PD1_MOUSE       KLEEFFARNSYVAGQYDDAASYKHLNSHM-----NALHQGMQANRLF--YLALPPTVYEA
O66787_AQUAE      KFKDFSELFVFVEFLAEREESYKNISSIL----------GKESLKVF--YLAVPPDLFKE
G6PD1_MYCTU       VFDRLAGRLSYLHGDVTDSQLYDSLAELI----------GSACRPLY--YLEMPPALFAP
G6PD1_MYCBO       VFDRLAGRLSYLHGDVTDSQLYDSLAELI----------GSACRPLY--YLEMPPALFAP
E8PQ82_THESS      AWQRLKGSIRYRNAEIS-PEGLSPLRHL-------------EGPALF--YLALPPSLFPK
G6PD_BORBU        LIEIFLNFFVYVFGDFNEKESYKNLFKFL----------DRSRETIY--YLSTSPAFYGP
G6PD2_MYCTU       NWDRLAEGFRFVPGTFDDDDAFAQLAETL---EKLDAERGTGGNHAF--YLAIPPKSFPV
G6PD2_MYCBO       NWDRLAEGFRFVPGTFDDDDAFAQLAETL---EKLDAERGTGGNHAF--YLAIPPKSFPV
G6PD_PSEAE        VWQRFRERLDYLSMDFLDPQAYVGLREAV----------DDELPLVA--YFATPASVFGG
G6PD_DICD3        LWTTLSNRLDFCNLDVEDTEGFKRLGTML-----------DQQNRTTINYFAMPPSTFGA
G6PD_ECOLI        LWDTLSARLDFCNLDVNDTAAFSRLGAML-----------DQKNRITINYFAMPPSTFGA
G6PD_ECOL6        LWDTLSARLDFCNLDVNDTAAFSRLGAML-----------DQKNRITINYFAMPPSTFGA
G6PD_ECO57        LWDTLSARLDFCNLDVNDTAAFSRLGAML-----------DQKNRITINYFAMPPSTFGA
G6PD_BUCBP        IWKKFSSRLEFCNLDINCLHNFKKLKQII-----------QQNNNIIINYLAMPPHTFGN
G6PD_BUCAI        IWKNLSSRIFFCNIDVHEPLHFFRLKTIL---------KQKKNIIVY--YCAVPSNTLNS
G6PD_BUCAP        IWKKLRSRLNFFYIDVFQDLHFLELKNIL---------NQKKNIIIY--YCAVPSNTFNA
G6PD_ZYMMO        AKAKFLNKLFYATVDITDPTQFGKLADLC---------GPVEKGIAI--YLSTAPSLFEG
G6PD_MYCS2        VVDRFLSRLRFVSVDLTEPSDYAAVGDVL----TSPDGGSGHDIRVF--YLACAPALFGP
G6PD_RHIME        EVEKFTSRLYYVSVDAKSEQGWDDLKKLL--------EEGKDRTRAF--YLAVGPAIFSD
G6PD_TREPA        RLTEFLQKIHYFSFDPTDSVAFADFATYV---RTLDQSLHTEGNFIF--YLATPPSLYET
G6PD_AGGAC        -LEQFCSHLYYQAVNTADKADYAKLVPRL---DELHDTYRTEGNTLY--YLSTPPSLYGV
G6PD_HAEIN        TLDAFCSHLYYQAVNTSDAQDYGKLVPRL---DDLHDKYQTCGNTFY--YMSTPPSLYGV
G6PD_THEMA        --PDFLEHCSYISVDYQDPESFKQLKNTI----ETLIKRIDSSNLVF--YLAVPPDLYIP
G6PD_SYNE7        VWNTFAQGLFFAPGNIDDPQFYQTLRDRL---ANLDELRGTRGNRTF--YLSVAPRFFGE
G6PD_SYNY3        LWNEFAQGLFYCSGNMDDPESYLKLKNFL---GELDEKRNTRGNRVF--YLAVSPNFFPP
G6PD_NOSS1        LWQDFSQGLFYCPGDIDNPESYQKLKNLL---SELDEKRGTRGNRMF--YLSVAPNFFPE
G6PD_NOSP7        LWQDFSQGLFYSPGDIDNPESYQKLKTLL---SELDEKRGTRGNRMF--YLSVAPSFFPE
G6PD_CHLMU        VWESLEHRIFYHQANFSEAEGYSSLRSFL---ESVDQKYGTKGNRLF--YLSTPPDYFQE
G6PD_CHLPN        VWEDFQQRLFYHRSEFDNNMGYTSLKDSL---EDLDKTYGTRGNRLF--YLSTPPQYFSR
G6PD_LEUME        QAEAFIEHFSYRAHDVTDAASYAVLKEAI---EEAADKFDIDGNRIF--YMSVAPRFFGT
G6PD_STRPN        QAQEFASHFYYQSHDVNDSEHYIALRQLQ---AELNEKYQAEHNKLF--FLSMAPQFFGT
G6PD_BACSU        HIDDFTSHFYYHPFDVTNPGSYQELNVLL---NQLEDTYQIPNNRMF--YLAMAPEFFGT
                      :     :             .                        :          

G6PD_ENCCU        LFREISKL---------D--YKVIGVEKPYGDSIESFMEIKG-----FDLGKTRFIDHYL
A0JXU9_ARTS2      ACEVLAPEEVPA-----G---TRLVMEKPFGSSEDSARHLNRTLAALVPEDHIHRVDHFL
F0M529_PSEPM      ACEVLQPEQVPA-----G---TRLVMEKPFGSSEESARSLNQTLVRLVPEDHIHRVDHFL
G6PD_HELPY        TAQHLAKNALNHAN-------TRLILEKPLGHDLKTCKEIFQSISVFFKEEQIFRIDHYL
G6PD_HELPJ        TAQNLAQNALNHAN-------TRLILEKPLGHDLKTCKEIFQSISAFFKEEQIFRIDHYL
A1UN45_MYCSK      VITMLKESGLVD--------RSRVVMEKPFGTDLASACELNAFVHDTFDESQIFRIDHFL
A6W799_KINRD      TTKGFEAHGLVE-----G---SRVVYEKPYGTSLASFEELDAEVQRVFDESQVFRIDHFL
C8X971_NAKMY      FTAAIGAHGLAK-----G---CRAVYEKPFGSSPSDFRTLNAAVHEVLDESQVYRIDHFL
D2S8C7_GEOOG      LTRALPQHGLTE-----G---ARVVYEKPYGTSPESFRELDELVLSVLDEEQVFRIDHFL
G6PD2_SCHPO       VSELIKSKAHPN-G---M--VTRLIVEKPIGFDYKSADAILSDLSKHWSAKDTFKVDHFL
G6PD3_SCHPO       VSSHIYENLYL--P---G--KSRLVIEKPFGKNYQSAVKLKEEVHKHWKEEEIYRIDHYT
G6PD4_ARATH       VACTIGDNAQAP-R---G--WTRIIVEKPFGFNSHSSHQLTKSLLSKFEEKQIYRIDHML
G6PD_SCHPO        VATNLKKKCVPE-K---G--IARLVIEKPFGVDLKSAQELQSQLAPLFDEKEIYRIDHYL
G6PDC_TOBAC       AVRCASLSASSA-H---G--WTRVIVEKPFGRDSESSAALTRSLKQYLNEDQIFRIDHYL
G6PD2_ARATH       AVKCASTSASSV-N---G--WTRVIVEKPFGRDSETSAALTKSLKQYLEEDQIFRIDHYL
G6PD3_ARATH       AVKCASSSASSV-N---G--WTRVIVEKPFGRDSKTSAALTKSLKQYLEEDQIFRIDHYL
G6PD1_ARATH       VVRCASLRASSE-N---G--WTRVIVEKPFGRDSESSGELTRCLKQYLTEEQIFRIDHYL
G6PDC_SPIOL       VVRCVSHRASSA-S---G--WTRVIVEKPFGRDSDSSRELTRSFKQYLSEDQIFRIDHYL
G6PDC_SOLTU       VVRCASLKASST-S---G--WTRVIVEKPFGRDLESSSELTRSLKKYLTEEQIFRIDHYL
G6PD_ASPNG        VSDQLKRNCYPK-N---G--VARIIVEKPFGKDLQSSRDLQKALEPNWKEEEIFRIDHYL
G6PD_EMENI        VSEQLKRNCYPK-N---G--VARIIVEKPFGKDLQSSRDLQKALEPNWKEEEIFRIDHYL
G6PD_CYBJA        VCEQVKKNVYPK-N---E--KSRIIIEKPFGRDLETYRELQKQISPLFTEDEVYRIDHYL
G6PD_KLULA        VCSKLKENLYTE-S---G--IQRVIVEKPFGHDLQSATELQEKLAPLFSEDELFRIDHYL
G6PD_YEAST        VAKQIKSRVYAE-N---G--ITRVIVEKPFGHDLASARELQKNLGPLFKEEELYRIDHYL
G6PD_DICDI        VSIGIHGSLISK-N---G--WSRVIVEKPFGRDLASSRELVSELGKLFKEKDLFRIDHYL
