CLUSTAL format seed alignment for MF_00969

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MFD_MYCBO             ------------------------------------------------------------
MFD_MYCTU             ------------------------------------------------------------
Q8NRS9_CORGL          ------------------------------------------------------------
Q9F2P1_STRCO          ------------------------------------------------------------
Q8G5I7_BIFLO          ------------------------------------------------------------
Q83N19_TROWT          ------------------------------------------------------------
MFD_MYXXA             ------------------------------------------------------------
Q74H75_GEOSL          ------------------------------------------------------------
Q1IHV1_KORVE          ------------------------------------------------------------
Q2RMB9_MOOTA          ------------------------------------------------------------
A9WHG9_CHLAA          ------------------------------------------------------------
I0IRW8_LEPFC          ------------------------------------------------------------
MFD_BACSU             ------------------------------------------------------------
Q8YAD0_LISMO          ------------------------------------------------------------
Q839B9_ENTFA          ------------------------------------------------------------
F9UL13_LACPL          ------------------------------------------------------------
MFD_STAEQ             ------------------------------------------------------------
MFD_STAES             ------------------------------------------------------------
MFD_STAHJ             ------------------------------------------------------------
MFD_STAA8             ------------------------------------------------------------
MFD_STAS1             ------------------------------------------------------------
Q9CJI0_LACLA          ------------------------------------------------------------
Q8DRQ1_STRR6          ------------------------------------------------------------
Q97E98_CLOAB          ------------------------------------------------------------
A5I7R4_CLOBH          ------------------------------------------------------------
D3R0N9_MAGIU          ------------------------------------------------------------
B8E2E1_DICTD          ------------------------------------------------------------
MFD_ECOLI             ------------------------------------------------------------
MFD_HAEIN             ------------------------------------------------------------
Q8EEV8_SHEON          ------------------------------------------------------------
Q9HZK3_PSEAE          ------------------------------------------------------------
Q83CG9_COXBU          ------------------------------------------------------------
Q63T69_BURPS          ------------------------------------------------------------
Q7VZN3_BORPE          ------------------------------------------------------------
Q8P7B3_XANCP          ------------------------------------------------------------
Q5NH30_FRATT          ------------------------------------------------------------
MFD_RICFE             ------------------------------------------------------------
MFD_RICCN             ------------------------------------------------------------
MFD_RICPR             ------------------------------------------------------------
MFD_RICTY             ------------------------------------------------------------
MFD_RICBR             ------------------------------------------------------------
Q3YR59_EHRCJ          ------------------------------------------------------------
Q2GLL6_ANAPZ          ------------------------------------------------------------
A9CIN2_AGRFC          ------------------------------------------------------------
Q89LE3_BRADU          ------------------------------------------------------------
Q9A782_CAUVC          ------------------------------------------------------------
Q2RTL9_RHORT          ------------------------------------------------------------
Q3J2M4_RHOS4          ------------------------------------------------------------
MFD_HELPY             ------------------------------------------------------------
MFD_HELPJ             ------------------------------------------------------------
Q7M928_WOLSU          ------------------------------------------------------------
Q0P9G9_CAMJE          ------------------------------------------------------------
A0A0H3P9Q7_CAMJJ      ------------------------------------------------------------
A7ZE35_CAMC1          ------------------------------------------------------------
E0UPP9_SULAO          ------------------------------------------------------------
I0GL09_CALEA          ------------------------------------------------------------
Q8RH90_FUSNN          ------------------------------------------------------------
MFD_BORBU             ------------------------------------------------------------
F0S455_DESTD          ------------------------------------------------------------
E1X1P6_HALMS          ------------------------------------------------------------
MFD_SYNY3             ----------------------------------------------------------MA
Q8DKA7_THEEB          ------------------------------------------------------------
Q7NEP2_GLOVI          ------------------------------------------------------------
Q7VBU2_PROMA          ------------------------------------------------------------
Q8F395_LEPIN          ---------------------------------------------------------MKD
B5YL15_THEYD          ------------------------------------------------------------
A6GW35_FLAPJ          ------------------------------------------------------------
Q8AB59_BACTN          ------------------------------------------------------------
Q2S6G5_SALRD          ------------------------------------------------------------
Q8KEN4_CHLTE          ------------------------------------------------------------
O84753_CHLTR          ------------------------------------------------------------
M1WUP8_PSEP2          ------------------------------------------------------------
Q72AT7_DESVH          ------------------------------------------------------------
B9KVH0_RHOSK          ------------------------------------------------------------
B0UM39_METS4          ------------------------------------------------------------
Q1YKV9_AURMS          ------------------------------------------------------------
E8TPS0_MESCW          ------------------------------------------------------------
C6B9D3_RHILS          ------------------------------------------------------------
A4YQE5_BRASO          ------------------------------------------------------------
A5EAY9_BRASB          MRKASRRGEFCGAWLAPRRAARVPVSDTFALKGGRMLDTPKFGSPRAAESAKAPNEIRRL
D1B5L3_THEAS          ------------------------------------------------------------
Q9RU62_DEIRA          ------------------------------------------------------------
Q5SJW3_THET8          ------------------------------------------------------------
I0IIW6_PHYMF          ------------------------------------------------------------
                                                                                  

MFD_MYCBO             ---------------------MTAPGPACSDTPIAGLVELALSAPTFQQLMQRAGGRPD-
MFD_MYCTU             ---------------------MTAPGPACSDTPIAGLVELALSAPTFQQLMQRAGGRPD-
Q8NRS9_CORGL          -------------------------------------MKVAATDPKLKGLMSNVGQQ---
Q9F2P1_STRCO          -------------------------------MSLHGLLDAVVKDTALAEAIAAAADGNR-
Q8G5I7_BIFLO          -------------------MAGEATHPDLINGSLVGILSELEQDKTFLKLAAGDIEASDD
Q83N19_TROWT          -------------------MPGILFNIAWPYKSPADNLTCPTNSTHTYPHKIPLHGQLDK
MFD_MYXXA             -------------------MRLLITLGPSGSTHGHSLHTDAGRRRGGRPFAQVVDELRAG
Q74H75_GEOSL          ---------------------------------MTQTDTDLFKRLTDR-------LTPPA
Q1IHV1_KORVE          -----------------------MILPFVRELFADVEKSPEFLRAATQ-------VKSGT
Q2RMB9_MOOTA          ---------------------------------MYNNSILQIIRDSEQFYAIAGGLRRGA
A9WHG9_CHLAA          ---------------------MVTPLPATFHQLASVQALGKVLADLPGIAALAASLRPGY
I0IRW8_LEPFC          --------------------------------------------------------MTRG
MFD_BACSU             --------------------------------MDNIQTFIKESDDFKSIINGLHEGL---
Q8YAD0_LISMO          --------------------------------MKGLQQLIYEQKDIRAVLNALDEKE---
Q839B9_ENTFA          -----------------------MENSRKEGPCLNIIERISQTEIAKSWRSQLMTTG---
F9UL13_LACPL          ---------------------------------MDIETIVEQTPDFQTILAGISPR----
MFD_STAEQ             -------------------------------MKSMIANYISEDNRFQELDEVFGQE----
MFD_STAES             -------------------------------MKSMIANYISEDNRFQELDEVFGQE----
MFD_STAHJ             -------------------------------MRPIISDYIQNDKRFQELDDVFGHQ----
MFD_STAA8             --------------------------------MTILTTLIKEDNHFQDLNQVFGQA----
MFD_STAS1             -------------------------------MKSIITEYINEDKRYQELNEVFGKE----
Q9CJI0_LACLA          ---------------------------------MNIIEFFDQNWQLQKWQQGFSKR----
Q8DRQ1_STRR6          --------------------------------MVTLLDLFSENDQIKKWHQNLTDK----
Q97E98_CLOAB          ------------------------------MRLDGLMHPLKGSNKFQDAIYKIKSNE---
A5I7R4_CLOBH          ------------------------------MRLEGLVSPLSLSEDFKSLLNNINLNK---
D3R0N9_MAGIU          -----------------------------MTNIDTFLARASRDKNFVALTEAVETTAGAC
B8E2E1_DICTD          --------------------------------MSILLEKIIKSSEFNTLEKVINSKN---
MFD_ECOLI             ----------------------------------------MPEQYRYTLPVKAGEQRLLG
MFD_HAEIN             ---------------------------------------MKTAFFQPDIPTQPNDHKILG
Q8EEV8_SHEON          --------------------------------------MTHISALTPPVVKNGTQMQTLS
Q9HZK3_PSEAE          -----------------------------------------MSVLRLPSLPASAGKQHWG
Q83CG9_COXBU          ---------------------------------MIKVEMTPISPLQPPIPRSIDNRLQWG
Q63T69_BURPS          ----MKSKDGFYNTSFAAMRRAELVRHPAFANQPLVMSDNASPSQSPVALVKAGQRFAFD
Q7VZN3_BORPE          --------------------------------------MPIPATATTLSALKPGARFTQP
Q8P7B3_XANCP          ---------------------------------------MPSPTFPSPPLPKSGQLRAYW
Q5NH30_FRATT          ----------------------------------------------MLNNQISANDTVVS
MFD_RICFE             --------------------------------------------------------MLQQ
MFD_RICCN             --------------------------------------------------------MLQQ
MFD_RICPR             --------------------------------------------------------MIQQ
MFD_RICTY             --------------------------------------------------------MLQQ
MFD_RICBR             --------------------------------------------------------MLQQ
Q3YR59_EHRCJ          ----------------------------------------------------MGNINKFL
Q2GLL6_ANAPZ          --------------------------------------------------MDMGSSEIVT
A9CIN2_AGRFC          ---------------------------------------MIAGFDAKL-VASADTPLTIG
Q89LE3_BRADU          ---------------------------------------MKQGMKSPAELLTPGRALTLA
Q9A782_CAUVC          -----------------------------------------MSYDAKQ-IAKAAGGLTLA
Q2RTL9_RHORT          -------------------------------------------MKNLLESLAVGRRIEAA
Q3J2M4_RHOS4          --------------------------------------------------MQNGTRIFLG
MFD_HELPY             --------------------------------------------------------MIQS
MFD_HELPJ             --------------------------------------------------------MIQS
Q7M928_WOLSU          --------------------------------------------------------MIQS
Q0P9G9_CAMJE          ---------------------------------------------------------MQA
A0A0H3P9Q7_CAMJJ      ---------------------------------------------------------MQA
A7ZE35_CAMC1          ---------------------------------------------------------MQA
E0UPP9_SULAO          --------------------------------------------------------MSQA
I0GL09_CALEA          -------------------------------------------------MRLKNIVENPN
Q8RH90_FUSNN          -------------------------------------------------MEKKFRGEIPF
MFD_BORBU             --------------------------------MNIDEELTTILKNNSNLKKMKEFLEQNI
F0S455_DESTD          -----------------------------------------MIKRSLKLLKGKVKNKELV
E1X1P6_HALMS          ---------------------------------------MIFESVVQKINSWHNSKKENL
MFD_SYNY3             EPRAVLKQGNRNRDKDSVGLGNRLRFVSISSALNPMTFSSILRHLQTLPLSKDLREKLQK
Q8DKA7_THEEB          -----------------------------------MSLMAIPRSWGKLPLTAELLSKLQH
Q7NEP2_GLOVI          -----------------------------------MPLTALIQSLRGSPFLEEMSQRLGK
Q7VBU2_PROMA          -----------------------------------MALKSLITNVVESALTEEIVKRVVK
Q8F395_LEPIN          LLNMIGDGVFSRFESSLKKKNSTSKIKSSFADSSNLKTQSNLTLKTQSASASEKKISVNT
B5YL15_THEYD          ---------------------------------------MNFLSNQPSNINTALLEEVKK
A6GW35_FLAPJ          ----------------------------MSTKIISKKYSEQAKIVNLLKTIK-GDN----
Q8AB59_BACTN          ----------------------------MTITELQQQYAAHPNTAVMERLLK-DASV---
Q2S6G5_SALRD          ----------------------------MSLTAIANRIETTAAVSRLRAWTA-EAQRGDR
Q8KEN4_CHLTE          ---------------------------MSAPRNASLEFSSFARNPYRRRFMKFSANPTPQ
O84753_CHLTR          ----------------------------MDFDPTSIDFSSFPLLKDTKLPSL--------
M1WUP8_PSEP2          --------------------------------------MSLTLPPPIQDFIKGSTDSVRV
Q72AT7_DESVH          ---------------------------------------MLDFAALVRKLASKGCGHIEV
B9KVH0_RHOSK          ------------------------------------------------------------
B0UM39_METS4          --------------------------------------------MVKRQPRAARRAEIVA
Q1YKV9_AURMS          --------------------------------MVRIFKGRDMHHSTTSQDRRSGNKRVFP
E8TPS0_MESCW          -------------MRAARNGVAVLTFFWGQGEISVNRHISRTDVEQIDHTDDSGFTIEHG
C6B9D3_RHILS          ------------------------------------------------------------
A4YQE5_BRASO          ----------------------------MAKSATPSRSKP--SDAVQDASARPPRQVPAS
A5EAY9_BRASB          AWHSSIQHETSVTSALRTARGSTLRKKASAKQAAPLKAAPRKKTVVVTKASAPLRAGISS
D1B5L3_THEAS          ------------------------------------------------------------
Q9RU62_DEIRA          ------------------------------------------------------------
Q5SJW3_THET8          ------------------------------------------------------------
I0IIW6_PHYMF          -----------------------------------MLAPFRSHAAPRAAVRAFAEADPAA
                                                                                  

MFD_MYCBO             --ELTLIAPASARLLVASA-----------LARQG--PLLVVTATGREADDLAAELRGVF
MFD_MYCTU             --ELTLIAPASARLLVASA-----------LARQG--PLLVVTATGREADDLAAELRGVF
Q8NRS9_CORGL          --HLHITGIDQARPWAIGA-----------LAHHA--PVLVVTATGREAEDLTAELKAMM
Q9F2P1_STRCO          -MHVDLVGPPAARPFAIAA-----------LARETGRPVLAVTATGREAEDLAAALRSLL
Q8G5I7_BIFLO          VDNSVLAGIPEGLRPALAAAIGQG------VAGKPGKPVVLVVASGREAEETVGSLRSWY
Q83N19_TROWT          GFLNLLAAIEAFIPTGFAATACPGGFSACKVASLVGDVDSLLVILPSEDACFTDTLRTYL
MFD_MYXXA             QRVRTQGLKGAARGHVLARLH----------GALRAPLVCVAVDE-EAADALAADLSFFL
Q74H75_GEOSL          ARLTLAGLRGSSPAYLLARLI----------GEAGAPFLVVVPDA-EAAAELTTELRFFT
Q1IHV1_KORVE          GRIRVSGLTPSARALHYALFS----------KATLKPLIVVVPSN-RAAEELLPIVQAYC
Q2RMB9_MOOTA          GEVQLYGL-PEGMKGLWLAAM----------LDEFNPILVVTPGS-EEAQRLAADIESFW
A9WHG9_CHLAA          QTIAPVP--AAARPALLAALA----------YHRTTPTLYITLSA-ESALRAADDLRQWL
I0IRW8_LEPFC          DEISLAGIPPEASFLLPGLIL----------DQIPDRTLWILTANMERARSLYNDINSFN
MFD_BACSU             -KEQLLAGLSGSARSVFTSAL----------ANETNKPIFLITHNLYQAQKVTDDLTSLL
Q8YAD0_LISMO          -KAQLVTGLTGSSRALFASVV----------EGASKRPVVFVTHNLYHAQKLYDDLLSLM
Q839B9_ENTFA          -TRQLITGLSGSAKTLLMAGA----------LQKTHQKIVIAVPNLYYANQLVDDFLNIL
F9UL13_LACPL          -SRQLITGLNGSARTVYLSAL----------FHQLTHSLLIVTDNGFHASQLVDDLTSLL
MFD_STAEQ             --NILVTGLSPSAKATIIAEK----------YLKDHKQMLLVTNNLYQADKIETDILQYV
MFD_STAES             --NILVTGLSPSAKATIIAEK----------YLKDHKQMLLVTNNLYQADKIETDILQYV
MFD_STAHJ             --NILVTGLSPSAKATIIAEK----------YLKDQKQMLLITNNLYQADKLETDILQYI
MFD_STAA8             --NTLVTGLSPSAKVTMIAEK----------YAQSNQQLLLITNNLYQADKLETDLLQFI
MFD_STAS1             --NVLVTGLSGAAKATIIAEK----------YLNSEQQLLVVTNNLYQADKLESDLLQFV
Q9CJI0_LACLA          -ERTLLTGLSGTAKSLVMANA----------YENVADKYIIVTDSQFHANELYDELSTLL
Q8DRQ1_STRR6          -KRQLILGLSTSTKALAIASS----------LEK-EDRIVLLTSTYGEAEGLVSDLISIL
Q97E98_CLOAB          -FPMELSGISESGKSYLISGL----------YEELDNPFLVITDSDSEAKKIYEDLLFYT
A5I7R4_CLOBH          -FPIGAYGLSDSGKNYFISNI----------FANVDESLVIFTHSDVEARKIYEDLSLYT
D3R0N9_MAGIU          GRHINVTGLSPTQKSYIVAAL----------TDHFSNRQDAATNSQAVKQKAGQVRGWTA
B8E2E1_DICTD          --RLKIFGIYKGIYPLFLLYL----------KRYEKPVLWITNNE--EDLNIWEDLQEDL
MFD_ECOLI             ELTGAACATLVA---EIAER--------------HAGPVVLIAPDMQNALRLHDEISQFT
MFD_HAEIN             NVLPGADALAIS---EISEQ--------------NQNLTVVVTPDTRSAVRLSRVLSELS
Q8EEV8_SHEON          CIAGVGQAVTLA---SLIRQ--------------HQGTTLIVTSDTPTALSLELELNYLL
Q9HZK3_PSEAE          NLPGAALSLAVA---EAASS--------------AKRFTLLLTADSQNAERLEQELRFFA
Q83CG9_COXBU          NLKGDSVSLAIS---TLAEK--------------NQGPLLLITPDVHSANYLHRSLPFFS
Q63T69_BURPS          GAHGSADALVIARYLAAHRA--------------QVPLLAVICANAVDAQRLAQELAYF-
Q7VZN3_BORPE          RPPGSGDGWLLA---DLARQ--------------AGKPLVVLTADPLEAQRLADEIPQF-
Q8P7B3_XANCP          RAPSSPTALAWSIARAAEAH--------------AGPVLVIARDNQSAHQIEADLHALLG
Q5NH30_FRATT          NAYGSAFSILFN---EYLKQ--------------NNQFNLIVTEDSQQAHKIYKELKYLN
MFD_RICFE             KFPATAKSFFATHNFTK----------------NLKQDFILSSSNEDEALQLYKQALFFS
MFD_RICCN             KFPAAAKSFFAIDNFTK----------------NLKQDFILSASNEEEALQLYKQALFFS
MFD_RICPR             KFPATAKCFYVIDNFTK----------------NLNQDFILSVSNEEEALQLYKQALFFS
MFD_RICTY             KFPATAKCFFAIDNFTK----------------HLNQDFILSVNNEEEALKLYKQAFFFS
MFD_RICBR             KFPQAAKSFFTIDSFIK----------------NSKQDFVLVTSNEEEALQLYKQALFFL
Q3YR59_EHRCJ          NIPHTFEPFVIIKMYAK----------------KLINSAIYIVDKETQLHDLASIFKFYI
Q2GLL6_ANAPZ          GIAPELEDALITEICRN----------------NPKKSFVCVLQDDKPLELLVKTLKFFD
A9CIN2_AGRFC          NVPSGMEALLLADMARA------------------GTSVAYVMSDGQRVADLEQILGFVA