G6PD_MEDSA        VCKMIKTCCMNKSDLG-G--WTRVVVEKPFGRDLESAEELSTQIGELFEEPQIYRIDHYL
G6PD_SOLTU        VCRMIKSYCMNKSDLG-G--WTRTVVEKPFGKDLASSEQLSSQIGELFDEPQIYRIDHYL
G6PD5_ARATH       VSKMIKAWCTNKSDLG-G--WTRIVVEKPFGKDLESAEQLSSQIGALFEEPQIYRIDHYL
G6PD6_ARATH       VCKMIKTCCMNKSDLG-G--WTRIVVEKPFGKDLESAEQLSSQIGELFDESQIYRIDHYL
G6PD_CAEEL        VSTELKKNCMDHGD---S--WTRVIIEKPFGHDLKSSCELSTHLAKLFKEDQIYRIDHYL
G6PD_CERCA        VTVNIKDICLAE-R---G--WNRVIIEKPFGRDDVTSKKLSDHLASLFHEDQLYRIDHYL
G6PD_DROME        VTVNIKQICMSV-C---G--WNRVIIEKPFGRDDASSQALSDHLAGLFQEDQLYRIDHYL
G6PD_TAKRU        VTENIKHFCMSA-K---G--WNRVIVEKPFGHDLQSSEELSTHLSSLFTEDQIYRIDHYL
G6PD2_MOUSE       VTKNIQETCMSQ-T---G--FNRIIVEKPFGRDLQSSNQLSNHISSLFREDQIYRIDHYL
G6PD_MACRO        VTKNIKETCMSQ-I---G--WNRVIVEKPFGKDLQSSDKLSNHISSLFHEDQIYRIDHYL
G6PD_HUMAN        VTKNIHESCMSQ-I---G--WNRIIVEKPFGRDLQSSDRLSNHISSLFREDQIYRIDHYL
G6PD_RAT          VTKNIQEICMSQ-T---G--WNRIIVEKPFGRDLQSSNQLSNHISSLFREDQIYRIDHYL
G6PD_CRIGR        VTKNIQETCMSQ-T---G--WNRIIVEKPFGRDLQSSNQLSNHISSLFREDQIYRIDHYL
G6PD1_MOUSE       VTKNIQETCMSQ-T---G--WNRIIVEKPFGRDLQSSNQLSNHISSLFREDQIYRIDHYL
O66787_AQUAE      ILENVGKYLNF------P--EKRIVIEKPFGLSLKHAKDLNKIISVYFKEEEIFRIDHYL
G6PD1_MYCTU       IVENLANVRLLE--------RARVAVEKPFGHDLASALELNARLRAVLGEDQILRVDHFL
G6PD1_MYCBO       IVENLANVRLLE--------RARVAVEKPFGHDLASALELNARLRAVLGEDQILRVDHFL
E8PQ82_THESS      AVLALGELNLAQEN--TG--WRRIAVEKPFGYDLASAQALNRLLQRYFREDQILRVDHFL
G6PD_BORBU        IINHLKKYFLSEKL---T--LSKIVLEKPFGSSLETAKKLNSLLYSAFKEDQIYRIDHYL
G6PD2_MYCTU       VCEQLHKSGLARPQ---GDRWSRVVIEKPFGHDLASARELNKAVNAVFPEEAVFRIDHYL
G6PD2_MYCBO       VCEQLHKSGLARPQ---GDRWSRVVIEKPFGHDLASARELNKAVNAVFPEEAVFRIDHYL
G6PD_PSEAE        ICENLAAAGLAE--------RTRVVLEKPIGHDLESSREVNEAVARFFPESRIYRIDHYL
G6PD_DICD3        ICRGLGQAGLNKEP-------ARVVMEKPLGTNLASSRVINNQVAEFFNECQVYRIDHYL
G6PD_ECOLI        ICKGLGEAKLNAKP-------ARVVMEKPLGTSLATSQEINDQVGEYFEECQVYRIDHYL
G6PD_ECOL6        ICKGLGEAKLNAKP-------ARVVMEKPLGTSLATSQEINDQVGEYFEECQVYRIDHYL
G6PD_ECO57        ICKGLGEAKLNAKP-------ARVVMEKPLGTSLATSQEINDQVGEYFEECQVYRIDHYL
G6PD_BUCBP        ICLGLESINLNLEP-------TRIIIEKPLGSSLKTSININNKIGKFFKEKQIFRIDHYL
G6PD_BUCAI        IFIGLGNAHLNSVP-------SRIVLEKPLGVCLKTSKKINDQISKYFLESQIFRIDHYL
G6PD_BUCAP        IFTGLGKVNLNSFP-------SRIIIEKPLGVSLETSKKINNQIAKYFLESQIFRIDHYL
G6PD_ZYMMO        AIAGLKQAGLAGPT-------SRLALEKPLGQDLASSDHINDAVLKVFSEKQVYRIDHYL
G6PD_MYCS2        ICGALGAQGLVTES-------SRVVLEKPIGRDLASAQQINEAVGAVFAEHQIFRIDHYL
G6PD_RHIME        ISEKIRDHKLITRN-------TRIVVEKPIGRDLASATELNDTIGKVFREEQIFRIDHYL
G6PD_TREPA        IPTQLAMHHLNREQ---GN-FRRVVIEKPFGYNLETAQHLNASLRAHFQENQTYRIDHYL
G6PD_AGGAC        IPECLGEHGLNKED--RG--WKRLIVEKPFGYDRETAEALDIQIHRFFEEHQIYRIDHYL
G6PD_HAEIN        IPECLAAHGLNTEE--YG--WKRIIVEKPFGYDEKTAQTLDVQIHRFFEEHQIYRIDHYL
G6PD_THEMA        ILENLSKTGLNEKP-------ARVVIEKPFGKDLESARRLEDTLQKYFQEDQIFRIDHYL
G6PD_SYNE7        AAKQLGAAGMLADP---A--KTRLVVEKPFGRDLSSAQVLNAILQNVCRESQIYRIDHYL
G6PD_SYNY3        GIKQLGAAGMLSDP---V--KSRIVIEKPFGRDLSSAQSLNRVVQSVCKENQVYRIDHYL
G6PD_NOSS1        AIKQLGGAGMLDDP---Y--KHRLVIEKPFGRDLASAQSLNAVVQKYCKEHQVYRIDHYL
G6PD_NOSP7        AIKQLGSGGMLEDP---Y--KHRLVIEKPFGRDLASAQSLNQVVQKYCKEHQVYRIDHYL
G6PD_CHLMU        IIRNLNRHQLFYHEQGAQQPWSRLIIEKPFGVDLQTAQELQQCIDANINEESVYRIDHYL
G6PD_CHLPN        IIENLNKHKLFYKNQDQGKPWSRVIIEKPFGRDLDSAKQLQQCINENLNENSVYHIDHYL
G6PD_LEUME        IAKYLKSEGLLADT---G--YNRLMIEKPFGTSYDTAAELQNDLENAFDDNQLFRIDHYL
G6PD_STRPN        IAKHLKSENIVDGK---G--FERLIVEKPFGTDYATASKLNDELLATFDEEQIFRIDHYL
G6PD_BACSU        IAKTLKSEGVTATT---G--WSRLVIEKPFGHDLPSAQALNKEIREAFTEDQIYRIDHYL
                                            *** *        :               :**  

G6PD_ENCCU        LKPLVVAMPGIIRET-GAIREVMSNRYVKSVEIVSKEVLGGEGR-HYFDKNGIIRDMVLS
A0JXU9_ARTS2      GKATVLNILGLRFAN-TFLEPIWNRDYIEKVEVIFDEDLALEGRARYYDAAGALRDMIQS
F0M529_PSEPM      GKATVLNILGLRFAN-NFLEPVWDRHHVEKVEIIFDEDLALEGRARYYDNAGALRDMIQS
G6PD_HELPY        GKKGVQNILELRLNN-PILNILWDQ--ISAVEICVYETLGVEERGEFYDKIGALRDMVQN
G6PD_HELPJ        GKKGVQNILELRLNN-PILNILWDQ--ISAVEICVYETLGVEERGEFYDKIGALRDMVQN
A1UN45_MYCSK      GKEAAQNILAFRFAN-GLFEPIWNRNFIDHIQIDIPEKLGLDERADFYESTGAYKDMVVT
A6W799_KINRD      AFEAQQDVMHARFAN-PWLASIWNREHVAQVQVDVAETLDVAQRASFYDATGAFLDMIVT
C8X971_NAKMY      GKEATQDLHVLRFAN-SLFAGAWNAEHIESVQIDAPENLDIDDRAGFYDATGAMLDMMIT
D2S8C7_GEOOG      GKEGTQDLHVLRFAN-ALFEHVWHRDHVAQVQIDVPEDLDVADRAEFYDATGAALDMLVT
G6PD2_SCHPO       GEDMIDGFTAIRFAN-SMFEPIWNREHIESVRVDFREDFGCEGRGGYFEGAGILRDVVQN
G6PD3_SCHPO       AKDMVNNFFTLRFANSSSIDAVLNRHSIQSVEIHMYETGGCEGRIGYYDANGVVRDVVQN
G6PD4_ARATH       GRNLIENLTVLRFSN-LVFEPLWNRTYIRNIQVIISESIAQTEK--FSDGYGIIRDIVHS
G6PD_SCHPO        GKEMVQNLVHLRFCN-PVISHLWDKNSISSVQITFKEPIGTEGRGGYFDSSTIVRDIVQN
G6PDC_TOBAC       GKELVENLSVLRFSN-LIFEPLWSRQCIRNVQFIFSEDFGTEGRGGYFDHYGIIRDIMQN
G6PD2_ARATH       GKELVENLSVLRFSN-LIFEPLWSRQYIRNVQFIFSEDFGTEGRGGYFDNYGIIRDIMQN
G6PD3_ARATH       GKELVENLSVLRFSN-LIFEPLWSRQYIRNVQFIFSEDFGTEGRGGYFDNYGIIRDIMQN
G6PD1_ARATH       GKELVENLSVLRFSN-LVFEPLWSRNYIRNVQLIFSEDFGTEGRGGYFDQYGIIRDIMQN
G6PDC_SPIOL       GKELVENLSVLRFSN-LVFEPLWSRNYIRNVQLIFSEDFGTEGRGGYFDNYGIIRDIMQN
G6PDC_SOLTU       GKELVENLSVLRFSN-LVFEPLWSRNYIRNVQFIFSEDFGTEGRGGYFDHYGIIRDIMQN
G6PD_ASPNG        GKEMVKNILIMRFGN-EFFNATWNRHHIDNVQITFKEPFGTEGRGGYFDEFGIIRDVMQN
G6PD_EMENI        GKEMVKNILIMRFGN-EFFNATWNRHHIDNVQITFKEPFGTEGRGGYFDEFGIIRDVMQN
G6PD_CYBJA        GKEMVKNLLVLRFGN-ELFSGIWNNKHITSVQISFKEAFGTEGRGGYFDNIGIIRDVMQN
G6PD_KLULA        GKEMVKNLLLMRFGN-TFLNAAWNKENIQSVQVVFKEPFGTEGRGGYFDSIGIIRDVMQN
G6PD_YEAST        GKELVKNLLVLRFGN-QFLNASWNRDNIQSVQISFKERFGTEGRGGYFDSIGIIRDVMQN
G6PD_DICDI        GKEMVQNLMVLRFAN-AVFEPLWSKSHISSITITFKEDIGTEGRGGYFDQFGIIRDVMQN
G6PD_MEDSA        GKELVQNMLVLRFAN-RFFLPLWNHNHIDNVQIVFREDFGTDGRGGYFDQYGIIRDIIPN
G6PD_SOLTU        GKELVQNLLVLRFAN-RFFLPLWNRDNIDNIQIVFREDFGTEGRGGYFDEYGIIRDIIQN
G6PD5_ARATH       GKELVQNMLVLRFAN-RLFLPLWNRDNIANVQIVFREDFGTEGRGGYFDEYGIIRDIIQN
G6PD6_ARATH       GKELVQNMLVLRFAN-RFFLPLWNRDNIENVQIVFREDFGTEGRGGYFDEYGIIRDIIQN
G6PD_CAEEL        GKEMVQNLMVMRFGN-RILAPSWNRDHIASVMISFKEDFGTGGRAGYFDTAGIIRDVMQN
G6PD_CERCA        GKEMVQNLMTIRFAN-KILNSTWNRENIASVLITFKEPFGTQGRGGYFDEFGIIRDVMQN
G6PD_DROME        GKEMVQNLMTIRFGN-KILSSTWNRENIASVLITFKEPFGTQGRGGYFDEFGIIRDVMQN
G6PD_TAKRU        GKEMVQNLMVLRFGN-RIFGPIWNRDNVACVVLTFKEPFGTQGRGGYFDDFGIIRDVMQN
G6PD2_MOUSE       DKEMVQNLMVLRFAN-RIFGPIWNGDNIVCVILTFKEPFGTEGRGGYFDEFGIIRDVMQS
G6PD_MACRO        GKEMVQNLMVLRFGN-RIFGPIWNRDNIACVIFTFKEPFGTLGRGGYFDEFGIIRDVMQN
G6PD_HUMAN        GKEMVQNLMVLRFAN-RIFGPIWNRDNIACVILTFKEPFGTEGRGGYFDEFGIIRDVMQN
G6PD_RAT          GKEMVQNLMVLRFAN-RIFGPIWNRDNIACVILTFKEPFGTEGRGGYFDEFGIIRDVMQN
G6PD_CRIGR        GKEMVQNLMVLRFAN-RIFGPIWNRDNIACVILTFKEPFGTEGRGGYFDEFGIIRDVMQN
G6PD1_MOUSE       GKEMVQNLMVLRFAN-RIFGPIWNRDNIACVILTFKEPFGTEGRGGYFDEFGIIRDVMQN
O66787_AQUAE      GKPQVQNILAFKFSN-YVFSEVLNKCLVEKVEVIALEEVGVEGRKAYYEKVGVIRDMLQN
G6PD1_MYCTU       GKQPVVELEYLRFAN-QALAELWDRNSISEIHITMAEDFGVEDRGKFYDAVGALRDVVQN
G6PD1_MYCBO       GKQPVVELEYLRFAN-QALAELWDRNSISEIHITMAEDFGVEDRGKFYDAVGALRDVVQN
E8PQ82_THESS      GKTSVTNLLELRYRN-PSLEALWERKGVAWVEITYAETLGLEGRARYYEQAGALRDMLQN
G6PD_BORBU        GKETVQNIFTFRFGN-SIFENIWNNRYVDFVQITVAEELGLDGRVEYYDSVGALKDMVQN
G6PD2_MYCTU       GKETVQNILALRFAN-QLFDPIWNAHYVDHVQITMAEDIGLGGRAGYYDGIGAARDVIQN
G6PD2_MYCBO       GKETVQNILALRFAN-QLFDPIWNAHYVDHVQITMAEDIGLGGRAGYYDGIGAARDVIQN
G6PD_PSEAE        GKETVQNLIALRFAN-SLFETQWNQNHISHVEITVAEKVGIEGRWGYFDQAGQLRDMVQN
G6PD_DICD3        GKETVLNLLALRFAN-SLFANNWDNRTIDHVQITVAEEVGIEGRWGYFDQAGQMRDMIQN
G6PD_ECOLI        GKETVLNLLALRFAN-SLFVNNWDNRTIDHVEITVAEEVGIEGRWGYFDKAGQMRDMIQN
G6PD_ECOL6        GKETVLNLLALRFAN-SLFVNNWDNRTIDHVEITVAEEVGIEGRWGYFDKAGQMRDMIQN
G6PD_ECO57        GKETVLNLLALRFAN-SLFVNNWDNRTIDHVEITVAEEVGIEGRWGYFDKAGQMRDMIQN
G6PD_BUCBP        GKETIQNLLAFRFSN-SLFYYNWNNKFIDHVQITVSETIGVEGRFNYFDTVGQIKDMVQN
G6PD_BUCAI        GKESILNLFALRFSN-TCLFYNWNNKTIDHIQITVSEEVGIEDRWNYFNMMGQMKDMVQN
G6PD_BUCAP        GKESILNLLALRFSN-SFFFHSWNNKIIDHIQITVSEEVGIENRWNYFDQMGQTRDMVQN
G6PD_ZYMMO        GKETVQNLLTLRFGN-ALFEPLWNSKGIDHVQISVAETVGLEGRIGYFDGSGSLRDMVQS
G6PD_MYCS2        GKESVQQLLVTRFGN-TWLEPLWNSSRIDHVQITAAESLGVGARGDYYDQSGALRDMLQN
G6PD_RHIME        GKETVQNLMALRFAN-ALYEPLWNSAHIDHVQITVSEAVGLENRAGYYDKAGALRDMVQN
G6PD_TREPA        GKETVQNILVTRFAN-PLFEPTWNRTHIDYVEITASESLGVENRGGYYDQSGALRDMIQN
G6PD_AGGAC        GKETVQNLLVLRFSN-GWFEPLWNRNFIDYIEITGAESIGVEERGGYYDGSGAMRDMFQN
G6PD_HAEIN        GKETVQNLLVLRFSN-GWFEPLWNRNFIDYVEITGAESIGVEERGGYYDGSGAMRDMFQN
G6PD_THEMA        GKETVQNILVFRFAN-FIFEEIWNNKFVDHVQITMAEDIGVEHRAGYFENVGLLRDIFQN
G6PD_SYNE7        GKETVQNLLVFRFAN-AIFEPLWNRQYIDHVQITVAETVGLEGRAGYYETAGALRDMVQN
G6PD_SYNY3        GKETVQNLMVFRFAN-AIFEPLWNRQFVDHVQITVAETVGVEERAGYYESAGALRDMVQN
G6PD_NOSS1        GKETVQNLLVFRFAN-AIFEPLWNRQFVDHVQITVAETVGVEDRAGYYEKAGALRDMLQN
G6PD_NOSP7        GKETVQNLLVFRFAN-AIFEPLWNRQFVDHVQITVAETVGVEDRAGYYESAGALRDMLQN
G6PD_CHLMU        GKETVQNILTIRFAN-TLFESCWNSQYIDHVQISVSESIGIGSRGNFFEKSGMLRDMVQN
G6PD_CHLPN        GKETVQNILTTRFAN-TIFESCWNSQYIDHVQISLSETIGIGSRGNFFEKSGMLRDMVQN
G6PD_LEUME        GKEMVQNIAALRFGN-PIFDAAWNKDYIKNVQVTLSEVLGVEERAGYYDTAGALLDMIQN
G6PD_STRPN        GKEMIQSIFAVRFAN-LIFENVWNKDFIDNVQITFAERLGVEERGGYYDQSGALRDMVQN
G6PD_BACSU        GKQMVQNIEVIRFAN-AIFEPLWTNRYISNIQITSSESLGVEDRARYYEKSGALRDMVQN
                         .      .            :  : .   *      .  : :      *:. .