Q89LE3_BRADU          NVAEGAEGLVISDLARAIAAR----------PKKPAVSLAVVCRDGARMQQLERALQFFA
Q9A782_CAUVC          GAPEGFDALVMADIARA-----------------RGGLTAFVARDTARAGAFIDALKFFA
Q2RTL9_RHORT          GLPEGFDALVLGELAAR----------------PGVPAVLHVARDDVRLARLAETIAFFH
Q3J2M4_RHOS4          GAPEGYDARLVAKELDR------------------GAPVIHVARDDKRLEAMRTALAVMA
MFD_HELPY             SLYRALNKG--------------------------FDYQILACKDFKESELAKEVISYFK
MFD_HELPJ             SLYRALNKG--------------------------FDYQILACKDFKESELAKEVISYFK
Q7M928_WOLSU          SLYHALKNP--------------------------FPYQILITQDDKESYLASEVARF--
Q0P9G9_CAMJE          SFYEYLQNP--------------------------KICELFLCKDEKQADLLAQVSRF--
A0A0H3P9Q7_CAMJJ      SFYEYLQNP--------------------------KICELLLCKDEKQADLLAQVSRF--
A7ZE35_CAMC1          KVYEYLLT---------------------------HAPQILICEDDKEAALCADAASF--
E0UPP9_SULAO          ILFNHFSKNETK-----------------------EEVELLLCEDAKEAYELENVAKF--
I0GL09_CALEA          FYLNFLKNERHVRINTSLTGV----------LYAVLNELDTPTLLITNEDNLDKLAKVFK
Q8RH90_FUSNN          WLKNKKNNLVYICSSNRNIDD----------YFFVLKDFYKGKILRIKKEN---------
MFD_BORBU             FFSLTGYEGFFKAFLIKKIKE----------YSKTGKIILIVKDEHTLDKIKNDLQVITN
F0S455_DESTD          KCYGLPGGSKGFILKEIKE---------------LISSFLFLVPSEVVAESIIEDLK--R
E1X1P6_HALMS          HITGLDSAQFSFIINECEKDT----------EFIKKNNFVFICDSVDHAENLYECFKVSK
MFD_SYNY3             RGHVQLSGLPRLPKGLIVSSL----------AQSLEKNLLVITATLEEAG-RWTAQLELM
Q8DKA7_THEEB          QRELVLTGMPRLVKGLVATTL----------AQESRQSLCVITSTLEEGG-RWAAQLELM
Q7NEP2_GLOVI          ALPVRLQGGNRVARGIAASAL----------ARRQGTPLLVVTANLEEAA-RWSAQLEAM
Q7VBU2_PROMA          KGKLSINGGSTSAKAITISSL----------ALKSNKPVLVIVPTLEEAS-RWNSIMQIL
Q8F395_LEPIN          EVVGSVYSVTTGSHSILASSL----------FQKLNQTILVVSENNTSAEFLFREALSFL
B5YL15_THEYD          ITSLIKTNNEIYNLSITSFSL----------FICFYKNNFIVFEENEDQAAKLYAAFKTF
A6GW35_FLAPJ          --KIHIKGLVGSSFSFVIEAL----------FAKSENSFLLLCNEKEEAAYILNDLEQLV
Q8AB59_BACTN          -QTIFCGGLCASSASLFSSVL----------VKQDVCPFVFVLGDLEEAGYFYHDLTQVL
Q2S6G5_SALRD          SPALHVNGAAGSLPAFLLYHL----------HREPGAPLCVLTPDEDAAAYLQSDLEQLV
Q8KEN4_CHLTE          FASIIKRPVDLVLDSLAASAP----------YRALREALSVATTGEHRAVDICGVRGSLA
O84753_CHLTR          -----VENLHSGARSFVIAKL----------FKELKRSIVVITT-LAKLDDLFEDLTTLL
M1WUP8_PSEP2          FKSGPATQAFVAVSLIAHQQ--------------SSVLIVPGAAEFKQAKALLSLFSTKK
Q72AT7_DESVH          TRSGMATAARLGNAVLDAGR--------------SAVMVVRDAEELALARGLLTLFSPDA
B9KVH0_RHOSK          MEPPIGLEVLRLLDLGIS-----------------KAAHLHITSDDARAEEIVRFLREIA
B0UM39_METS4          PALPDGALAEALLSLSAA-----------------ASPLVLVARDARRLDGIAAILRALA
Q1YKV9_AURMS          LHPIGVVAAMIARRVSDD-----------------RRPLIYIAETGRRRHDIFALASILA
E8TPS0_MESCW          VPPSSAIAAALAGGLEASR----------------HKHIIHITASERSADEIVGALRQFL
C6B9D3_RHILS          -----MVATRLVASLRRS-----------------ERSLCYVALSEGAATKIADAVSALF
A4YQE5_BRASO          DAPLGLVASHLLRLWQQPS----------------TRGVVFLSSDEARAERIAAVLHAMD
A5EAY9_BRASB          SSPLGMLALYLAAQWRASG----------------RDGVVFLAENESRAERLGSIIPVIE
D1B5L3_THEAS          ---------MIPRGIARAI----------------GYGRLPVPDRFVVILPGWSDVVTLS
Q9RU62_DEIRA          ------------MTLSATP----------------NLAKLLDPAPPGNLLLLPQVARMAL
Q5SJW3_THET8          -------------------------------------MEIALERIYGHRLALPQVGAALL
I0IIW6_PHYMF          VAVAGPTGVTTTLLAAAAALA-------------HPGPVLLVTAFEDQAQAATADLLNLA
                                                                                  

MFD_MYCBO             G----------------------------------DAVALLPSWETLPHERLSPG-----
MFD_MYCTU             G----------------------------------DAVALLPSWETLPHERLSPG-----
Q8NRS9_CORGL          G----------------------------------DKVAWLPSWETLPHERLSPG-----
Q9F2P1_STRCO          P---------------------------------PEGIVEYPSWETLPHERLSPR-----
Q8G5I7_BIFLO          DG-------------------------------DPNDIAQLEAWETLPHERLSPR-----
Q83N19_TROWT          P---------------------------------ESIILNFPEWDTLLHEQISPS-----
MFD_MYXXA             GGQGSL---------------------------LAPRVLRLPADEVLPYDEVSPD-----
Q74H75_GEOSL          GRPG--------------------------------DILLFPAWDTSPFEKASPH-----
Q1IHV1_KORVE          ELTGTA---------------------------HADAVVMLPAYDVLPYENLSPH-----
Q2RMB9_MOOTA          PGEG---------------------------------IDYLPPSELLPLEVYTPS-----
A9WHG9_CHLAA          GSDQ---------------------------------VWLFPPADALPYEQMSPG-----
I0IRW8_LEPFC          ALFPE-----------------------------APDGLLLPEEEILPYEEESPP-----
MFD_BACSU             ED---------------------------------RSVLLYPVNELISSEIAVAS-----
Q8YAD0_LISMO          DV---------------------------------DRLFLYPADELISSELSISS-----
Q839B9_ENTFA          PS---------------------------------EQVHLFPVDEVLSAEMAFSS-----
F9UL13_LACPL          DE---------------------------------DQVFLFPAEEMIATEVATSS-----
MFD_STAEQ             DD---------------------------------SEVYKYPVQDIMTEEFSTQS-----
MFD_STAES             DD---------------------------------SEVYKYPVQDIMTEEFSTQS-----
MFD_STAHJ             DH---------------------------------SEVYKYPVQDIMTEEFSTQS-----
MFD_STAA8             DA---------------------------------EELYKYPVQDIMTEEFSTQS-----
MFD_STAS1             ED---------------------------------SEIYKYPMQDIMTEEFSTQS-----
Q9CJI0_LACLA          GE---------------------------------EKVFQFFSDDNIYAEFALAS-----
Q8DRQ1_STRR6          GE---------------------------------ELVYPFLVDDAPMVEFLMSS-----
Q97E98_CLOAB          -----------------------------------QSVYYLPTKEVVFYNIYAVS-----
A5I7R4_CLOBH          -----------------------------------TEVYYLPTKEVVFYNIYAIS-----
D3R0N9_MAGIU          ERGEETSRNLGAAMCLIEPDELQIRETQAALQPLLPDLQILRPREINLINADAGS-----
B8E2E1_DICTD          EI------------------------------------SILPSYVHLPYERPLRS-----
MFD_ECOLI             -D------------------------------QM---VMNLADWETLPYDSFSPH-----
MFD_HAEIN             -S------------------------------QD---VCLFPDWETLPYDTFSPH-----
Q8EEV8_SHEON          -A------------------------------KTAIKVRLFPDRETLPYDSFSPH-----
Q9HZK3_PSEAE          -P------------------------------DLP--VLHFPDWETLPYDVFSPH-----
Q83CG9_COXBU          -S------------------------------ADT-PILHFPDWETLPYDYFSPH-----
Q63T69_BURPS          --------------------------------APDARVRVLPDWETLPYDTFSPH-----
Q7VZN3_BORPE          --------------------------------APELRVRQLPDWETLPYDAFSPH-----
Q8P7B3_XANCP          -D------------------------------ASALPVVPFPDWETLPYDQFSPH-----
Q5NH30_FRATT          KN------------------------------NSKVDILFFPNLEILPYDRFSAS-----
MFD_RICFE             ---------------------------------SNENIYYFPSYDTIPYDHTSPN-----
MFD_RICCN             ---------------------------------SNENIYYFPSYNTIPYDHTSPN-----
MFD_RICPR             ---------------------------------SNDNIYYFPSYDTIPYDHTSPN-----
MFD_RICTY             ---------------------------------SNENIYYFPSYDTIPYDYTSPN-----
MFD_RICBR             ---------------------------------PSENIYYFPSYDTIPYDHTSPN-----
Q3YR59_EHRCJ          ---------------------------------PSLEVITFPAWNAIPYKKNSPH-----
Q2GLL6_ANAPZ          ---------------------------------STHNILLFPAWDTCTYKHTSPS-----
A9CIN2_AGRFC          ---------------------------------PDIPVLTLPAWDCLPYDRVSPS-----
Q89LE3_BRADU          ---------------------------------PDLPVLTFPAWDCQPYDRVSPH-----
Q9A782_CAUVC          ---------------------------------PEIEAVLFPSWDCLPYDRIGPS-----
Q2RTL9_RHORT          ---------------------------------PAVEILEFPAWDCVPYDRVSPN-----
Q3J2M4_RHOS4          ---------------------------------PRAVVLELPAWDCLPYDRVSPN-----
MFD_HELPY             ---------------------------------PNTKAILFPEFRAKKNDDLRSF-----
MFD_HELPJ             ---------------------------------PNIKAVLFPELRAKKNDDLRSF-----
Q7M928_WOLSU          ---------------------------------RGFETILFPDFRAQKGDDLRSY-----
Q0P9G9_CAMJE          ---------------------------------KGLKTFVLPDFRAQFGDDLRAF-----
A0A0H3P9Q7_CAMJJ      ---------------------------------KGLKTFVLPDFRAQFGDDLRAF-----
A7ZE35_CAMC1          ---------------------------------AGFSAFKLPDFRAKKGDDLRSF-----
E0UPP9_SULAO          ---------------------------------FQHDVIVFPDFRPSYGDDLRSY-----
I0GL09_CALEA          ---------------------------------NNIVFNEFGLFPYEVGFSSKEI-----
Q8RH90_FUSNN          --------------------------------------------------EAREL-----
MFD_BORBU             ---------------------------------QIFELNYFSPLVYKGIGSKSTI-----
F0S455_DESTD          ---------------------------------FGLRVIYLPAWDVPPLDISSPL-----
E1X1P6_HALMS          ---------------------------------ISKKLLFYPGHDLSPYSGAMTS-----
MFD_SYNY3             GW---------------------------------QTVNFYPTSEASPYDPGRLE-----
Q8DKA7_THEEB          GW---------------------------------DAVFFYPTSEASPYDLFDLE-----
Q7NEP2_GLOVI          GW---------------------------------GSVYLYPSSEATPYEPFDPE-----
Q7VBU2_PROMA          GW---------------------------------NKVLLYPSSEVSPYESIEIS-----
Q8F395_LEPIN          PS---------------------------------NDLIYLPGQEVLPYEYMRYP-----
B5YL15_THEYD          ------------------------------------------SSFFNTTDEIVFL-----
A6GW35_FLAPJ          S---------------------------------DQDVLFYPSSYRRPYQIED------T