G6PD_ENCCU        HMGELLGVVASDVTKPSRIMEALARMEVFKA----CTVDTERC----IYGQY--------
A0JXU9_ARTS2      HLLQIMALMAIE--PPASVDERDLRDAVATLLRASSVKAPYRS--STRRARYTAGSIDGR
F0M529_PSEPM      HLLQIMALMAIE--PPATIGERDLRDAISTVLRASSVPLPHSG--STRRARYTAGAVGGK
G6PD_HELPY        HLLQVLSLIATD--LPNNL--KDLRKEKIKVLKTLQP--PKDFKKQVIRAQY--------
G6PD_HELPJ        HLLQVLSLIATD--LPNDL--KDLRQEKIKVLKTLQP--PKDFTKQVIRAQY--------
A1UN45_MYCSK      HLFQVMAFVVME--PPTALEPRAISEEKNKVFRSMLPVDPAKV----IRGQY--------
A6W799_KINRD      HLFQMAATVAME--PPADLGPGALQAARDAALQDFRELDPAEV----VLGQF--------
C8X971_NAKMY      HLFQVAAEVAME--QPASMDADDLQSAREEVIGCFRPLDPAEV----VLGQY--------
D2S8C7_GEOOG      HLFQVAAEVAME--PPASFSPADLQAAREGVLAAFRPLDPDEV----VLGQF--------
G6PD2_SCHPO       HLLQLLTLLCIE--EPKSQDAEDIIKCKVDFLKSLHPVSKEDI----VYGQYTKSANGKV
G6PD3_SCHPO       HLTQIFCIAAMN--EPKSASASDVRAEKVNLLKATRPASLKES----MLGQYTTSEDGKI
G6PD4_ARATH       HILQTIALLAME--PPISLDGEDIRNEKVKVLRSIRKIDPRDV----ILGQYK-------
G6PD_SCHPO        HLVQILTLLTME--TPTTFSADDLRDEKVKVLRRTRLGDLKDI----VLGQYVKSKDGKK
G6PDC_TOBAC       HLLQILALFAME--TPVSLDAEDIRNEKVKVLRSMRPLQLDDV----IIGQYKCHTKGDV
G6PD2_ARATH       HLLQILALFAME--TPVSLDAEDIRNEKVKVLRSMRPIRVEDV----VIGQYKSHTKGGV
G6PD3_ARATH       HLLQILALFAME--TPVSLDAEDIRNEKVKVLRSMRPIKLEDV----VIGQYKSHSIGGV
G6PD1_ARATH       HLLQILALFAME--TPVSLDAEDIRSEKVKVLRSMKPLRLEDV----VVGQYKGHNKGGK
G6PDC_SPIOL       HLLQILALFAME--TPVSLDAEDIRNEKVKVLRSMKPLKLQDV----VVGQYKGHSKGNK
G6PDC_SOLTU       HLLQILALFAME--TPVSLDAEDIRNEKVKVLRSMRPLQLEDV----VLGQYKGHSNGAK
G6PD_ASPNG        HLLQVLTLLAME--RPISFSAEDIRDEKVRVLRAMDAIEPKNV----IIGQYGKSLDGSK
G6PD_EMENI        HLLQVLTLLAME--RPISFSAEDIRDEKVRVLRAMDPIQPKDV----IIGQYGRSLDGSK
G6PD_CYBJA        HLLQVLTLLTME--RPVSFDPEAVRDEKVKVLKAFDKIDVNDV----LLGQYGKSEDGTK
G6PD_KLULA        HLLQVLTLLTME--RPVSFDPESVRDEKVKVLKAFSPIDHDDI----LIGQYGRSVDGSK
G6PD_YEAST        HLLQIMTLLTME--RPVSFDPESIRDEKVKVLKAVAPIDTDDV----LLGQYGKSEDGSK
G6PD_DICDI        HLLQVLSLVAME--PPVSLNADDITNEKVKLLRCIQPIKMSEV----VLGQYTSDPEGKI
G6PD_MEDSA        HLLQVLCLIAME--KPVSLKPEHIRDEKVKVLESVLPIRDDEV----VLGQY--------
G6PD_SOLTU        HLLQVLCLVAME--KPVSQKPEHIRDEKVKVLQSMLPIEDEEV----VLGQY--------
G6PD5_ARATH       HLLQVLCLVAME--KPISLKPEHIRDEKVKVLQSVIPIKDEEV----VLGQY--------
G6PD6_ARATH       HLLQVLCLVAME--KPISLKPEHIRDEKVKVLQSVVPISDDEV----VLGQY--------
G6PD_CAEEL        HLMQILTLVAME--KPASLNAEDIRDEKVKVLKAAKVVELKDV----VVGQYIASPEFDH
G6PD_CERCA        HLLQILSLVAME--KPTSCQPDDIRDEKVKVLKSIPALTLDDM----VLGQYVGNPNGVG
G6PD_DROME        HLLQILSLVAME--KPVSCHPDDIRDEKVKVLKSIEALTLDDM----VLGQYLGNPQGTN
G6PD_TAKRU        HMLQMLCLVAME--KPASTNSDDVRDEKVKVLKCIVPASMSDV----VLGQYVGDPEGEG
G6PD2_MOUSE       HLLQMLCLVAME--KPATTDSDDVRNEKVKVLKCISEVETDNV----ILGQYVGNPNGEG
G6PD_MACRO        HLLQMLCLVAME--KPASTNSDDVRDEKVKVLKCISEVRATDV----VLGQYVGNPDGEG
G6PD_HUMAN        HLLQMLCLVAME--KPASTNSDDVRDEKVKVLKCISEVQANNV----VLGQYVGNPDGEG
G6PD_RAT          HLLQMLCLVAME--KPASTDSDDVRDEKVKVLKCISEVETDNV----VLGQYVGNPSGEG
G6PD_CRIGR        HLLQMLCLVAME--KPASTDSDDVRDEKVKVLKCISEVETSNV----VLGQYVGNPNGEG
G6PD1_MOUSE       HLLQMLCLVAME--KPATTGSDDVRDEKVKVLKCISEVETDNV----VLGQYVGNPNGEG
O66787_AQUAE      HMLLLSSLIVMR--LPPR--AEDFHFELKNALKR-AEFESESL----ILGKY--------
G6PD1_MYCTU       HLLQVLALVTME--PPVGSSADDLNDKKAEVFRAMAPLDPDRC----VRGQY--------
G6PD1_MYCBO       HLLQVLALVTME--PPVGSSADDLNDKKAEVFRAMAPLDPDRC----VRGQY--------
E8PQ82_THESS      HLLQLLALVVME--PPSRLEAASIRAQRAEALRSVQTAEPRLA----VRGQY--------
G6PD_BORBU        HILQLLSLVAME--SPIKFDSEFIHDEKVKVLKSLRKISKEDIKNYIVKGQYIGSQVQGV
G6PD2_MYCTU       HLMQLLALTAME--EPVSFHPAALQAEKIKVLSATRLAEPLDQ--TTSRGQYAAGWQGGE
G6PD2_MYCBO       HLMQLLALTAME--EPVSFHPAALQAEKIKVLSATRLAEPLDQ--TTSRGQYAAGWQGGE
G6PD_PSEAE        HLLQLLCLIAMD--PPSDLSADSIRDEKVKVLRALEPIPAEQLASRVVRGQYTAGFSDGK
G6PD_DICD3        HLLQILTMIAMS--PPADLSTDRIRDEKVKVLRSLRRIDRSNVHEVTVRGQYTSGFVQGK
G6PD_ECOLI        HLLQILCMIAMS--PPSDLSADSIRDEKVKVLKSLRRIDRSNVREKTVRGQYTAGFAQGK
G6PD_ECOL6        HLLQILCMIAMS--PPSDLSADSIRDEKVKVLKSLRRIDRSNVREKTVRGQYTAGFAQGK
G6PD_ECO57        HLLQILCMIAMS--PPSDLSADSIRDEKVKVLKSLRRIDRSNVREKTVRGQYTAGFAQGK
G6PD_BUCBP        HLLQILTITTMS--TPIDCHENSIRDEKVKILKSLRPFNINNIHKNVILGQYTSGIINQK
G6PD_BUCAI        HLLQILTILTMD--QPKNISSESIQHEKVKILRSLNPINIHNINKKTVRGQYCSGVINEK
G6PD_BUCAP        HLLQILTIVSMD--KPKNITPEGIRDEKLKILRSLKKIDLNEIHIKTARGQYASGIINGK
G6PD_ZYMMO        HILQLVALVAME--PPAHMEANAVRDEKVKVFRALRPINNDTVFTHTVTGQYGAGVSGGK
G6PD_MYCS2        HLLQVLCLVAME--PPTHVNRESVRDEKRKVLEALEPLTAEQTQRDTVTGQYGPGLVGDE
G6PD_RHIME        HILQLLCFVAME--APTSMDAEAVRDEKLKVLRALKPITASNVEQVTVRGQYRAGASSGG
G6PD_TREPA        HLLLLLGIIAME--APAVVSSSRLRDEIVKVFDCLRPMGERDVMQHTVRAQYVAGKIRGV
G6PD_AGGAC        HLLQVLAMVAME--PPVIINANSMRDEVAKVLHCLRPLTQEDVEHNLVLGQYVAGEVDGE
G6PD_HAEIN        HLLQVLAMVAME--PPAIINANSMRDEVAKVMHSLRPLTSEDMENNLVLGQYTAAEINGK
G6PD_THEMA        HMLQILALIAME--PPSSFNGENFRNERVKLLRSIRPFPVEELESWIVRGQYGRGVVNGK
G6PD_SYNE7        HLMQLFSLTAME--PPNSLGADGIRNEKVKVVQATRLADIDDLSLSAVRGQYKAGWMNGR
G6PD_SYNY3        HLMQLFCLTAMD--PPNAIDADSIRNEKVKVLQATRLADINNLENAGIRGQYKAGWMGGK
G6PD_NOSS1        HLMQLYCLTAME--APNSMDADSIRTEKVKVLQATRLADVHNLSRSAIRGQYSAGWMKGQ
G6PD_NOSP7        HLMQLYCLTAME--APNAMDADSIRTEKVKVLQATRLADVHNLSRSAVRGQYSAGWMKGQ
G6PD_CHLMU        HLMQLLCLLTME--PPSEFSSAEIKKEKIKILKKILPIREEDV----IRGQYGEGVVQGV
G6PD_CHLPN        HMMQLLCLLTME--PPTTFDADEIRKEKIKILQRISPFSEGSS---IVRGQYGPGTVQGV
G6PD_LEUME        HTMQIVGWLAME--KPESFTDKDIRAAKNAAFNALKIYDEAEVNKYFVRAQYGAGDSADF
G6PD_STRPN        HTLQLLSLLAMD--KPASFTKDEIRAEKIKVFKNLYHPTDEELKEHFIRGQYRSGKIDGM
G6PD_BACSU        HIMQMVALLAME--PPIKLNTEEIRSEKVKVLRALRPIAKDEVDEYFVRGQYHAGEIDGV
                  *              *                                 ..:        

G6PD_ENCCU        ----DDYIKE--IHK---DSSTETFCMVPISIGTPRWSKVPFIIVAGKGMNEKRTEIILE
A0JXU9_ARTS2      DV--PDYAKEKGVDA---SRNTETLAEVQVDIGNWRWAGVPFILRSGKALGAKRKEAVVT
F0M529_PSEPM      EV--PDYAQEEGVDG---GRGTETLAEIRVNIDNWRWKGVPFILRSGKALGVKRKEAVVT
G6PD_HELPY        ----QGYRDENKVHK---ESQTETFVAIKAFLDTPKFKGVPFYLKHAKKMPHNQASVKIH
G6PD_HELPJ        ----QGYRDENKVHK---ESQTETFVAIKAFLDTPKFKGVPFYLKHAKKMPRNQASVKIH
A1UN45_MYCSK      ----VGYRREDGVAP---DSETETFIALQVGIDNWRWAGVPIYLRTGKKMAEGQRIISIA
A6W799_KINRD      ----EGYTDIDGVPD---DSTTDTLAAARVWIDNDRWRGVPFLLRSGKRMTADEQRVTLV
C8X971_NAKMY      ----DGYREVKGIAP---DSTTDTFVAARMWVDNDRWRGVPFLMRTGKRMAASTQRVSVV
D2S8C7_GEOOG      ----DGYTDIEGVAD---DSQTDTYVAARLWVDSDRWRGVPFVLRTGKRMAASEERVSLL
G6PD2_SCHPO       ----PGYRELDGVAD---DSEVSTFCALQLRSEAPRWKGIPIIISAGKGLDRDYFEARIT
G6PD3_SCHPO       ----PGYLDLEGVPK---DSKATTFAASTLHVDNDRWKGVPFVFVSGKRMKKGEVYIKYY
G6PD4_ARATH       ----SSSRDKNGVIL---NGVDPTYCAAALYIDNARWDGVPFLVRVGTGLIKHRVEIHVQ
G6PD_SCHPO        ----PGYLDDETVPK---GSRCPTYSAIPCFIDTERWRGVPFLLKAGKAMDIGKVEIRVQ
G6PDC_TOBAC       TY--PGYTDDKTVPK---DSLTPTFAAAALFIDNARWDGVPFLMKAGKALHTRSAEIRVQ
G6PD2_ARATH       TY--PAYTDDKTVPK---GSLTPTFAAAALFIDNARWDGVPFLMKAGKALHTRSAEIRVQ
G6PD3_ARATH       TY--PSYTDDKTVPK---GSLTPTFAAAALFIDNARWDGVPFLMKAGKALNTRSAEIRVQ
G6PD1_ARATH       TY--PGYTDDPTVPN---HSLTPTFAAAAMFINNARWDGVPFLMKAGKALHTRGAEIRVQ
G6PDC_SPIOL       SY--SGYTDDPTVPN---NSVTPTFAAAALFIDNARWDGVPFLMKAGKALHTKRAEIRVQ
G6PDC_SOLTU       SY--PAYTDDPTVPN---GSITPTFSAAALFIDNARWDGVPFLMKAGKALHTKRAEIRVQ
G6PD_ASPNG        ----PAYKEDETVPQ---DSRCPTFCAMVAYIKNERWDGVPFIMKAGKALNEQKTEIRIQ
G6PD_EMENI        ----PAYKEDDTVPQ---DSRCPTFCALVAHIKNERWDGVPFIMKAGKALNEQKTEIRIQ
G6PD_CYBJA        ----PGYLDDSTVKP---NSKAVTYAAFRVNIHNERWDGVPIVLRAGKALDEGKAEIRIQ
G6PD_KLULA        ----PSYLDDETVKE---DSKCVTFAAIGFKIANERWDGVPIVMRAGKALNEGKVEIRIQ
G6PD_YEAST        ----PAYVDDDTVDK---DSKCVTFAAMTFNIENERWEGVPIMMRAGKALNESKVEIRLQ
G6PD_DICDI        ----PAYLDDEGVPK---DSTTPTYAAAVFHINNPRWRGMPFILKCGKALDERKTEVRIQ
G6PD_MEDSA        ----EGYTDDPTVPD---DSNTPTFATTILRIHNERWEGVPFIVKAGKALNSRKAEIRVQ
G6PD_SOLTU        ----EGYKDDPTVPN---NSNTPTFATMVLRIHNERWEGVPFIMKAGKALNSRKAEIRVQ
G6PD5_ARATH       ----EGYRDDPTVPN---DSNTPTFATTILRINNERWEGVPFILKAGKAMSSKKADIRIQ
G6PD6_ARATH       ----EGYRDDDTVPN---DSNTPTFATTILRIHNERWEGVPFILKAGKALNSRKAEIRIQ
G6PD_CAEEL        PEASQGYKDDKSVPA---DSTTPTYALAVVHINNERWEGVPFFLRCGKALNEKKAEVRIQ
G6PD_CERCA        EQ-REGYLDDPTVSN---DSNTPTYAQGVLRINNERWDGVPFILRCGKALDERKAVVRIQ
G6PD_DROME        DDARTGYVEDPTVSN---DSNTPTYALGVLKINNERWQGVPFILRCGKALNERKAEVRIQ
G6PD_TAKRU        DA-KLGYLDDPTVPK---GSTQATFATVVLYVHNERWDGVPFILRCGKALNERKAEVRLQ
G6PD2_MOUSE       EA-ANGYLDDPTVPR---GSTTATFAAAVLYVKNERWDGVPFILRCGKALNERKAEVRLQ
G6PD_MACRO        EA-TKGYLDDPTVPR---GSTTATFAAVVLYVENERWDGVPFILRCGKALNERKAEVRLQ
G6PD_HUMAN        EA-TKGYLDDPTVPR---GSTTATFAAVVLYVENERWDGVPFILRCGKALNERKAEVRLQ
G6PD_RAT          EA-TNGYLDDPTVPH---GSTTATFAAAVLYVENERWDGVPFILRCGKALNERKAEVRLQ
G6PD_CRIGR        EA-TNGYLDDPTVPR---GSTTATFAAAVLYVENERWDGVPFILRCGKALNERKAEVRLQ
G6PD1_MOUSE       EA-ANGYLDDPTVPH---GSTTATFAAAVLYVENERWDGVPFILRCGKALNERKAEVRLQ
O66787_AQUAE      ----KSY-----------QGKAPTFALVKLHFDDERFTGVPFVLATGKKLKKKLTRVCIH
G6PD1_MYCTU       ----LGYTEVAGVAS---DSATETYVALRTEIDNWRWAGVPIFVRAGKELPAKVTEVRLF
G6PD1_MYCBO       ----LGYTEVAGVAS---DSATETYVALRTEIDNWRWAGVPIFVRAGKELPAKVTEVRLF
E8PQ82_THESS      ----QGYLEEPRVAP---DSPRETFVAVRLATHAPRWLGVPFYLRSGKRLAARSGFIFLA
G6PD_BORBU        FK--KGYKDETEFLG---NSNTETYLAMKVFINNWRWSGVPFYLRTGKGLARKFSEIYIQ
G6PD2_MYCTU       KV--VGLLDEEGFAE---DSTTETFAAITLEVDTRRWAGVPFYLRTGKRLGRRVTEIALV
G6PD2_MYCBO       KV--VGLLDEEGFAE---DSTTETFAAITLEVDTRRWAGVPFYLRTGKRLGRRVTEIALV
G6PD_PSEAE        AV--PGYLEEEHANR---DSDAETFVALRVDIRNWRWSGVPFYLRTGKRMPQKLSQIVIH
G6PD_DICD3        KV--PGYLEEEGANK---TSNTETFVAIRVDIDDWRWSGVPFYLRTGKRLPSKCSEVVVY
G6PD_ECOLI        KV--PGYLEEEGANK---SSNTETFVAIRVDIDNWRWAGVPFYLRTGKRLPTKCSEVVVY
G6PD_ECOL6        KV--PGYLEEEGANK---SSNTETFVAIRVDIDNWRWAGVPFYLRTGKRLPTKCSEVVVY
G6PD_ECO57        KV--PGYLEEEGANK---SSNTETFVAIRVDIDNWRWAGVPFYLRTGKRLPTKCSEVVVY
G6PD_BUCBP        KV--KSYLDETNNQEYQMNKYTETFVSMKIYIDNDQWSGVPFYLRTGKRLPKKCSEIVIF
G6PD_BUCAI        KV--PSYLEENGANK---NSLTETFVAIKVDLNNKQWSGVPFYLRTGKRLAHKYSEIVVF
G6PD_BUCAP        KV--PSYIEENGANK---HSKTETFVSIKVDINNDRWFGVPFYLRTGKRLAYKYSEIVIV
G6PD_ZYMMO        EV--AGYIDELGQPS-----DTETFVAIKAHVDNWRWQGVPFYIRTGKRLPARRSEIVVQ
G6PD_MYCS2        VV--GSYREEVADPH----SRTETFVAVKAHIRNWRWAGVPFYLRTGKRMSQRFSEIVVQ
G6PD_RHIME        PV--KGYLEELEGGV----SNTETFVAIKAEISNWRWAGVPFYLRTGKRMAGRMSEIVIT
G6PD_TREPA        AV--PGYLEESGVDP---RSCTETFAALKCYIDNWRWMDVPFYLRTGKRLPTGVTEVIVH
G6PD_AGGAC        WV--KGYLEEKGVPP---YSTTETYMALRCEIENWRWAGVPFYVRTGKRLPARVTEIVIH
G6PD_HAEIN        ME--KGYLEEKGVPA---NSRTETYIALRCEIENWRWAGVPFYVRTGKRLPARVTEIVIH
G6PD_THEMA        EV--PAYREEPGVAK---DSNVETFVAMKLFIDNWRWSGVPFYLRSGKRLPKKITEVAVV
G6PD_SYNE7        SV--PAYRDEEGADP---QSFTPTYVAMKLLVDNWRWQGVPFYLRTGKRMPKKVTEIAIQ
G6PD_SYNY3        PV--PGYREEPGVDP---SSTTPTFAALKLMVDNWRWQGVPFYLRTGKRMPKKVSEIAIQ
G6PD_NOSS1        QV--PGYRTEPGVDP---NSSTPTYVGMKFLVDNWRWQGVPFYLRTGKRMPKKVSEISIH
G6PD_NOSP7        AV--PGYRTEPGVDP---NSTTPTYVAMKFLVDNWRWKGVPFYLRTGKRMPKKVSEIAIH
G6PD_CHLMU        SV--SGYREEENVDP---NSLVETYVALKLFIDNPRWKGVPFYLQAGKRLPKRTTDIAVI
G6PD_CHLPN        SV--LGYREEENVDK---DSRVETYVALKTVINNPRWLGVPFYLRAGKRLAKKSTDISII
G6PD_LEUME        ----KPYLEELDVPA---DSKNNTFIAGELQFDLPRWEGVPFYVRSGKRLAAKQTRVDIV
G6PD_STRPN        KY--ISYRSEPNVNP---ESTTETFTSGAFFVDSDRFRGVPFFFRTGKRLTEKGTHVNIV
G6PD_BACSU        PV--PAYTDEDNVAP---DSNTETFVAGKLLIDNFRWAGVPFYIRTGKRMKEKSTKIVVQ
                                         *           .:  :*: .  .. :          