Q8AB59_BACTN          G---------------------------------TEKVFFFPSSFRRSIKYGQ------K
Q2S6G5_SALRD          GE-------------------------------PDEAILRVPATQKTPYDPDQI-----A
Q8KEN4_CHLTE          PFIAAKLFRD----------------------FDAPVVLFCNADEQELYDNDLPLLLGGK
O84753_CHLTR          A----------------------------------ESPLEFPASEIDLSPKLV-------
M1WUP8_PSEP2          TDE--------------------------------IRPTWEEEWITFPPYNPRQP-----
Q72AT7_DESVH          SAGDS----------------------------PLVKPRWESRWVVMPQHPLGAR-----
B9KVH0_RHOSK          PT---------------------------------LRPGLFPCWDCLPYDGASPT-----
B0UM39_METS4          PG---------------------------------LGVAVYPAWDCLPGDRTSPS-----
Q1YKV9_AURMS          GP---------------------------------GTVCELDAPDGFPGDGLPVT-----
E8TPS0_MESCW          PH---------------------------------AEIILLPSWDCLPYDRVWPT-----
C6B9D3_RHILS          PD---------------------------------IEIIVLPPWDCLPYDRVPPS-----
A4YQE5_BRASO          PD---------------------------------CGVLVLPRFDTVPFDDAAPS-----
A5EAY9_BRASB          PA---------------------------------CDVLVYPRLNTLPFDQLEPS-----
D1B5L3_THEAS          SD---------------------------------LACLGREVSPLLPPVPLGVK-----
Q9RU62_DEIRA          FA---------------------------------AFPGPAVLLTTPDRVANYAT-----
Q5SJW3_THET8          FA---------------------------------QEAPPALLLVPEARLRRYRD-----
I0IIW6_PHYMF          RGSDE----------------------------SGIGGAGDTHLVVAPFDALGPRDLLGA
                                                                                  

MFD_MYCBO             -VDTVGTRLMALRRLAHP-----------------------DDAQLGPPLGVVVTSVRSL
MFD_MYCTU             -VDTVGTRLMALRRLAHP-----------------------DDAQLGPPLGVVVTSVRSL
Q8NRS9_CORGL          -VDIVGKRAQVLNHLGD--------------------------------LKVVVAAARAF
Q9F2P1_STRCO          -SDTVGRRLAVLRRLAHPR----------------------PDDPETGPVSVVVAPVRSV
Q8G5I7_BIFLO          -ADTVASRMAVFRRLKHPS----------------------DTDSMFGPIRILVMPIRSL
Q83N19_TROWT          -PERVSARMEALHKISLFRKNNKRAKNAQTSKTLHDIGILEDNLPTIHQKLVVVASIKAF
MFD_MYXXA             -AAAVTERLGALFHLGQGTR----------------------------FPALVLSVRALH
Q74H75_GEOSL          -ADVTAQRLAVLRRLAD-RR----------------------------AAAVVTTPEALR
Q1IHV1_KORVE          -PEIQEARAAALWKIVS-GT----------------------------ARFVIAPFVATA
Q2RMB9_MOOTA          -PELAAQRLKVLTNLVSGR-----------------------------TRILVVPVEDLL
A9WHG9_CHLAA          -RDVLARRLAVLRGLQTGSF----------------------------SGVIVTSVKALM
I0IRW8_LEPFC          -DLLRAERISVLSELSR-RP----------------------------VSFVVSTFPAIA
MFD_BACSU             -PELRAQRLDVINRLTNGEA-----------------------------PIVVAPVAAIR
Q8YAD0_LISMO          -PELRGQRVEALDFLLSGKP-----------------------------GIVIVPVAGLR
Q839B9_ENTFA          -PEARADRVSALNFLMTANA-----------------------------GIVVVPVAGLR
F9UL13_LACPL          -PESRAQRVQALNALLRDSP-----------------------------AVVVTSVAGAR
MFD_STAEQ             -PQLMSERVRTLTALAQGEK-----------------------------GLFIVPLNGFK
MFD_STAES             -PQLMSERVRTLTALAQGEK-----------------------------GLFIVPLNGFK
MFD_STAHJ             -PQLMSERVRTLTALAHNKK-----------------------------GLFIVPLNGLK
MFD_STAA8             -PQLMSERIRTLTALAQGKK-----------------------------GLFIVPLNGLK
MFD_STAS1             -PQFMSERVRTLTALAQEER-----------------------------GLFIVPLNGLK
Q9CJI0_LACLA          -KDRVAYRLEALNFLLDEKST----------------------------GFLVVPFLALR
Q8DRQ1_STRR6          -QEKIISRVEALRFLTDSSKK----------------------------GILVCNIAASR
Q97E98_CLOAB          -GDLRWERLKVIRKMMSRGK-----------------------------KIIVTSVENLA
A5I7R4_CLOBH          -GDLRWERLKVINEILSPKK-----------------------------KIIVTCIESLE
D3R0N9_MAGIU          -RRQEQDRLLTLAGLLTGRV-----------------------------RHVLISATALL
B8E2E1_DICTD          -PQIQGKRLRAISNIIYDKN-----------------------------FSIIASLKSLI
MFD_ECOLI             -QDIISSRLSTLYQLPTM-----------------------------QRGVLIVPVNTLM
MFD_HAEIN             -QEIISSRLSALFHLQNA-----------------------------KKGIFLLPISTLM
Q8EEV8_SHEON          -QDLISQRLETLSQITHA-----------------------------EHSVVIVPVTTLM
Q9HZK3_PSEAE          -QDIISQRIAALYQLPQL-----------------------------KHGVLVVPISTAL
Q83CG9_COXBU          -EDIISERLLTLYRLPRL-----------------------------SSGIIISALPTLL
Q63T69_BURPS          -QDLVSERLATLHDLGEG-----------------------------RCDILLVPATTAL
Q7VZN3_BORPE          -QDLISQRLRTLHALMNQ-----------------------------GVDILTVPVTTAL
Q8P7B3_XANCP          -PEIISQRLAALHRLPGL-----------------------------TRGVVTVPVQTLL
Q5NH30_FRATT          -IDIISRRQEILYKMTHQP----------------------------QKTLIITSISNTL
MFD_RICFE             -ANILSRRAEILTKLTTNNS--------------------------NG-KLLITYAANLL
MFD_RICCN             -ANILSRRAETLIKLTTNNS--------------------------NSNKLLITHTANLL
MFD_RICPR             -ANIVSRRAETLTKLITN----------------------------SKGKLLITHAANLL
MFD_RICTY             -TNIISRRAETLTKLITN----------------------------NNSKLLITHAANLL
MFD_RICBR             -CNILSKRAETLSKLTTN----------------------------KGNKLVITHATNLL
Q3YR59_EHRCJ          -NSVMAERIKVLYSLTTKCN--------------------------NTPYIILSTTNAIM
Q2GLL6_ANAPZ          -SYVMTHRVKCLLDLLSVGS--------------------------K-PYILLTTISALI
A9CIN2_AGRFC          -ADTSARRLAALAGLINHAK-------------------------KPHPAVVLVTVNAML
Q89LE3_BRADU          -GGILAQRLTTLARLAPLTG-------------------------SDKPLIVLTTVNAIV
Q9A782_CAUVC          -SGVSATRMATLSRLARGLG-------------------------ESKAAILVIAAPALL
Q2RTL9_RHORT          -VEIVARRLETLSRLSEEPTR------------------------QPGGRLVLTTASAIL
Q3J2M4_RHOS4          -PEISARRMATLAALAHGMP---------------------------GAFVLLTTLNAAT
MFD_HELPY             -FEEFLQLLGGLREFYQALE-------------------------NKQETIIIAPISALL
MFD_HELPJ             -FEEFLQLLGGLREFYQALE-------------------------NKQETIIIAPISALL
Q7M928_WOLSU          -KEELLALLGALRKWYRAP---------------------------KERLLLIAPLRSLL
Q0P9G9_CAMJE          -SKELFDLCKILNAYHKEE----------------------------EKKILISPLNTVL
A0A0H3P9Q7_CAMJJ      -SKELFDLCKILNAYHKEE----------------------------EKKILISPLNTVL
A7ZE35_CAMC1          -NEELFEISSVLSKYYKFD----------------------------GKKIIVSPFSTLL
E0UPP9_SULAO          -KEELHELFFALRTYHSAQ----------------------------KKPLIISPLKTLL
I0GL09_CALEA          -IFKKKKAIKSIKNTK----------------------------------ILITTLKGIF
Q8RH90_FUSNN          -KKYNYDLLELINSNE----------------------------------KFIILISLDY
MFD_BORBU             -FNERIKFLFNFYKKNP--------------------------------GIYITVLKSLL
F0S455_DESTD          -SLYQYRRLKSLYQLLS--E---------------------------PFNVLLLTPHSLF
E1X1P6_HALMS          -ERALFERFKVLNFLANNNE---------------------------ETFILISTFESFS
MFD_SYNY3             -SEMVWGQMQVLAELIQGHQ--------------------------VKGKAIVATEKALQ
Q8DKA7_THEEB          -GEMVWGQLQVLVE----SD--------------------------RPNIAIVTTERALQ
Q7NEP2_GLOVI          -EEVTWGQLQVLAELTG-RS--------------------------SAHWAIVCTSRALH
Q7VBU2_PROMA          -KEIEWAQLSVLSELLANDY--------------------------RDPMAIICTERALQ
Q8F395_LEPIN          -SEMKRERIKAIAKILS-----------------------------GEPVLIFTSVSGFL
B5YL15_THEYD          -PSKGTERMIAIFKILN-----------------------------------ERNKKIIT
A6GW35_FLAPJ          DNANVLLRSEVLNRLNSRKK----------------------------PAIIVSYPEAIF
Q8AB59_BACTN          DAANEILRTEVLSRLQKGEE----------------------------GLCIVTYPDALA
Q2S6G5_SALRD          DSTPLIERADALQRLAEGFE----------------------------GILVTSVP-AVG
Q8KEN4_CHLTE          PFRNTADELSPALGMLSRRE----------------------------TLVVLAAFEDLS
O84753_CHLTR          NGDAVGKRDHILYSLQKQSA----------------------------PVICVTTLKALS
M1WUP8_PSEP2          DAQSWSERWAALYALTYGKK----------------------------PCGVLMTVDNLL
Q72AT7_DESVH          NRDAWASRMAALFALGQKRV----------------------------PQGVLITVDNFL
B9KVH0_RHOSK          -PDAMGRRMALLDAVRARDV----------------------------RLVIVGPS-GLL
B0UM39_METS4          -RGAMGARAGVLRWLSEPAP----------------------------PAIVLTTAPALI
Q1YKV9_AURMS          -VATAGNRMAMLRWLLDEEKR---------------------------PSVLITTPAALI
E8TPS0_MESCW          -RANMGRRLRALCHMATKPDR---------------------------ARIAVMSIEASL
C6B9D3_RHILS          -QRCMGLRMDALRIWSMPSDA---------------------------PRLFLTSLDATL
A4YQE5_BRASO          -RELSGRRAHVLRRLAEHAR----------------------------HPLLISTVEAVL
A5EAY9_BRASB          -RDIAGRRSSVLRRLAGTKK----------------------------PILLITTAEAMM
D1B5L3_THEAS          -EGVQAHLLHRGRVLEDWIRL---------------------------GGGLITSAAGAV
Q9RU62_DEIRA          -AAALGAPVSINPGLREWETR---------------------------AEHVVLDVNTAL
Q5SJW3_THET8          -LSAFGAKVYVNPGLEALEEK---------------------------A-LFVLSYEEAL
I0IIW6_PHYMF          RAEGPLVRRVVLAATLDHGATGRQD--------------AEGLAANAGRWVIVASVAALL
                                                                                  

MFD_MYCBO             LQPMTPQLGMMEPLTLTVGDESPFDGVVARLVELAYTRVD-MVGRRGEFAVRGGILDIFA
MFD_MYCTU             LQPMTPQLGMMEPLTLTVGDESPFDGVVARLVELAYTRVD-MVGRRGEFAVRGGILDIFA
Q8NRS9_CORGL          CQPVLKDAEGRAPLTLKEGAEFDFSALTTELVFRAYKHVD-MVAKRGEFATRGGILDIFP
Q9F2P1_STRCO          LQPQVKGLGDLEPVALRTGQGADLEEIVQALAAAAYARVE-LVEKRGEFAVRGGILDVFP
Q8G5I7_BIFLO          IQPVVQGLGDVEPLVFTVGEDLPLDEAAKRLIENAYTRVD-LVMDRGEFAVRGGILDVFP