G6PD_ENCCU        FRRDVFAKCIELFSMPRQSSCRIVHTNEIETVRLVFNIYPECEVFLEVLVGGEPV-R-YV
A0JXU9_ARTS2      FKPVPHLP--KGFTG-------VDSPNQ-----LRIGFGPD-TLQFDVDVNGPGN---VL
F0M529_PSEPM      FRPVPHLP--QGFTG-------VDAPNQ-----LRIGFGPD-TLAFDIDVNGPGN---IF
G6PD_HELPY        FNAV----------------------NT-----LEFFLSQDKITLTLKDHQNP-------
G6PD_HELPJ        FNAV----------------------NT-----LEFFLSQDKITLTLKDHQNP-------
A1UN45_MYCSK      FREAPR----SMFPAGSGVG--SQGPDH-----LTFDLADNSKVSLSFYGKRPGP---GM
A6W799_KINRD      LRTPED----GPYAGS------ATAPST-----ISFSLLEGGAVDVALTVREPGV---AG
C8X971_NAKMY      FKAPAS----TPFPI-------PADGGV-----LSFSLAGNGAVDLSMVVKEPGP---GL
D2S8C7_GEOOG      LRRPDG----PVTDI-------PGHGNV-----LSLSLSGSGAVDLQVVAKEPGP---DL
G6PD2_SCHPO       FKRREG----GMFPT-------VDSSNV-----LVLRVYPKEFIALKGHIKQPGF---SR
G6PD3_SCHPO       FRLKDS----GIFSD-------VKRRRY-----LILHVQPEEFVNLTCTINKPMT-T-DL
G6PD4_ARATH       FRHVPG----NLYRENIGINI-DLGTNE-----LILRDEPDEAILVKINNKVPGL---GL
G6PD_SCHPO        FKAAAN----GLFK--------DAYHNE-----LVIRVQPDEAIYFKMNIKQPGL---SE
G6PDC_TOBAC       FRHVPG----NLYNKNFGSDL-DQATNE-----LVIRVQPNEAIYLKINNKVPGL---GM
G6PD2_ARATH       FRHVPG----NLYNRNTGSDL-DQATNE-----LVIRVQPDEAIYLKINNKVPGL---GM
G6PD3_ARATH       FRHVPG----NLYNRNSGTDR-DQTTNE-----LVIRVQPDEAIYLKINNKVPGL---GM
G6PD1_ARATH       FRHVPG----NLYKKSFATNL-DNATNE-----LVIRVQPDEGIYLRINNKVPGL---GM
G6PDC_SPIOL       FRHVPG----NLYKKTFGTDL-DKATNE-----LVLRVQPDEAIYLKINNKVPGL---GM
G6PDC_SOLTU       FRHVPG----NLYKRNFGTDM-DKATNE-----LVLRLQPDEAIYLKINNKVPGL---GM
G6PD_ASPNG        FRDVTS----GIFK--------DIPRNE-----LVIRVQPNESVYIKMNSKLPGL---SM
G6PD_EMENI        FKDVTS----GIFK--------DIPRNE-----LVIRVQPNESVYIKMNSKLPGL---SM
G6PD_CYBJA        FKPVAK----GMFK--------EIQRNE-----LVIRIQPNEAIYLKINSKIPGI---ST
G6PD_KLULA        FRRVAS----GMFT--------DIPNNE-----LVIRIQPNEAIYLKCNAKTPGL---AN
G6PD_YEAST        YKAVAS----GVFK--------DIPNNE-----LVIRVQPDAAVYLKFNAKTPGL---SN
G6PD_DICDI        FKRPDN----FLFSDD------DISRNE-----LVMRIQPGEAVYLKLLSKKPGL---EN
G6PD_MEDSA        FKDVPG----DIFRSK------KQGRNE-----FVIRLQPSEAIYMKLTVKQPGL---EM
G6PD_SOLTU        FKDVPG----DIFRCQ------KQGRNE-----FVIRLQPSEAMYMKLTVKKPGL---EM
G6PD5_ARATH       FKDVPG----DIFKCQ------NQGRNE-----FVIRLQPSEAMYMKLTVKQPGL---EM
G6PD6_ARATH       FKDVPG----DIFRCQ------KQGRNE-----FVIRLQPSEAMYMKLTVKQPGL---DM
G6PD_CAEEL        FKEVSG----DIYPSG------ELKRSE-----LVMRVQPNEAVYMKLMTKKPGM---GF
G6PD_CERCA        YRDVPG----DIFEG-------NSKRNE-----LVIRVQPGEALYFKMMTKSPGI---TF
G6PD_DROME        YQDVLG----DIFEG-------NTKRNE-----LVIRVQPGEALYFKMMTKSPGI---TF
G6PD_TAKRU        FTDVPG----DIFRN-------QCYRNE-----LVVRVQPNEAIYAKMMSKKPGV---YF
G6PD2_MOUSE       FRDIPG----DIFHQ-------KCKRNE-----LVIRMQPNEAVYTTMMTKKPGM---FF
G6PD_MACRO        FRDVAG----DIFQR-------QCKRNE-----LVIRVQPNEAVYTKMMTKKPGM---FF
G6PD_HUMAN        FHDVAG----DIFHQ-------QCKRNE-----LVIRVQPNEAVYTKMMTKKPGM---FF
G6PD_RAT          FRDVAG----DIFHQ-------QCKRNE-----LVIRVQPNEAVYTKMMTKKPGM---FF
G6PD_CRIGR        FRDVAG----DIFHQ-------QCKRNE-----LVIRVQPNEAVYTKMMTKKPGM---FF
G6PD1_MOUSE       FRDVAG----DIFHQ-------QCKRNE-----LVIRVQPNEAVYTKMMTKKPGM---FF
O66787_AQUAE      FKNFPK----EIERLLGC----VPERNL-----LVFELYPEQEVSFRVNVISPL----GF
G6PD1_MYCTU       LRRVPA----LAFLPNRR----PAEPNQ-----IVLRIDPDPGMRLQISAHTDDS-----
G6PD1_MYCBO       LRRVPA----LAFLPNRR----PAEPNQ-----IVLRIDPDPGMRLQISAHTDDS-----
E8PQ82_THESS      FHSSP-----------------EGQRGG-----LLLRLSPEVGLDLTLLGRG--------
G6PD_BORBU        FKKPSF----TLFNNSS-----VDFSNA-----LIFRIQPRDGIEIKFNTKKPGY---NY
G6PD2_MYCTU       FRRAPH----LPFDATMTD---ELGTNA-----MVIRVQPDEGVTLRFGSKVPGT---AM
G6PD2_MYCBO       FRRAPH----LPFDATMTD---ELGTNA-----MVIRVQPDEGVTLRFGSKVPGT---AM
G6PD_PSEAE        FKEPPH----YIFAPEQR----SLISNR-----LIIRLQPDEGISLQVMTKDQGLGK-GM
G6PD_DICD3        FKNPAL----NLFHDSYQ----QLPQNK-----LIIRLQPDEGVEIQILNKIPGLDH-KH
G6PD_ECOLI        FKTPEL----NLFKESWQ----DLPQNK-----LTIRLQPDEGVDIQVLNKVPGLDH-KH
G6PD_ECOL6        FKTPEL----NLFKESWQ----DLPQNK-----LTIRLQPDEGVDIQVLNKVPGLDH-KH
G6PD_ECO57        FKTPEL----NLFKESWQ----DLPQNK-----LTIRLQPDEGVDIQVLNKVPGLDH-KH
G6PD_BUCBP        FKTPPL----NIFSKNYN----TLSKNK-----LILSLQPNEAIKIYILNKKPKLTS-QY
G6PD_BUCAI        FKKKPT----NLFKNLNS----ELLQNK-----LIIRLEPNPNIIFDFSVKAPGLEQ-EY
G6PD_BUCAP        FKKISK----NLFQEFNK----NLSPNK-----LIIRLEPNESIKIYFLNKVPGLSK-EY
G6PD_ZYMMO        FKPVPH----SIFSSSGG----ILQPNK-----LRIVLQPDETIQISMMVKEPGLDRNGA
G6PD_MYCS2        FKPVPL----PMFPGIEG----TSEPNR-----LIISLQPDEAIRLEMTAKEPGS---GG
G6PD_RHIME        FKQIPH----SIFDQSAG----RISANQ-----LMIRLQPNEGVKQSLMIKDPGP-G-GM
G6PD_TREPA        YRTLPI----ALFEHIERPC--AREGNA-----LVIRIQPDEGIQLKIDLKEPGA---GF
G6PD_AGGAC        FKTTPH----PVFSQ-------NAPENK-----LIIRIQPDEGISMRFGLKKPGA---GF
G6PD_HAEIN        FKTTPH----PVFSQ-------NAPENK-----LIIRIQPDEAISMRFGLKKPGA---GF
G6PD_THEMA        FKKIPH----SIFAGVPSD---ELEPNT-----IVFTLQPNEGISLEFQVKRPCP---GM
G6PD_SYNE7        FKTVPH----LMFQSATQK---VNSPNV-----LVLRIQPNEGVSLRFEVKTPGS---SQ
G6PD_SYNY3        FRQVPL----LIFQSVAH----QANPNV-----LSLRIQPNEGISLRFEAKMPGS---EL
G6PD_NOSS1        FRDVPS----RMFQSAAQ----QRNANI-----LAMRIQPNEGISLRFDVKMPGA---EF
G6PD_NOSP7        FREVPS----RMFQSAAQ----QTNANI-----LTMRIQPNEGISLRFDVKMPGA---EF
G6PD_CHLMU        FKKSSY----DLFNSENCPLC-PLENDL-----LIIRIQPDEGVALQFNCKVPGT---NK
G6PD_CHLPN        FKKSPY----NLFAAEECSRC-PIENDL-----LIIRIQPDEGVALKFNCKVPGT---NN
G6PD_LEUME        FKAGTF----NFGSEQ------EAQEAV-----LSIIIDPKGAIELKLNAKSVED---AF
G6PD_STRPN        FKQMD-----SIFGE-------PLAPNI-----LTIYIQPTEGFSLSLNGKQVGE---EF
G6PD_BACSU        FKDIPM----NLYYGNEN----NMNPNL-----LVIHIQPDEGITLYLNAKKLGG---AA
                                                   : .                        

G6PD_ENCCU        LHDKKEIDGL-MHDSY------GGYHDYEIIFDSLVRGKDFSSVSSQEAELLWKVFNPIL
A0JXU9_ARTS2      SLDRATLNAE-LSASE------LLP--YGEVLEGVLTGDPLLSVRADTAEDCWRIIEPVI
F0M529_PSEPM      SLGRVTLDAE-LSASE------LLP--YGEVLEGVLAGDPLLSVRGDTAEECWRIVEPVL
G6PD_HELPY        ------LILE-THNKQ------EFLRPYAKLLYDAIQNNHNNFAHQLELEASWVFIDTLI
G6PD_HELPJ        ------LILE-THNKQ------EFLQPYAKLLYDAIPNNHYNFAHQLELEASWVFIDTLI
A1UN45_MYCSK      KLDKLSMQFS-TQETG-RVG--DVLEAYERLILDAMRGDHTLFTTAAGIESLWDRSTPLL
A6W799_KINRD      GTTQGTATLP-LAGL---G---EPALPYVHLIEHVLTGDRSLFTGVEGLRAAW----TCI
C8X971_NAKMY      SLVISDASIV-LGDVE-GA---DALPPYVRLIHDVLIGDRSLFTRPDGLASAWNVLQPVL
D2S8C7_GEOOG      DLATATATLQ-LSDVP-GGT--PLP-PYVSLLHDVLVGDRSLFTSSEGLAHAWQAFAPLQ
G6PD2_SCHPO       QIVPVTLDVK-YPEAF-PDT--WIHKAYEVVIADAINGKHTHFISDDEVRTSWKIFDDVL
G6PD3_SCHPO       QPIDAYASLN-YNEQF-KDLMKEKRDGYEILFEDAIRGDPTKFIRYDEVEYAWKIWDEIL
G6PD4_ARATH       QLDASELNLL-YKDRY-KT---EVPDSYEHLIHDVIDGDNHLFMRSDEVAAAWNILSPVL
G6PD_SCHPO        APLLTDLDLT-YSRRF-KNM--KLHEAYEALFLDAFAGDQSRFARIDELECAWSLVDPLL
G6PDC_TOBAC       RLDRSNLNLL-YSARY-SK---EIPDAYERLLLDAIEGERRLFIRSDELDAAWSLFTPVL
G6PD2_ARATH       RLDRSNLNLL-YSARY-SK---EIPDAYERLLLDAIEGERRLFIRSDELDAAWSLFTPLL
G6PD3_ARATH       RLDQSNLNLL-YSARY-SK---EIPDAYERLLLDAIEGERRLFIRSDELDAAWALFTPLL
G6PD1_ARATH       RLDRSDLNLL-YRSRY-PR---EIPDAYERLLLDAIEGERRLFIRSDELDAAWDLFTPAL
G6PDC_SPIOL       RLDRTDLNLC-YSTRY-RG---EIPDAYERLLLDAIEGERRLFIRSDKLDAAWSLFTPLL
G6PDC_SOLTU       RLDRSDLNLL-YKAKY-RG---EIPDAYERLLLDAIEGERRLFIRSDELDAAWALFTPLL
G6PD_ASPNG        QTVVTELDLT-YRRRF-SDL--KIPEAYESLILDALKGDHSNFVRDDELDASWRIFTPLL
G6PD_EMENI        QTVVTELDLT-YRRRF-SDL--KIPEAYESLILDALKGDHSNFVRDDELDASWRMFTPLL
G6PD_CYBJA        ETSLTDLDLT-YSTRYSKDF--WIPEAYEALIRDCYLGNHSNFVRDDELEVSWKLFTPLL
G6PD_KLULA        ENQTTELDLT-YSERY-KNY--WIPEAYESLIRDALLGDHSNFVRDDELDVSWKLFTPLL
G6PD_YEAST        ATQVTDLNLT-YASRY-QDF--WIPEAYEVLIRDALLGDHSNFVRDDELDISWGIFTPLL
G6PD_DICDI        KIEQTELDLS-YRHRF-ENL--DLPDAYERLILDSIKGDHNLFVRDDELDVAWQIFTPLL
G6PD_MEDSA        SAVQSELDLS-YGQRY-QGI--TIPEAYERLILDTIRGDQQHFVRRDELKASWQIFTPLL
G6PD_SOLTU        STVQSELDLS-YGQRY-QGV--VIPEAYERLILDTIRGDQQHFVRRDELKAAWEIFTPLL
G6PD5_ARATH       QTVQSELDLS-YKQRY-QDV--SIPEAYERLILDTIRGDQQHFVRRDELKAAWEIFTPLL
G6PD6_ARATH       NTVQSELDLS-YGQRY-QGV--AIPEAYERLILDTIKGDQQHFVRRDELKVAWEIFTPLL
G6PD_CAEEL        GVEETELDLT-YNNRF-KEV--RLPDAYERLFLEVFMGSQINFVRTDELEYAWRILTPVL
G6PD_CERCA        DIEETELDLT-YEHRY-KNS--YLPDAYERLILDVFCGSQMHFVRSDELSEAWRIFTPVL
G6PD_DROME        DIEETELDLT-YEHRY-KDS--YLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPIL
G6PD_TAKRU        TPEETELDLT-YKSRY-KDV--KLPDAYERLILDVFCGSQMHFVASDELREAWRIFTPLL
G6PD2_MOUSE       NPEESELDLT-YGNKY-KNV--KLPGAYERLILDVFCGCQMHFVRTDELREGWRIFTPLL
G6PD_MACRO        NPEESELDLT-YGNRY-KDV--KLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLL
G6PD_HUMAN        NPEESELDLT-YGNRY-KNV--KLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLL
G6PD_RAT          NPEESELDLT-YGNRY-KNV--KLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLL
G6PD_CRIGR        NPEESELDLT-YGNRY-KNV--KLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLL
G6PD1_MOUSE       NPEESELDLT-YGNRY-KNV--KLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLL
O66787_AQUAE      LRCTESINWR-VSLKD-VLG--EIPEAYESLLLDVIRGDKTLFLDAEETEILWEKTEPLL
G6PD1_MYCTU       -WRDIHLDSS-FAVDL-G----EPIRPYERLLYAGLVGDHQLFAREDSIEQTWRIVQPLL
G6PD1_MYCBO       -WRDIHLDSS-FAVDL-G----EPIRPYERLLYAGLVGDHQLFAREDSIEQTWRIVQPLL
E8PQ82_THESS      KPETLSFRLG-PEPEF---------DAYEEVLLAALSGDLTPFPSQEEVEEAWRILDPVL
G6PD_BORBU        EIQTANMEFS-YHGAF-KR---LFDEAYERLLLDAFLGDGTLYATSDEIESSWEFVSDIA
G6PD2_MYCTU       EVRDVNMDFS-YGSAF-AE---DSPEAYERLILDVLLGEPSLFPVNAEVELAWEILDPAL
G6PD2_MYCBO       EVRDVNMDFS-YGSAF-AE---DSPEAYERLILDVLLGEPSLFPVNAEVELAWEILDPAL
G6PD_PSEAE        QLRTGPLQLS-FSETY-HAA--RIPDAYERLLLEVTQGNQYLFVRKDEVEFAWKWCDQLI
G6PD_DICD3        RLQTTKLDLS-FSETF-NQQ--HLADAYERLLLETMRGIQALFVRRDEVEEAWKWVDSIM
G6PD_ECOLI        NLQITKLDLS-YSETF-NQT--HLADAYERLLLETMRGIQALFVRRDEVEEAWKWVDSIT
G6PD_ECOL6        NLQITKLDLS-YSETF-NQT--HLADAYERLLLETMRGIQALFVRRDEVEEAWKWVDSIT
G6PD_ECO57        NLQITKLDLS-YSETF-NQT--HLADAYERLLLETMRGIQALFVRRDEVEEAWKWVDSIT
G6PD_BUCBP        KLDLITLDFN-YSKFY-KKI--QLSDAYEKLLLESMKGIQSLFVRRDEVELAWKWIDSTL
G6PD_BUCAI        KIENSQLKSSQFSKKY-SK---NSIDAYERLLFEIMRGVQSLFVCRDEIEAAWKWIDPII
G6PD_BUCAP        KLKSDKMEFN-FNINN-TK---NFVDAYERLLFESMRGIQSLFVCREEVEEAWKWIDPII
G6PD_ZYMMO        HMREVWLDLS-LTDVF-KDR--KRRIAYERLMLDLIEGDATLFVRRDEVEAQWVWIDGIR
G6PD_MYCS2        RLRPVSLALN-YTEAF-PE---RSPDAYERLLMDVVRGDPTLFMRRDEVEAAWAWAEPIL
G6PD_RHIME        RLRNVPLDMS-FAEAF-AV---RNADAYERLLLDVIRNNQTLFVRRDEVEAAWQWIDPIL
G6PD_TREPA        KTIPVSVDFQ-YSALT-YS---HLPSAYERLLLDCMNGDNTLYHRDDAVESAWRFIDPIL
G6PD_AGGAC        EAKEVSMDFR-YADLA-GA---TVMTAYERLLLDAMKGDATLFARTDAVHAAWKFVQPIL
G6PD_HAEIN        EAKEVSMDFR-YADLA-GA---QVLTAYERLLLDAMKGDATLFARTDAVHAAWKFVQPIL
G6PD_THEMA        FPQLLSMDFR-YEDYF-GV---KLPDAYERLLLDVILGDPTLFMRRDDLEVSWELLDPVL
G6PD_SYNE7        RTRSVDMDFR-YDTAF-GS---PTQEAYSRLLVDCMLGDQTLFTRADEVEASWRVVTPLL
G6PD_SYNY3        RTRTVDMDFS-YGSSF-GV---AAADAYHRLLLDCMLGDQTLFTRADEVEEAWRVVTPVL
G6PD_NOSS1        RTRSVDMDFS-YGSFG-IE---ATSDAYDRLFLDCMMGDQTLFTRADEVEAAWQVVTPAL
G6PD_NOSP7        RTRSVDMDFS-YGS-F-GIQ--ATSDAYDRLFLDCMMGDQTLFTRADEVEAAWQVVTPAL
G6PD_CHLMU        LVRPVKMDFR-YDSYF-NT---VTPEAYERLLCDCILGDRTLFTSNEEVLASWELFSPLL
G6PD_CHLPN        IVRPVKMDFR-YDSYF-QT---TTPEAYERLLCDCIIGDRTLFTGGDEVMASWKLFTPVL
G6PD_LEUME        NTRTIDLGWT-VSDED-KK---NTPEPYERMIHDTMNGDGSNFADWNGVSIAWKFVDAIS
G6PD_STRPN        NLAPNSLDYR-TDATA-TG---ASPEPYEKLIYDVLNNNSTNFSHWDEVCASWKLIDRIE
G6PD_BACSU        HAQPIKLD---YCSNCNDEL--NTPEAYEKLIHDCLLGDATNFAHWDEVALSWSFVDSIS