Q83N19_TROWT          MQPIISD-GNPPCLYFHTGGEYELSEIANILVAMSYSRTD-LVGARGEFAIRGGILDIYP
MFD_MYXXA             RKVLPLAVMRALAARVAVGQDFDRDSLARRLVRMGYQNSP-LVEDVGTFSVRGDLLDVFS
Q74H75_GEOSL          QRVVPRSLLDSASLYFLPGEESDRDDLLSRLVTLGYLNVP-LVEDRGTFAVRGGIVDIFP
Q1IHV1_KORVE          MHYRPAEFYFDLTKVINRGNSIDSDELRAHLNTSGYSTVD-VVEMPGEYALRGGILDIYP
Q2RMB9_MOOTA          RKLPPPDTLRHSLQSLEVGQIIDREALLQKLTGLGYRREE-VVEAPGQLAVRGGIIDIFP
A9WHG9_CHLAA          QPTLPPSDLANATIRLQRGMQVSIEETVVTLLDNGYQRVA-MVEEPGELSRRGAILDVWP
I0IRW8_LEPFC          RKTLPKRLLSGGLSEITLGTLVDRQELIQSLVALGFFRVP-QVTAPGEFSVRGAILDLYT
MFD_BACSU             RMLPPVEVWKSSQMLIQVGHDIEPDQLASRLVEVGYERSD-MVSAPGEFSIRGGIIDIYP
Q8YAD0_LISMO          KMLPPVSLWKHFNISIVEGEEIDPDVLRQKLVTMGYTMSG-MVNTPGEFSVRGGIIDIYP
Q839B9_ENTFA          KYLPTKETWQNAQLYWEIGTEVEPEILAQRLVLMGYERQA-MVGKPGEFSIRGSIVDVYP
F9UL13_LACPL          RFLPPVAQFQAATLPVAVGQDIDLEDLQRQLHDMGYVKEK-LVARPGDFAVRGSIVDIYP
MFD_STAEQ             KWLTPVDLWKDHQMTLKVGQDIDVDAFLNKLVNMGYRRES-VVSHIGEFSLRGGIIDIYP
MFD_STAES             KWLTPVDLWKDHQMTLKVGQDIDVDAFLNKLVNMGYRRES-VVSHIGEFSLRGGIIDIYP
MFD_STAHJ             KWLTPFELWKDHQITLRVGEDIDVDEFLNKLVNMGYRRES-VVSHIGEFSLRGGIIDIYP
MFD_STAA8             KWLTPVEMWQNHQMTLRVGEDIDVDQFLNKLVNMGYKRES-VVSHIGEFSLRGGIIDIFP
MFD_STAS1             KWLTPVDMWKSHQLTLNVGDDIDIDEFLNKLVNMGYRRES-VVSHIGEFSLRGGIVDIYP
Q9CJI0_LACLA          SYLPSPENFLENYLLLTSGDEYDLSNLVNLLSKAGYEKTQ-RVMTPGEFSMRGDIVDIYP
Q8DRQ1_STRR6          LILPSPNAFKDSIVKISVGEEYDQHAFIHQLKENGYRKVT-QVQTQGEFSLRGDILDIFE
Q97E98_CLOAB          AVYLPVELYKEYTFKLTLGDTVEAKELQKKLVQCGYEHVE-SVDAKGQFSIRGGIVDIYS
A5I7R4_CLOBH          SAYIPKELYTKYTFKLSVGDIIEIKLLEEKLIKSGYERVD-IVENKGEFSARGGIIDIYP
D3R0N9_MAGIU          QRLPDPDFLRRHLLILQGTERIQPETLEHFLLAAGYEKVS-QAEAFGQFSRRGDIVDVVP
B8E2E1_DICTD          YPIIPKDVLKERIIKIRIGEEIAREKIEKYLAENFYQRLP-QVEKIGDYSIRGGILDIFS
MFD_ECOLI             QRVCPHSFLHGHALVMKKGQRLSRDALRTQLDSAGYRHVD-QVMEHGEYATRGALLDLFP
MFD_HAEIN             QRLCPPQYLQHNVLLIKKGDRLVIDKMRLQLEAAGYRAVE-QVLEHGEYAVRGALLDLFP
Q8EEV8_SHEON          MRLPPKSYLSSNVFVLKKGDKYQLHDVRQQLTDTGYHLVE-QVYEHGEFAIRGSILDIFP
Q9HZK3_PSEAE          HRLAPTRFLLGSSLVLDVGQKLDVERMRLRLEGAGYRCVD-TVYEHGEFAVRGALIDLFP
Q83CG9_COXBU          QRLPPADHLEKNTFILSVGEKFSLQENRERLISAGYRSVQ-QVMEHGEYAQRGSIIDIYP
Q63T69_BURPS          YRMPPASFLAAYTFSFTQGERLDEAKLKAQLTLAGYEHVS-QVVRPGEYCVRGSLIDLFP
Q7VZN3_BORPE          YRLAPPAFLAAYTFSFKQKDRLDEAALRAQLTLANYSHVT-QVTAPGEFCLRGGLIDLFP
Q8P7B3_XANCP          QQLAPLSYIVGGSFDLTVGQRLDLDAEKRCLESAGYRNVP-QVMDPGDFAVRGGLLDVFP
Q5NH30_FRATT          RKIAPASFIQKHSFILKTGDNLDITKYKMLLTEAGYTLVN-NVFEKGEFSIRGSIIDIYP
MFD_RICFE             NKLPPKDFFSKYFLKLSPKMKFTTDELAMFLVENSFTRNA-SSIDVGEFAVRGEIIDIIL
MFD_RICCN             NKLPPKDFFSKYFLKLSPKMKFTTDELAMFLVENSFTRNA-SSIDVGEFAVRGEIIDIIL
MFD_RICPR             NKLPPKDFFSKYFLKLYPKIKFTMDELSMLLVENSFTRNT-SSIDVGEFAVRGEIIDIIL
MFD_RICTY             NKLPPKDFFSKYFLKLYPKIKFTIDELSMLLVENSFTRNI-SSNDVGEFSVRGEIIDIIL
MFD_RICBR             NKLPPKDFFAKYYLKLFPKMKLSANELSKFLVENSFTRNA-STVDVGEFAVRGEIVDLIL
Q3YR59_EHRCJ          QKVLPQNIILQSVLKITLQQNITKHDIEYYLTHYGYNQYS-IVQDTGEFAILNNSIDIFP
Q2GLL6_ANAPZ          QKVLPKNAVSSSTLHIEAGKSLSMDELTLHLIEHGYVKSSTVVQEVGSFAVRGDIVDIFQ
A9CIN2_AGRFC          QKMAPRDVIESLGFSARPGNQIRMEDIAARLERNGFDRVA-TVREVGEFAVRGGILDVFV
Q89LE3_BRADU          QRVPARELVAAQALSVAPGNVVPMDTIIAWLEHNGYNRSS-TVREPGEYAVRGGILDLFP
Q9A782_CAUVC          QRVPTKEVLLRASYAAKVGANVDIKDLERYFAVNGYTRAS-TVSERGEFAIRGGVIDVYP
Q2RTL9_RHORT          QRVPPRQILERGVFSARVGGRLDLGKLLDHLARHGYGRSE-QVMEPGEYAVRGGIVDIFP
Q3J2M4_RHOS4          QRIPAREVLRAASFSARVGDRVDEGRLRSYLARMGFSLTD-TVTEPGDYAIRGGIVDIYP
MFD_HELPY             HPLPKKELLESFKITL--LEKYNLKDLKDKLFYYGYEILD-LVEVEGEASFRGDIVDIYA
MFD_HELPJ             HPLPKKELLESFKITL--LEKYNLKDLKDKLFYYGYEILD-LVEVEGEASFRGDIVDIYI
Q7M928_WOLSU          HPLPKEELLQSFHLGF--GDNLDIGELKERFYRFGYEFVE-IIELPGEVSFRGDIIDVFP
Q0P9G9_CAMJE          KKLPSKKHLQNYHIDK--KQNFDLKCFEDEISRLGYEFVD-IVQDKGEISIRADIIDIFC
A0A0H3P9Q7_CAMJJ      KKLPSKKHLQNYHIDK--KQNFDLKCFEDEISRLGYEFVD-IVQDKGEISIRADIIDIFC
A7ZE35_CAMC1          NPLPTQKNLESSTIKL--KDNLNLNEFADLLIRFGYECVD-IVESVGEFSIRGEVVDIYG
E0UPP9_SULAO          FHLPKKELLGTTTLEF--GAEINLKEFKQLMIHWGYTFVD-MVQVEGEISHRGDIIDIFV
I0GL09_CALEA          DYAP--SENTIKELTIKLNNTVTLTNLTTTLVDFGFERSA-EVEHPGEFSVKGAIIDIFP
Q8RH90_FUSNN          FLED--YYSEANSIFIEKGKNLNIKDLEEKLIDADFEKTY-MVAQRKEYSIRGDILDIFN
MFD_BORBU             SKIPDKNTLLKNIYKIEKNTNINTADIEKTLITLGYEKTL-RVTIPGEFTVKGEIIDIYP
F0S455_DESTD          QKVILPENLIEYVIEIEKGKEIDYSLIPKKLTTLGYKRVD-SEPEEGEFSIKGDTLELVS
E1X1P6_HALMS          MRVPPRSFFKEYNFKIETSDIISPDELARKLVSLGYSSSP-SIEEPGTFSSKGEIFDIYT
MFD_SYNY3             PHLPPVATLREYCLALRRGQEMDSKSLELTLARLGYERGS-TVETEGQWSRRGDIVDIFP
Q8DKA7_THEEB          PHLPPPEQFRAACLTLQVGQAYSLGEVATTLAALGYERVS-LVETEGQWSRRGDIVDIFP
Q7NEP2_GLOVI          PHLPPPEYLAEYCLSLEAGAGLSIEKLTGELVRLGYLRVP-QVEAEGQFSRRGDILDFFP
Q7VBU2_PROMA          PHLPRPELMLENSVSIIKGNELNLDNLSRNLIKIGYEKTT-TTEQEGTWSRRGDIIDIFA
Q8F395_LEPIN          KTLPPIQTMQGRAIVLKKGKEIDLESLLIQLIDLGYKRVQ-VCETFGEFSLKGGILDIFS
B5YL15_THEYD          TVDSAKIPPHIETINIKKGGTIEREFLAKNLINLGYSKVE-LVTQEGEFSEHGWVFDIWG
A6GW35_FLAPJ          EKVVTKKELDKNTLKISVGDLVSIDFINEVLFEYEFKRVD-FITEPGEFSVRGGILDVFS
Q8AB59_BACTN          EKVVSRKELSDKTLKLNVGEKLDTTFITDVLHSYGFEYVD-YVYEPGQYAVRGSIIDVFS
Q2S6G5_SALRD          ELVPPPQAVQRETLTVENGEEIALEALADRLLEQDFSPVE-FVEEPGEFARRGGILDVFP
Q8KEN4_CHLTE          IEVCGTESSNERLFSLAAGSDAGYDALMQFLKSNGFEKRE-FVENEGEFSVRGSIIDVFC
O84753_CHLTR          ERTPSPESMIRDHLELRVGEELDPDTLLDLCKSLGYRHEA-LAREKGDFAFRGGIVDIFP
M1WUP8_PSEP2          PHWPDKSVLQENWVALSKGEEMSPELLLEQLISWGYVRRK-LVSGAGDIAMRGDILDIQA
Q72AT7_DESVH          SKLPPADLFASHELTLACGDEMAPELVLEQAVDWGFDRVQ-MVSRPGEIAVRGDIVDIYP
B9KVH0_RHOSK          QRVPPVE--AMRRFAVRAGETLDLGALRSFAARAGYVEDD-RIDEPGEIAFRAEVVEVFA
B0UM39_METS4          QRVPPPETWAQARVLLRVGEQVEAEALEAALTRLGYIPDE-RVDEPGEIALRGRTFEVFP
Q1YKV9_AURMS          RKVPPKSVWEGLHSEIRVGETLDQTALQAKLQHLGYWLDD-RVDEPGEAAFRGKVLEIFP
E8TPS0_MESCW          QRVPPAQVIAGGFAILEVGQKFDRDDFRTRSEAFGYVVDE-RVDEPGEIAFRGDLMDIFP
C6B9D3_RHILS          QRIPPATVIANSRLELVVGKAFDRDAFSDFIQRTGYVEEG-VADDPGELAVREGVIDIYP
A4YQE5_BRASO          PLVPPQRCWTAASLHLKAGQPIDLEGFRNSLAKLGYATDE-PPDDPGSVLFHGQTTELFP
A5EAY9_BRASB          ELLPLPTNWSRIGFQLRTGAIYSEADLEARLKALGYDLDD-SPDYPGGVLFHGNTFEIFP
D1B5L3_THEAS          LPALSPS----GHFQLRKGDRC-RSSLIHWISSQGYERVP-VVWAPGQWALRGALVDLFP
Q9RU62_DEIRA          DLFPARP--EDHALSLRVGASYPREELLARLERFGYERGR-FEDRETDEPGFDLRGDTLE
Q5SJW3_THET8          SPFPEDP--EAWRLLLEVGRAYPREALLSRLLKLGYAR----------DEDYRVLGEVVE
I0IIW6_PHYMF          QAVPTEAVVAGAVRRIHPGDAVDLPALVGLLEATGHRAARAEAVAAGTFHAGGSTLRFRP
                                                         .                        

MFD_MYCBO             PTAEHP-----VRVEFWGDEITEMRMFSVADQRSIPEIDIHTLVAFACRELLLSEDVRAR
MFD_MYCTU             PTAEHP-----VRVEFWGDEITEMRMFSVADQRSIPEIDIHTLVAFACRELLLSEDVRAR
Q8NRS9_CORGL          TTLDYP-----VRVEFWGDEVSDIRQFSVADQRTIPEITIKSIEIFPARELLITEEVASR
Q9F2P1_STRCO          PTEEHP-----LRVEFWGDDVEEIRYFKVADQR-SLEVAEHGLWAPPCRELLLTDDVRER
Q8G5I7_BIFLO          PTAPHP-----VRIEFFGDEIDTIKEFHASDQR-TYGDGLKTIWATACRELQLTDAVRTR
Q83N19_TROWT          PTEKHP-----IRIEFFGRQLESMRHFRVSDQRSIGPYVSNNAHVGMFAQYQDNSVCKCN
MFD_MYXXA             PLYDKP-----VRLEFFGDTIESIRAFDPQSQRT--VDALKEVDLVPAREVLLTDETRPR
Q74H75_GEOSL          PGFDLP-----VRIEFFGDFVDTIRSFEPLSQRS--LQPLEELLLLPSRELLLTADTLQG
Q1IHV1_KORVE          PESEHP-----VRIELFGDEVESIRKFDTETQRS--AGATDEVVLLPLSDTPVREDILGS
Q2RMB9_MOOTA          LGAEEP-----VRLELFGDEIDSLRRFDPVSQRS--VADLRAIVVGPAQEVLPPPDLGPG
A9WHG9_CHLAA          PGDELP-----LRIEWFDDEIDSLRRFDPATQRS--EQRLERADIGPPHEIP----FWRR
I0IRW8_LEPFC          PSRPEP-----VRLEFTDDELTSMRGFDPNTQRS--MGSIEKLDLAPSHEWLPPINRSHF
MFD_BACSU             LTSEN-----PVRIELFDTEVDSIRSFNSDDQRS--IETLTSINIGPAKELIIRPEEKAR
Q8YAD0_LISMO          ITEEF-----PIRIELFDTEVDSLRFFDVETQRS--TTRVEEFRLLPATEIILDQSYYPD
Q839B9_ENTFA          LNAEY-----PVRVELFDVEIDSIRYFEADTQRS--LENLEEVTISPMTDLVFSKADMNH
F9UL13_LACPL          LDADY-----PLRLDFFDTEVDTLKYFDPETQRS--VENLDEYTILPATDFILTSAMLQA
MFD_STAEQ             LIGT------PVRIELFDTEVDSIRDFDVETQRS--NDNINQVEITTASDYIITDEVIQH
MFD_STAES             LIGT------PVRIELFDTEVDSIRDFDVETQRS--NDNINQVEITTASDYIITDEVIQH
MFD_STAHJ             LIGQ------PVRIELFDTEVDSIRDFDVETQRS--NDNIEEVSITTASDYVITDDVIQH
MFD_STAA8             LIGE------PIRIELFDTEIDSIRDFDVETQRS--KDNVEEVDITTASDYIITEEVISH
MFD_STAS1             LIGK------PVRIEFFDTEVDSIRDFDVESQRS--EGNIEHVDITTASDYIITEDVLKH
Q9CJI0_LACLA          LDAEN-----PVRLEFFGDEVDTIRSFDVESQRS--LTSLERLEIYPASDFILTDKEFDK
Q8DRQ1_STRR6          ISQLE-----PCRIEFFGDEIDGIRSFEVETQLS--KENKTELTIFPASDMLLREKDYQR
Q97E98_CLOAB          PIDDV-----PYRIEFFGDEIESIRSFNTESQRS--IEKVNKIEVFPAKEIILTDEALNK
A5I7R4_CLOBH          PISSE-----PYRLEFFDDEIDSIRNFNVNSQRS--IEKVNNINIFPAKEIILEEENISL
D3R0N9_MAGIU          PDLRQSKPDCGLRISFFDDEIDSFTYYSLISQRS--VGNCRKSVLISPVKEVLLDVDRLD
B8E2E1_DICTD          PIYEN-----PIRIEFFGDEITSIRFFNLEDKRS--IETTKEVFITPISELIANKDE---
MFD_ECOLI             MGSELP-----YRLDFFDDEIDSLRVFDVDSQRT--LEEVEAINLLPAHEFPTDK-----