                                             *  ::     .              *       

G6PD_ENCCU        SISKEDM----LFYYSKGID-MPKEAEEMIREI-KDH-----------------------
A0JXU9_ARTS2      KAWGRGS--VPLEEYAAGTS-GPGG------------------WPV--------------
F0M529_PSEPM      RAWQQDE--VPLEEYDAGSA-GPAG------------------WPGSAAGH---------
G6PD_HELPY        EGFMNNATP----LYSYESH-HLNESEFL--KP-LYQ-----------------------
G6PD_HELPJ        EGFINNATP----LYSYESH-NLNESEFL--KP-LYQ-----------------------
A1UN45_MYCSK      ED------PPPVKVYQPGTW-GPNAIHQLIAPN-AWRLPFEREWREKTPE----------
A6W799_KINRD      ERFSNDR-PAVL-PYAPGTW-GPEAADALAEPG---------QWFLRS------------
C8X971_NAKMY      DHRPAVQ------PYPQGSW-GPAAAAQLAAP--GR-------WLLGQ------------
D2S8C7_GEOOG      QRPPQVH------RYAPGSW-GPVEAEALAEPC-GWL------LGDGRRD----------
G6PD2_SCHPO       DTTGD---LSPL-PYAFGSHHGPDATLEFFKKR-NLE------WD---------------
G6PD3_SCHPO       DSP-----KKPI-PYPAGSD-GPEGLEAYMKRHLGHE-----------------------
G6PD4_ARATH       EEIDKHH-TAPE-LYEFGGR-GPVAAYYLWAKH-GVP------WADD-------------
G6PD_SCHPO        KYMEEEK-PVPE-PYEYGSD-GPECLYSFLKKF-GYIYDSPDYYDYPVMSVPSDH-----
G6PDC_TOBAC       KELEDKK-IVPE-YYPYGSR-GPIGAHYLAARY-KVR------WGDLV------------
G6PD2_ARATH       KEIEEKK-RIPE-YYPYGSR-GPVGAHYLAAKH-KVQ------WGDVSIDQ---------
G6PD3_ARATH       KEIEEKK-TTPE-FYPYGSR-GPVGAHYLAAKH-KVQ------WGDLSLDQ---------
G6PD1_ARATH       KELEEKK-IIPE-LYPYGSR-GPVGAHYLASKY-NVR------WGDLGEA----------
G6PDC_SPIOL       KELEEKK-VAPE-LYPYGSR-GPVGAHYLAAKH-NVR------WGDLSGEDS--------
G6PDC_SOLTU       KELEEKK-IAPE-LYPYGSR-GPVGAHYLAAKH-NVR------WGDLSGDD---------
G6PD_ASPNG        HYLDDNKEIIPM-EYPYGSR-GPAVLDDFTASF-GYKFSDAAGYQWPLTSTPNRL-----
G6PD_EMENI        HYLDDNKEIIPM-EYPYGSR-GPSVLDDFTASY-GYKFSDAAGYQWPLTHTTPNRL----
G6PD_CYBJA        EAVEKEENVKLE-SYPYGSK-GPKELRKYLIDH-GYVFNDPGTYQWPLTNTDVK------
G6PD_KLULA        NYLEGPDGPQPK-IYPYGCR-SPDGLVEFLADH-GYTFSKPGSYQWPVTTPKM-------
G6PD_YEAST        KHIERPDGPTPE-IYPYGSR-GPKGLKEYMQKH-KYVMPEKHPYAWPVTKPEDTKDN---
G6PD_DICDI        DQIEKEK-IKPE-PYSFGSR-GPKSADELSKKF-GFIRSLGYNWPGNSPQGSKK------
G6PD_MEDSA        HKIDRGE-LKPV-PYNPGSR-GPAEADELLEKA-GYVQTPGYIWIPPTL-----------
G6PD_SOLTU        HRIDNGE-VKPI-PYKPGSR-GPAEADELLQNA-GYVQTHGYIWIPPTL-----------
G6PD5_ARATH       HRIDKGE-VKSV-PYKQGSR-GPAEADQLLKKA-GYMQTHGYIWIPPTL-----------
G6PD6_ARATH       HRIDKGE-VKSI-PYKPGSR-GPKEADQLLEKA-GYLQTHGYIWIPPTL-----------
G6PD_CAEEL        EELKKKK-VQPV-QYKFGSR-GPTEGDELMKKY-GFIFTGTYKWVAPKL-----------
G6PD_CERCA        NEIENNK-VKPI-PYVFGSR-GPKEADQKTSEN-NFKYYGSYKWIGKK------------
G6PD_DROME        HQIEKEH-IRPI-TYQYGSR-GPKEADRKCEEN-NFKYSGSYKWHGGKAATSNH------
G6PD_TAKRU        HQIEKEK-PKPI-PYKYGSR-GPAEADELEKRV-GFRYEGTYKWVNPHRL----------
G6PD2_MOUSE       HKIEREK-PQPF-PYVYGSR-GPTEADELMRRV-GFQYKGTYKGTHKH------------
G6PD_MACRO        HHIEKEK-TQPI-AYVYGSR-GPPEADELMKRV-GFQYEGTYKWVNPHKL----------
G6PD_HUMAN        HQIELEK-PKPI-PYIYGSR-GPTEADELMKRV-GFQYEGTYKWVNPHKL----------
G6PD_RAT          HKIDREK-PQPI-PYVYGSR-GPTEADELMKRV-GFQYEGTYKWVNPHKL----------
G6PD_CRIGR        HKIDQEK-PQPI-PYVYGSR-GPTEADELMKRV-GFQYEGTYKWVNPHKL----------
G6PD1_MOUSE       HKIDREK-PQPI-PYVYGSR-GPTEADELMKRV-GFQYEGTYKWVNPHKL----------
O66787_AQUAE      KKEKEVL------TYDDRVL-IPEFAEDFISCL---------------------------
G6PD1_MYCTU       DNPGEIH------RYDRGSW-GPEAAQSLLRGHRGWQSP----WLPRGTDA---------
G6PD1_MYCBO       DNPGEIH------RYDRGSW-GPEAAQSLLRGHRGWQSP----WLPRGTDA---------
E8PQ82_THESS      KAWEEGE---PE-VYPQGSE-GPRGQMGIL-KP-GHA------WVSLRG-----------
G6PD_BORBU        NKWADIE----ICNYFYGSE-GPKEIDSILEKD-HF-------WRKI-------------
G6PD2_MYCTU       EHWAAHG--TPD-AYEAGTW-GPESSLEMLRRT-GRE------WRRP-------------
G6PD2_MYCBO       EHWAAHG--TPD-AYEAGTW-GPESSLEMLRRT-GRE------WRRP-------------
G6PD_PSEAE        AGWERLS-EAPK-PYPAGSW-GPVASVALVARD-GRS------WYGDF------------
G6PD_DICD3        DAWAMDN-DSPK-PYQAGTW-GPVASVAMITRD-GRS------WNEVE------------
G6PD_ECOLI        EAWAMDN-DAPK-PYQAGTW-GPVASVAMITRD-GRS------WNEFE------------
G6PD_ECOL6        EAWAMDN-DAPK-PYQAGTW-GPVASVAMITRD-GRS------WNEFE------------
G6PD_ECO57        EAWAMDN-DAPK-PYQAGTW-GPVASVAMITRD-GRS------WNEFE------------
G6PD_BUCBP        QCLHLKP-RLPD-LYPAGTW-GPARSKTMINND-GYE------WNE--------------
G6PD_BUCAI        HAWKNSKNNAPQ-LYMSGTW-GPKNSDLLLAHD-GRV------WYEFH------------
G6PD_BUCAP        NGWKKTN-INTVQLYKSGTW-GPKSSDEIIMRD-GRF------WETFN------------
G6PD_ZYMMO        EGWKANS-MKPK-TYVSGTW-GPSTAIALAERD-GVT------WYD--------------
G6PD_MYCS2        RHWQDAD-RVPR-TYPAGTD-GPVDAATLIERD-GRR------WHGGAA-----------
G6PD_RHIME        KAWEATG-QQVQ-GYTAGTW-GPSQSIALIERD-GRT------WNDAI------------
G6PD_TREPA        AAWKSNK--SPLLTYPAGSW-GPKAADDLIKGS-APR------WHHPSSTLLSDDFACRL
G6PD_AGGAC        NYKAQGG-RLY--DYEAGTW-GPTAADKLIAKS-GRV------WRRPSGLMKKKV-----
G6PD_HAEIN        DYKANGG-RIH--EYEAGTW-GPVAADKLIAKQ-GKV------WRKPSGLMKKKV-----
G6PD_THEMA        KAWENDPVRFSPYVYPAGTW-GPREADLLIERD-GRK------WRKL-------------
G6PD_SYNE7        ESWDDPRQAAGISFYEAGTW-EPAEAEQLINRD-GRR------WRRL-------------
G6PD_SYNY3        SAWDAPSDPLSMPLYEAGTW-EPAEAEWLINKD-GRR------WRRL-------------
G6PD_NOSS1        SVWDSPADPATIPQYEAGTW-EPAEAEFLINQD-GRR------WRRL-------------
G6PD_NOSP7        SVWDAPADPTTIPQYEAGTW-EPEQAELLINQD-GRR------WRRL-------------
G6PD_CHLMU        EQWSKIRPIFP--NYIAGSL-RPQGADELLSRD-GRA------WRSY-------------
G6PD_CHLPN        EEWDQDSSPSFP-NYPAGSS-GPKEADALIERD-GRS------WRPL-------------
G6PD_LEUME        AVYTADK--APLETYKSGSM-GPEASDKLLAAN-GDA------WVFKG------------
G6PD_STRPN        KLWAENG--APLHDYKAGSM-GPQASFDLLEKF-GAK------WTWQPDITYRQDGRLE-
G6PD_BACSU        ETWAANKTLSP--NYESGSM-GPKESDDLLVKD-GLH------WWNI-------------
                                *