MFD_HAEIN             MGSAVP-----FRLDFFDDEIDSIRTFDVDTQRT--LDEISSINLLPAHEFPTDD-----
Q8EEV8_SHEON          TGVNMP-----LRIELFDDEVETIRHFDPETQRS--STPVNAVRLLPAKEFPTDS-----
Q9HZK3_PSEAE          MGSELP-----FRIDLFDDEIETLRTFDPETQRS--IDKVESIRLLPAREFPLNK-----
Q83CG9_COXBU          MGSPLP-----YRIELFDDEVTSIRSFDPESQRS--VEKIESVRLLPAREYPLTK-----
Q63T69_BURPS          MGSPLP-----YRIDLFDDQVDSIRAFDPDTQRS--LYPVRDVRLLPGREFPFDE-----
Q7VZN3_BORPE          MGSVVP-----YRLDLFDDEIESIRSFDVDTQRS--LYPVGEVQLLPGREFPMDE-----
Q8P7B3_XANCP          MGADTP-----LRIELLDEDIDSIRAFDPESQRS--LDKVDAVKMLPGREVPMDD-----
Q5NH30_FRATT          IGSKVA-----FRIDLFDNEIDSIKELNTESQRS--GNQIQSINIMPSHELVYNN-----
MFD_RICFE             PGPKA------YRINFSWDYIESIKEFDIDTQIS--TKSCSELVISPANEIVLNS-----
MFD_RICCN             SGPKA------YRIHFSWGYIESIKEFDIDTQIS--TKSCRELIISPANEIVLNS-----
MFD_RICPR             PGPKG------YRINFSWDYIESIKEFDINTQIS--TKYCAELVISPANEIVLNS-----
MFD_RICTY             PGPKA------YRINFSWDYIESIKEFDINTQIS--TKYCTELVISPVSEIVLNS-----
MFD_RICBR             PESKG------YRINFSWDYVESIKQFDIDTQIS--TRSCNELIISPANEIVLNP-----
Q3YR59_EHRCJ          MTYKNP-----IRIHLHNNFIQSINYFNHTTQLIDNNSFLDEILIYPTSELIKQK-----
Q2GLL6_ANAPZ          AVNENP-----VRIYFDYDIVESIKFFDPDTQITCSEQILD-IVIFSASELIKND-----
A9CIN2_AGRFC          PGTEEP-----VRLDFFGDTLESIRTFDPASQRT--IAQARSLDLNPMSEVTLTP-----
Q89LE3_BRADU          AGLDQP-----VRFDFFGDSLESIRSFDAETQRT--LLDMRSLDLVPVSEFQLVT-----
Q9A782_CAUVC          PAAEEP-----VRLDLFGDTLESIRAFDPETQRS--TKQLKEIDLLPVSEALLDA-----
Q2RTL9_RHORT          PGAPEP-----LRLDLFGDELDSLRSFDPVSQRT--TGQRDALILRPMSEVVLDK-----
Q3J2M4_RHOS4          PGVAGP-----VRLDFFGDVLDGARRFDPETQRT--VEKLDLVELAPVSEVMLDE-----
MFD_HELPY             PN-SKA-----YRLSFFDTECESIKEFDPITQMS--------------------------
MFD_HELPJ             PN-SKA-----YRLSFFDAECESIKELDPATQMS--------------------------
Q7M928_WOLSU          PQESSP-----VRLSLFDTQIESLRYFDLETQMC--------------------------
Q0P9G9_CAMJE          INEENP-----IRILLFGEEIESIRYFDLQSQKS--------------------------
A0A0H3P9Q7_CAMJJ      INEENP-----IRILLFGEEIESIRYFDLQSQKS--------------------------
A7ZE35_CAMC1          VNMDDP-----VRILLFGDEVESIRNYNTATQIS--------------------------
E0UPP9_SULAO          PSSNNP-----IRISLFDNEVEQIKEFELESQRT--------------------------
I0GL09_CALEA          FDYEKP-----VRIQLDFDRVEKIAILNELLLAEENVDSITISSIKY-------------
Q8RH90_FUSNN          INQDNP-----VRIEFFGNEVDRITYFD-------------INSQLS-------------
MFD_BORBU             FGEQNP-----IRIALNFDKIEEIKKFNPLTQLKHDNEILEFQILPK-------------
F0S455_DESTD          PE-GER-----LVAEFFGDTVEELYLNKEIIEKFVIIPTLELLQ----------------
E1X1P6_HALMS          ID-SRP-----IRLLYFDDMIEEIIFIDLETQKSIRDKKLDKVSIAPTPQIFGTDEVFSH
MFD_SYNY3             VSAELP-----VRLEWFGDELEKIREFDPASQRSLDDLTG--LVLTPTSFDQVIE-----
Q8DKA7_THEEB          VSAELP-----VRLQWFGDEIESIREFDPASQRSLHTEGDRLDVLEQVTLTPISF-----
Q7NEP2_GLOVI          VSAEIP-----VRAEWFGDELERLREFDPATQRSLDAVQQ--VAITPVGFGPVVL-----
Q7VBU2_PROMA          VNNELP-----IRIELFGDNIDKIREFDPINQRSLDEINN--IRISPVSINKITF-----
Q8F395_LEPIN          SYSTEP-----VRIDLFGEEIESIRTFDPDSQRSMTDLDQ--AVLLPADEYILSE-----
B5YL15_THEYD          IGEEYP-----ARIEFFGDEIEEIKLFYPDTQRSFKDKNE---------IWIIQA-----
A6GW35_FLAPJ          FSNDNP-----YRIEFFGNEVDSIRTFDVATQLS--------------------------
Q8AB59_BACTN          FASEYP-----YRIDFFGDEVESIRTFEVESQLS--------------------------
Q2S6G5_SALRD          YAGTYP-----IRIDFFGDEVDGLREFDPQTQRS--------------------------
Q8KEN4_CHLTE          YGSREP-----VRIEFFGDTVSSLRNFDTDSQLS--------------------------
O84753_CHLTR          LSSPEP-----FRIEFWGDRVSSIRSYNPSDQLS--------------------------
M1WUP8_PSEP2          PGYPLP-----LRLEFFGDSLEEIRLFDSSSQRS--KADLDEVILLPVSPGITTE-----
Q72AT7_DESVH          PGYERP-----LRLEFFGETLEEIRLFDASNQRS--LGKLDEMVLLPVSPVVLSA-----
B9KVH0_RHOSK          AGADRP----VRIGL-QGDLVTGIRRYDPVSLRSLEDVPGIDLLPVTELPESAFAEGP--
B0UM39_METS4          AAAPVP----CRVEH-EDGHITAIRSYDPVTQRSLGEAAELLIDPATELILGPDSPEPLR
Q1YKV9_AURMS          AAAPRP----CRIEH-EDGVVTAIRSYDPVSQRSVSETDCLIVDPASEIVGADDGATGRQ
E8TPS0_MESCW          AGAEDP----VRVVLGPDSCIRELKTYDPISQLSDQVRDSIAVGPASELMFKAGDHPELT
C6B9D3_RHILS          AGAPGP----LRIVLSKDDSVLELRGFDRVSQRTESYFDKVIFGPASEAILTEGITEEFV
A4YQE5_BRASO          AGALGP----VRINH-ADGMISDIHFFDLGHQNAVVAAETLVIDPMSER---SVGGEALV
A5EAY9_BRASB          AGALGP----LRIEH-SGGRIRRIAAINPMDQEVISETNELFIDPMSERLAFKDRARKRS
D1B5L3_THEAS          PGD-RA----IRVAF-DDDLVEEIRVFSPETQRAVASLDSWEMGGLKGGRSLTLLDVPVP
Q9RU62_DEIRA          LHLTPG----AGLPADAEEGVWLRAEFFGDELDTLRQLRPGELTGEKIQSFTLAPTADYL
Q5SJW3_THET8          LGE-------------------VRLEFFGDELERLVVR------GEERRRHVLLPKPG--
I0IIW6_PHYMF          LGAIATDDAGRASTAARAAVVVGFEENRIASIRF--------------------------
                                                                                  

MFD_MYCBO             AAQLAARHPAAESTVTGS-------------------------ASDMLAKLAEGIAVDGM
MFD_MYCTU             AAQLAARHPAAESTVTGS-------------------------ASDMLAKLAEGIAVDGM
Q8NRS9_CORGL          AESLISKHPGNPTLV------------------------------EMLSRIADSQDVDGM
Q9F2P1_STRCO          ARVLAEDHPEL---------------------------------GELLGKIAEGIAVEGM
Q8G5I7_BIFLO          AKALVGSIPNA---------------------------------EDMLESIANAIPVEGM
Q83N19_TROWT          VSLSSNPHRCASHLSINN-------------------------TYKPSAVMAPASEALIV
MFD_MYXXA             AESAARAV---ADRIN---------------------------LPTIKLREQLDALREGL
Q74H75_GEOSL          AASRIKTR---CDDLE---------------------------ISPLVRRELLEQLQNGL
Q1IHV1_KORVE          IHAKLSGRRLDADEET---------------------------LEAIARAEGVTVFPGWE
Q2RMB9_MOOTA          LETLKAEFSQTYATLRQRQ-------------------PQAARELKDRVQELIAMLEAGS
A9WHG9_CHLAA          DEALRRIDALDMSQLR--------------------------REVRDEWAVAREQLAGGQ
I0IRW8_LEPFC          ---------------------------------------------SEELKDFLSVHQATP
MFD_BACSU             AMEKIDSGLAASLKKLK---------------------ADKQKEILHANISHDKERLSEG
Q8YAD0_LISMO          IVKRLEKKMMLTLNELK---------------------EQEDKQALIENLEEDLEMLRSG
Q839B9_ENTFA          GMTRLQDALEKRLATAK---------------------DQTETDFLEEYFGQLLSSWEQG
F9UL13_LACPL          GAQRLKTAIAAE-NKKL---------------------KPAERQTLADNLAQPLADMEKG
MFD_STAEQ             LQNELKKAYEYTRPKIE---------------------KSV-RNDLKETYESFKLFESTF
MFD_STAES             LQNELKKAYEYTRPKIE---------------------KSV-RNDLKETYESFKLFESTF
MFD_STAHJ             LQSELKTAYEATRPKID---------------------KSV-RNDLKETYESFKLFETTF
MFD_STAA8             LKEELKTAYENTRPKID---------------------KSV-RNDLKETYESFKLFESTY
MFD_STAS1             TKHKLKQAYEDTRPKIE---------------------KSV-RNELKETYESFQLFEAEM
Q9CJI0_LACLA          GAKSLTEMTNLLTDPSA---------------------KSYMEEVISAAQNH--------
Q8DRQ1_STRR6          GQSALEKQISKTLSPIL---------------------KSYLEEILSSFHQK--------
Q97E98_CLOAB          GYEAIKDELNQSLDRLKG-------------------NNEESYNKLKETMEYNLEALKER
A5I7R4_CLOBH          GLKNIKTDLDKLVLKL---------------------NKKEDKEKIQSIINSNLEQLNES
D3R0N9_MAGIU          AGSCADSLADSNINAENLAAKIDAAGKREILSLKENNASAKVTAELNKSLAADIAKLTEG
B8E2E1_DICTD          ------------------------------------------------------------
MFD_ECOLI             ---AAIELFRSQWRDTF--------------------------EVKRDPEHIYQQVSKGT
MFD_HAEIN             ---KGIEFFRAQFRETFG-------------------------EIRRDPEHIYQQISKGT
Q8EEV8_SHEON          ---SAIEGFRQRYRRRFE-------------------------VIVKEPESVYQLVSRNL
Q9HZK3_PSEAE          ---EAVTGFRGRFRERF--------------------------DVDYRRCPIYQDLASGL
Q83CG9_COXBU          ---EAITHFRQSWRAKFL-------------------------GNPQE-APIYQQISEGE
Q63T69_BURPS          ---AARTAFRSRWRETFE-------------------------GDPSR-APIYKDIGNGV
Q7VZN3_BORPE          ---EARNRFRARFREVFE-------------------------GDPSR-ALPYKDIGNGI
Q8P7B3_XANCP          ---ASVERVLACLRERFD-------------------------VDTRR-SALYQDLKSGI
Q5NH30_FRATT          ---Q-NTTFALDKLNKLC-------------------------GDKALNSTIATYIQNNE
MFD_RICFE             ---ETNGNFKNNYLRNFG-------------------------VNHTD-NPLYEAVISGR
MFD_RICCN             ---ETIGNFKNNYLRNFG-------------------------VNHTD-NALYEAVISGR
MFD_RICPR             ---ETIGNFKNNYLRNFG-------------------------VNHTD-NPLYEAVISGR
MFD_RICTY             ---KTIGNFKNNYLRNFG-------------------------VNHTD-NPLYEAVISGR
MFD_RICBR             ---ETISNFKDNYLRNFG-------------------------VNHTD-NPLYEAITGGR
Q3YR59_EHRCJ          ---ATIDLFSRIYKTKT----------------------------NQD-QNLLDTIISGK
Q2GLL6_ANAPZ          ---GNIARFSEKCSHLR----------------------------SNN-PPLYEAVVHRQ
A9CIN2_AGRFC          ---DTIGRFRKNYLSLFG-------------------------AATRD-DALYQAVSEGR
Q89LE3_BRADU          ---DTIRRFRMGYVAEFG-------------------------APERD-DALYEAVSEGR
Q9A782_CAUVC          ---DGISRFRKGYVAEFG-------------------------AP-GD-DALYAAVSEGG
Q2RTL9_RHORT          ---ESISRFRSGYRELFG-------------------------TPSAA-DALYEAISAGL
Q3J2M4_RHOS4          ---GAFTRFRQNYRIEFG-------------------------AAGTD-DPLYEAVSAGR
MFD_HELPY             ---LKEDLLEIEIPPTLF-------------------------SLDESSYKDLKTKVEQS
MFD_HELPJ             ---LKEDLLEIEIPPTLF-------------------------SLDEPSYKDLKTKVEQS
Q7M928_WOLSU          ---EREELDRIEITPALF-------------------------ALDEATQKELEELVSAS
Q0P9G9_CAMJE          ---IPNELEHFEICPFLK-------------------------YFDKENYEIFKDKLEDF
A0A0H3P9Q7_CAMJJ      ---IPNELEHFEICPFLK-------------------------YFDKENYEIFKDKLEDF
A7ZE35_CAMC1          ---NKNELSEAEIVPFIA-------------------------NLSKDEFEKVSQKIEDM
E0UPP9_SULAO          ---LGDDLEALEIRSAFY-------------------------SLNESAYNELNQKIQNS
I0GL09_CALEA          -------IEESEIEKIEK-------------------------TIRKKLKNVNEFTEDIV
Q8RH90_FUSNN          -------IEKK-------------------------------------------------
MFD_BORBU             -------KEIIWDDKTIN-------------------------TLKTKIKSVEYKKILEE
F0S455_DESTD          ------------DREKLK-------------------------KLEEIYPGVVERHFLLG
E1X1P6_HALMS          KLRENIPMPATAQKSRFA-------------------------KRKEIFSSLSDNYLFDN
MFD_SYNY3             ------PALN-----------------------------AQAIDLSAWGEDAETEQLF--
Q8DKA7_THEEB          ------TPLI-----------------------------AQALRAADHAHLIPEDQ----
Q7NEP2_GLOVI          ------PELQLRL------------------------TPARVAELPNSWQEVVRTQIQQG
Q7VBU2_PROMA          ------NNLS-----------------------------NNELKRKDNNIKHEIEG----
Q8F395_LEPIN          ------EQKK---------------------------EYQNFLKSSDSSLHLPEIPEG--
B5YL15_THEYD          ------EEKE--------------------------------------------------
A6GW35_FLAPJ          -------------------------------------------IEKKNKIAIIPNFENKF
Q8AB59_BACTN          -------------------------------------------RERKEGVAIVPDLA--V
Q2S6G5_SALRD          -------------------------------------------VSRLTTARLVPNLEREE
Q8KEN4_CHLTE          -------------------------------------------TSAIESVDLFGSFTQES
O84753_CHLTR          -------------------------------------------TGKLSQITISPATAIIP
M1WUP8_PSEP2          ---KYISEAQKVWEKLRK---------------------------TGEISSTEEFALTER
Q72AT7_DESVH          ---ELRSKATARWKRLFS---------------------------KGMLTEEQYAGLLRG
B9KVH0_RHOSK          --------------------------------------------------PPRGAEHLLP
B0UM39_METS4          --------------------------------------------------PFTGQEHRLP
Q1YKV9_AURMS          EI-----------------------------------------DGETLQTGAPDSERFLC
E8TPS0_MESCW          ------------------------------------------------AMRATSMEERLV
C6B9D3_RHILS          ------------------------------------------------PTSDTVMR-LLL
A4YQE5_BRASO          ------------------------------------------------------------
A5EAY9_BRASB          ------------------------------------------------------------
D1B5L3_THEAS          ------------------------------------------------------------
Q9RU62_DEIRA          ------------------------------------------------------------
Q5SJW3_THET8          ------------------------------------------------------------
I0IIW6_PHYMF          ----------------------------------------------ADPPTEAWNRPLAA
                                                                                  

MFD_MYCBO             EAVLPV-----LWSDGHALLTDQLPDGTPVLVCDPEKVRTRAADLIRTGREFLEASWSVA
MFD_MYCTU             EAVLPV-----LWSDGHALLTDQLPDGTPVLVCDPEKVRTRAADLIRTGREFLEASWSVA
Q8NRS9_CORGL          EALIPA-----LTDTPMVPMLELMPENTHVLVIAPEKVRRRIADLEATDAEFLMAGWEAA
Q9F2P1_STRCO          ESLAPV-----LVDD-MELLLDVLPKGSMSVVCDPERVRTRAADLVATSQEFLQASW--A
Q8G5I7_BIFLO          ESLMPA-----LVDH-LEPVGSMLPKHAVILLSDPEKLRRSAEDLAKTANEFLAASWHVA
Q83N19_TROWT          YPTSEFPEEDQINNITPKSLLHFMPGKSTVVVIKCEQLTSKIEQLINTNREFSEAFCTPD
MFD_MYXXA             PGFGMEGLLPGFFEDGLSTVFDFLRDWSPEAPVIYLDDPLGQDRAADTLWEELERSHGAA
Q74H75_GEOSL          YPAGVEWLLP-LFHQNLETLLDYAGD-----AVRVLVDPAAQEEEGERLSRELEEASDRA
Q1IHV1_KORVE          YYAGATANQR---------LFDLLPN-----AAVLRDDPVKIESDFEAWWERVQQSHERS
Q2RMB9_MOOTA          WPGGSSQLQP-FFYPRQATLFEYFQR----QPLLVLDDPARLLEEMRRREQQRLGIFTDM
A9WHG9_CHLAA          RFEGRAFYAP-FFYDQTATLLDYLPP----QSMVALAEGHLLAQHADEIDVQAAGYRDQL
I0IRW8_LEPFC          LAPGIERYIG-QFYDDITSPLDYTPD-----PVLFIEDPHALEIRINDWQERIRDAYESI
MFD_BACSU             QTDQELVKYLSYFYEKPASLLDYTPDNT----LLILDEVSRIHEMEEQLQKEEAEFITNL
Q8YAD0_LISMO          VKPDMFFKYIGLAYPDPASLFDYLPKNT----AILLDEFGRILETEESLEREEAEWQTET
Q839B9_ENTFA          IPTENAHYYTDFLYQQKTTLLDYLPENS----LLFVDDYSRMMETEREIAREEAEWQTLK
F9UL13_LACPL          IIGNDLLLYGDYLYDRKTSIFDYVAADG----LVIFEEYSRLLDSEQQLLTQEADWVTDQ
MFD_STAEQ             FDHQLLRRLVSFMYEKPSTLIDYFQKNA----IIVVDEFNRIKETEETLTTEVEDFMSNL
MFD_STAES             FDHQLLRRLVSFMYEKPSTLIDYFQKNA----IIVVDEFNRIKETEETLTTEVEDFMSNL
MFD_STAHJ             FDHQLLRRLVAFMYEQPSTLIDYFAKDA----IIVADEYNRIKETEKTLTTEVDDFIQNL
MFD_STAA8             FDHQILRRLVAFMYETPSTIIEYFQKDA----IIAVDEFNRIKETEESLTVESDSFISNI
MFD_STAS1             FDHQVLRRLVAFMYEQPATIMDYFKEDA----IIAVDEYNRIKETETTLVTEIDEFMQNL
Q9CJI0_LACLA          YYHKDLRKFAEYFYDKKTSLLNYFPKNV----QIFIDDFQKVNEMNNKLEMELADFILSE
Q8DRQ1_STRR6          QSHADSRKFLSLCYDKTWTVFDYIEKDT----PIFFDDYQKLMNQYEVFERELAQYFTEE
Q97E98_CLOAB          AGFETIDTFIPYFYDNTSSFFDYL-KNS----IIFVDNYERCKGKIDSVYCEFEQNYENF
A5I7R4_CLOBH          WSFENIDTFLPYFYNKTNSLLDYI-EGS----LIIIDDVKRCLGKLDSTYLEFNEDYDKF
D3R0N9_MAGIU          LTTAPADKWLSLIYPEDTMFWDYWQETPGPKLPVVLDEPLRLTKALDTAQAAWQERIKEG
B8E2E1_DICTD          ------EKYFLKNKELKKYIFSYLPPNT----ILIFENYDESLALIQKWTEKGLANLEKR
MFD_ECOLI             LPAGIEYWQPLFFSEPLPPLFSYFPANTLLVNTGDLETSAERFQADTLARFENRG-----
MFD_HAEIN             LISGIEYWQPLFFAE-MATLFDYLPEQTLFVDMENNQTQGERFYQDAKQRYEQRK-----
Q8EEV8_SHEON          MPAGIENYLPLFFDE-VSTLFDYLPKNTQLVTLGDIEKSARAHLQEVEIRYEDRR-----
Q9HZK3_PSEAE          TPSGIEYYLPLFFEE-TATLFDYLPQDTQVFSLPGIEQAAEQFWNDVRSRYEDRR-----
Q83CG9_COXBU          AAAGIEYYLPLFFET-TQTFFSYLPKNTTVILFEKLETVAHQFWQEVEHRYEQLR-----
Q63T69_BURPS          PSAGIEYYLPLFFDE-TATLFHYLPERAQLVFTGDLDAAIKRFTADTKQRHAFLS-----
Q7VZN3_BORPE          AFAGIEYYLPLFFEQ-TATLFDYLAADTITVTVGDIDDAMQRFAHDTRSRYDFLK-----
Q8P7B3_XANCP          APSGVEYYLPMFFSK-TATLFDYLDTRVLPLIATGVSNAADAFWLQAQNRYEQRR-----
Q5NH30_FRATT          YFSGIEFYLPLFYDK-LSSLYDYLPPSTNIHLVDNITNSIEAFSDEVKFRYNELK-----
MFD_RICFE             KFAGYEQLLPLFY-NSCSSLVDYLNDPIFIFDNLSKQAILEFEHSYNDFYSA--------
MFD_RICCN             KFTGYEQLLPLFY-DSCSNLIDYLNDPIFIFDNLSKKAILEFEHSYNDFYSA--------
MFD_RICPR             KFAGYEQLLPLFY-YSCSSLVDYLNNPICIFDNLSKQAILEFENSYNDFYLA--------
MFD_RICTY             KFPGYEQLLPLFY-DSCSSLVDYLNDPICIFDNLSKQEILEFENSCNDFYLA--------
MFD_RICBR             KFSGYEQLLPLFY-DSYSGLTDYLNNPVIIFDNLTKQAILEFEHSYNDFYKA--------
Q3YR59_EHRCJ          KHTGEENFLPLFYKEELKNIFNYIPQNSTVIFSDRIINEIEQYNSQIYLNYK--------
Q2GLL6_ANAPZ          KFEGEEQLLPLLQADALVTLFDYI-QEAELVLSEATFSNIKQRIENIWEQND--------
A9CIN2_AGRFC          RYAGMEHWLPLFY-EQLETAFDYL-KGFRIVTDHTAKEAAKERSKLVLDYYEARRASGET
Q89LE3_BRADU          RHPGMEHWLPLFQ-DRMDTLFDYL-QGAVIAIEPQAEDAVRERFKQILDYYQARREAMEH
Q9A782_CAUVC          RRAGLEHWLPLFY-ERMATLFDYLPAGALIGVDNQATEARDERLAMIQDAYDARASADR-
Q2RTL9_RHORT          PFMGMEHWLPLFH-EGMDTLFAYV-PDGPVTLDPGLDGALRSRQDQIFEYFEARRLMESV
Q3J2M4_RHOS4          KHQGMEHWLPFFH-ARLETLFDYL-PEASVMLDDQVTPARISRWEGIADQYDARREAMTA
MFD_HELPY             PLNSFSKDLTSFGLWFLGEKAQDLLIVYKSIISPRALEEIQELASLNELDCERF------
MFD_HELPJ             PLNSFSKDLTSFGLWFLGEKANDLLGVYQSIISPRALEEIQELASLNELDDERF------
Q7M928_WOLSU          SYGAFSKDLMSLGLWYLKDKGEVLPRRVPSILTAGAKEELLELLELQESDELRFL-----
Q0P9G9_CAMJE          QSDALIHDINSLGFWCIDDFFDYL--ELDFLACEKFDINEYEK-DISFV-----------
A0A0H3P9Q7_CAMJJ      QSDTLIHDINSLGFWCIDDFFNYL--ELDFLACEKFDINEYEK-DISFV-----------
A7ZE35_CAMC1          QSDALVSDLNSLGFWAIDSFSDYLK-EFDSKLVKKIDFEIYDAPEEKFK-----------
E0UPP9_SULAO          EFDALNKDVASLGFWHLDDMAENFLENKNVKLVRNLDNLLKDAYGINNPRLPRDA-----
I0GL09_CALEA          LKDIEELKKSRNFGLNFYPKFLENGIHFKYRTILDYIS--DSTVVLFDVNIDKFL-----
Q8RH90_FUSNN          ---------------DSIELYIDNNKNKKDIFSLMSMN--KNKIEYYYENNDILQ-----
MFD_BORBU             LDFKKETKTEEMFYPLVANTYLGDEIEKHTPIVNFEINNFEKEIEKIHQEYEKLY-----
F0S455_DESTD          EISGAEKLLPDVFELVPVTEYIGGTLPAIVFEPDQVRTTGETFIKTVEENFELLK-----
E1X1P6_HALMS          YAAFTPLFFE---KSEVLLDYLNDETIKVLFNEVEFSRSYSDFFEQLRVEFELEW-----
MFD_SYNY3             -GKEGLQRFLGLAFTEPACLLDYLPTETVCVLDEPEQCAAHSERWFEAVAQDWSA-----
Q8DKA7_THEEB          ---EGLRRYLGLAFPEPASLLDYLPAQTLIAVDEPPLCVAHGDRWYEHTHTYWQS-----
Q7NEP2_GLOVI          QAPEGLRRWLGLAFDQPASLVDYLPDALTVCVDEPEQVRSAEHRWCEQAEEQWSH-----
Q7VBU2_PROMA          ----TIEELLEITQAKDSTLMNYIHKDSLICIDEKKQCVSHNENWINHLRITFNE-----
Q8F395_LEPIN          -NYGIYYEELIPLVRENHGILSYFSEPPILIFPSANSVKERLFHLEKEYLSLFEK-----
B5YL15_THEYD          --------------INNIELLELFEFDNIFTVDKNFTNKKFNIVKISHLPVKFST-----
A6GW35_FLAPJ          LQENR-ESFLEYINPKTTIFIQNTDLLLTHLDKLFSKAQETFEKLNKDIKHAS-------
Q8AB59_BACTN          TGDVT-TSFLDFIPKETVLAMRDFLWLRERIQVVHDEALTPQAIAVQEAEENGGI-----
Q2S6G5_SALRD          AARGS-IALFQYLPDEAVLATLDEAQVREGAQAQFEEAAAAYEERRAELAENDEVE----
Q8KEN4_CHLTE          AAESKPAGILDYLPDTAIVIIDDATAMQGSDHRALLEAALPR------------------
O84753_CHLTR          TNKLS-HSLLDYFKAFPLCIFDGLSSLEDNFSDIAGILASLPKRFMPIQDLCQRIL----
M1WUP8_PSEP2          LAMNDGFVWPGMYYASPVGLESHFPSGMNYLLSSGSSLRARLEDQDQAWRGYIEEEAR--
Q72AT7_DESVH          IERHGEGLMPGAYYEAPTVVEEWLPRDAAWILPGRKELVDAVEAAQQNWEALFDKQAE--
B9KVH0_RHOSK          RAWPALAALPDHLGQGGISVTPGALAA-LRRARAQIEEAHRDRESLGEGEALLPDALYLG
B0UM39_METS4          AFYPRLATLLDPVPGARLVVEAGAEAR-AEAFFEQLAEAGGARAGAGLYLAPEEWRALLG
Q1YKV9_AURMS          RQYERPETVFDYLQDADMVLETGAEIR-ADEVFDALQRIDADDPHRHAVLADHLDRETWD
E8TPS0_MESCW          ALFGAMPSVFDSASSASISFLEGIDGQPLDKILDLIEDARRARQEAAGREKPLPEQFYLS
C6B9D3_RHILS          RLYQDMPTVFDFLGDATVVLAPGAADQ-VERYLEIVDDARQSRKDFGEVEAPSSRSLYLD
A4YQE5_BRASO          -------DLFTYLDGSEIIVDSTVPDH-AEMRLAALDESDVDKERRKRAFVDRST-----
A5EAY9_BRASB          -------SLFDYCSRAKWIADSAVPRH-ADTWLSTIEDAAARGER-DRAYLSRRE-----
D1B5L3_THEAS          -------FGLVVFEPGQVEIQCESAVWLWEQMREEIHSLPGAADWSSLAS----------
Q9RU62_DEIRA          ----------------------TETKWDATRLELLPGRVFLDSPEFYASALEVLIDTLWP
Q5SJW3_THET8          ----------------------KAEGFTSKKVLHFPGPVYLDTPALAPKAL-------WP
I0IIW6_PHYMF          ITLATPDAKRVLQRASTRCLLDLLPARTGVVLDDAEAIALEAARLGRRAAGGGGD-----
                                                                                  

MFD_MYCBO             ALGTAENQAPVDV-------EQLGGSGFVELDQVRAAAARTGHPWWTLS-----QLSDES
MFD_MYCTU             ALGTAENQAPVDV-------EQLGGSGFVELDQVRAAAARTGHPWWTLS-----QLSDES
Q8NRS9_CORGL          AMG-ADGPVAAEG-------LDLEASSYRSYESLEVSASKSDVRWWTFAPPGMFEASEEA
Q9F2P1_STRCO          ATAGGGEAP-----------IDVDAASLWSIADVRERARELDMMWWSVS-----PFAADE
Q8G5I7_BIFLO          ASGHGAGAP-----------ISFDEASFLDYAETISSLEYSEHPVIRLT-----SFGVDT
Q83N19_TROWT          AFSATNKYARNNHDGDNTLDGIAEKINYYTLEGLRHFAADLGIGWTDLSGFN--SEDEKS
MFD_MYXXA             E-----------ARQELICPPLEHFLSREDVNQRMQSFRVLEGGGLSLAQTE----RP--
Q74H75_GEOSL          R-----------ERGELFPAPESLFLAPADTAAALAAGRLVTIPFLHLNEGD----SPE-
Q1IHV1_KORVE          -------------GVGHLVRPEDLLDSPDTWQQRIASLPGADVEQLGMYS----------
Q2RMB9_MOOTA          L-----------AAGLALPSQGQAYLDSADLERLWQRYQRLYFSLLPRRVPG----SN--
A9WHG9_CHLAA          L-----------ALGELPPDFPRPYLRWSEL-HLKESAKLVVVDLSHNEYPD----AL--
I0IRW8_LEPFC          P-----------AEERALLPPPEKAFIPFGAREKTPFSFGSDHPRILLSVFR----DD--
MFD_BACSU             -----------LEEGKILHDIR--LSFSFQKIVAEQKRPLLYYSLFLRHVH---------
Q8YAD0_LISMO          -----------LSRMETVRDVQ--VSHSFKKLLEGNHSPKIYLSLFQKQMA---------
Q839B9_ENTFA          -----------IEEMRVFSEQT--FGVDFHDQLRKTARNTTFFSLFQKGMG---------
F9UL13_LACPL          -----------LAHHRVLATAS--YGNDIRDLLRDDQHAQLLISLFQKGIG---------
MFD_STAEQ             -----------IESGNGFIGQG--FMKYESFDALLEQHAVAYFTLFTSSM----------
MFD_STAES             -----------IESGNGFIGQG--FMKYESFDALLEQHAVAYFTLFTSSM----------
MFD_STAHJ             -----------IESGNGFIGQS--FMQYDGFESLLKDYPVTYFTLFTSTM----------
MFD_STAA8             -----------IESGNGFIGQS--FIKYDDFETLIEGYPVTYFSLFATTM----------
MFD_STAS1             -----------IESGKGFIDQS--FLQYEGFENLLKPFAVTYFTLFTATM----------
Q9CJI0_LACLA          -----------KAMERGFEGQT--YLLDTMAKVR-NYKPATFFSNFQKGLG---------
Q8DRQ1_STRR6          -----------LQNSKAFSDMQ--YFSDIEQIYK-KQSPVTFFSNLQKGLG---------
Q97E98_CLOAB          -----------LERGDILPKQGNIIVSKENIYEILKTEKRINLESIGRAAN---------
A5I7R4_CLOBH          -----------LEKGCILPKQAEIVHDKERMIEQLEFKKIINIENIKKTID---------
D3R0N9_MAGIU          -----------FLKGQNFLTAGLAQYTRLDCMRRLDKEMNVITLAVIGGAN---------
B8E2E1_DICTD          -----------RTKENLPEDLY------------LTNSLLESYTSHYQVLD---------
MFD_ECOLI             -----------VDPMRPLLPPQSLWLRVDELFSELKNWPRVQLKTEHLP-----------
MFD_HAEIN             -----------VDPMRPLLSPEKLWLNVDEVNRRLKSYPRITFKAEKVR-----------
Q8EEV8_SHEON          -----------VDPLRPLLAPKELYLLIEELFAAFKPLPRYQFVAPNPD-----------
Q9HZK3_PSEAE          -----------VDPERPLLPPAEVFLPVEDCFARLKNWPRVVASQEDVE-----------
Q83CG9_COXBU          -----------HDLTRPLCPPSELFLSFEQLRIEIKNHTQIKISDAPII-----------
Q63T69_BURPS          -----------HDRERPILEPQRLFLSDDDFYLLAKPFARIVL-----------------
Q7VZN3_BORPE          -----------VDRERPVLPPDTLFLDHEALFARLKDFPRLAL-----------------
Q8P7B3_XANCP          -----------HDVERPLLPPDELYQSPDALRERLNKLARIEVWPADHP-----------
Q5NH30_FRATT          -----------HDSDRPILPFQEIFYSQQEIQDIYQQYKNIKWFQQ--------------
MFD_RICFE             ------------RSEVNKLKFNSFYPTLSPTDLYFTASEITELLEQKNN-----------
MFD_RICCN             ------------RSEANKLKFNSFYPTLSPTSLYFTASEITELLEQKNN-----------
MFD_RICPR             ------------RSKANKLKVNNFYPTLSPTSLYFTASAITELLEQKNN-----------
MFD_RICTY             ------------RSNANKLKVNNFYPALSPASLYFTASAITELLEQKNN-----------
MFD_RICBR             ------------RLDANKLKFNSFYPTLSPSQLYFTSLEAIELLEQENN-----------
Q3YR59_EHRCJ          ------------SQLFYQVPPHQFYINLEDFKTITQQFNKIVFSQHNSANNN----NSTS
Q2GLL6_ANAPZ          ------------TQD-CTTHCTSLFLDLQSYEQVLARFHKILLCRFDSAPQS----IVQN
A9CIN2_AGRFC          KGSTQ-------GAPYKPVSPGQIYLDGKSFEAALASVNAVRLTPFNEHD------SEGR
Q89LE3_BRADU          PGG---------GAIYKPLPPDRLYFTEEEWTRRLGDVPLVRLTQFSVP-------ADGT
Q9A782_CAUVC          ------------KSAYRPLAPEALYLTAEEWERELSDRTHRRFTPFQPQ---------GL
Q2RTL9_RHORT          GDGAKASEKPGGGMIYHALPPPRMFLEEDEFLRHCAGRPGAAFSAYAAPDVA----TEKG
Q3J2M4_RHOS4          KGRL--------DTVYKPAAPDLLYLDEAAWEAAVAGHRVIQLSPLAQSP--------GP
MFD_HELPY             ------------------------------------------------------------
MFD_HELPJ             ------------------------------------------------------------
Q7M928_WOLSU          ------------------------------------------------------------
Q0P9G9_CAMJE          ------------------------------------------------------------
A0A0H3P9Q7_CAMJJ      ------------------------------------------------------------
A7ZE35_CAMC1          ------------------------------------------------------------
E0UPP9_SULAO          ------------------------------------------------------------
I0GL09_CALEA          -----------ESVKEFIATQKENYGNLVEYEPIEETIKKLLLNRKVIE-----------
Q8RH90_FUSNN          -----------AKIKRLINENLD------------------REEDILNK-----------
MFD_BORBU             -----------KEAEEAGKNIIDPKRILLNYKTFNLKSDVLFSKIKSLK-----------
F0S455_DESTD          -----------KEG----------------IPSSKPEKFVWKIDIKPIV-----------
E1X1P6_HALMS          -----------QDLDNDNLLPEPIRLYDTNLENTLKNISHISIDDLSYA-----------
MFD_SYNY3             -----------LQLPNL-------PQLHRNFSALGDRLKTDFQYITLSE-----------
Q8DKA7_THEEB          -----------LETPP--------PPIHRPWSASAQALER-FQRLHLYE-----------
Q7NEP2_GLOVI          -----------QPVGP--------GPLHTDFAAITASLGR-YALIEMRE-----------
Q7VBU2_PROMA          -----------LMRDNTLKDNNSINILNYNDKNQINSLLEDFKIIEMSNDS---------
Q8F395_LEPIN          -----------RSREVLCAPPEKLLSFGEEFKVLSESIGLSFVGLPPRN-----------
B5YL15_THEYD          -----------KSVDAG-------------------------------------------
A6GW35_FLAPJ          --------------------PEQLFLNQKEFIKQSLNFCVVETASKP-------------
Q8AB59_BACTN          -------------------TLEGKLIDGSEFTVRALDFRRMEFGNKP-------------
Q2S6G5_SALRD          ------------QTPEDLTPPDDRFLTGDQMAAALTRHPRLQFGTFSQSST---------
Q8KEN4_CHLTE          -----------------------------------FRHVVIQRINKQ-------------
O84753_CHLTR          ------------KEFTPLFFEEKTFPNLISHKDTGFSIEAFHKKISVQRVS---------
M1WUP8_PSEP2          -------------QKRIRWPLRFFCRSHEGARQVWQKKRQIVFEELTIGREK--------
Q72AT7_DESVH          -------------EGGARQPRGLVLRDAAPVRQLYEEKDSAGFEPLVMGVER--------
B9KVH0_RHOSK          EE---------------------DLAGILAQAETLDLSGWEPVPAFAED-----------
B0UM39_METS4          RR---------------------RIATALPSED-------RAVPAFARE-----------
Q1YKV9_AURMS          TL---------------------VAERVTALVDDVEAD--YSVPVFATE-----------
E8TPS0_MESCW          REE-------------------WDASMCNRSTRLAVSAER--VPKFFRQ-----------
C6B9D3_RHILS          RAE-------------------WERQASSVSARELDLEEGGDLPTEASD-----------
A4YQE5_BRASO          -----------------------WRHALRLATVLPAKGHSEPIPVFAQQ-----------
A5EAY9_BRASB          -----------------------WDQAAKKITLLAPTVPFRATPEFYKA-----------
D1B5L3_THEAS          ------------------------RVQGVIRVSSSQGDPSAMLERVPNF-----------
Q9RU62_DEIRA          KLA-------------------GREVTSFGRTPLDLPDLHTGLETLPFY-----------
Q5SJW3_THET8          LLA-------------------GRPWVALGGG-VELPPLELGARPLPPY-----------
I0IIW6_PHYMF          -------------------------LTPAELDERLAARPVVRVDLQPAA-----------
                                                                                  

MFD_MYCBO             AIELDVRAAPSA----------RGHQRDIDEIFAMLRAHIATGGYAALVAPGTGTAHRVV
MFD_MYCTU             AIELDVRAAPSA----------RGHQRDIDEIFAMLRAHIATGGYAALVAPGTGTAHRVV
Q8NRS9_CORGL          TLPLDFEAGPAP----------RGELPKIDAMMAQLLAHTTGGGRAAFIAPTQGAIKRMV
Q9F2P1_STRCO          TLTSDLDAEGDSDTLKLGMHAPETYRGDTAKALADTKGWLAEGWRAVYLTEGHGPASRTV
Q8G5I7_BIFLO          TLTGHVQLDAQN---------PAEFRGDEAKASQGIEGLLDAGFHVTITAAAAGTLARLR
Q83N19_TROWT          LITANPDFSGYSVFDHIRNLQKSGWQIVLASTNNRVYPTLDEYGIDYLILSANTDYSSFE
MFD_MYXXA             ---PVHFSFGGTQDLREAILAHHGEEGALSPLVERLERWRELRVACVVACGTLSQADRLK
Q74H75_GEOSL          ---TIDIATETNADLKVDISPDS--EGVLRPLAARLTGWIEERQRVIIACHQRGQAQRLY
Q1IHV1_KORVE          ---------ESGEQIAIQSQSTSKFHGSVPAMVEEVKALLTDGRRVLFAAANTGEVERLA
Q2RMB9_MOOTA          ----------PRPAVGISAQTIPAFQGKLGLVVEELTRWRREGYRIILMVADPNRVVALR
A9WHG9_CHLAA          ----------PPLSFGVP----PLYGGQLRRLIDTVVEQVRGGELVVAVTAQAARLQELV
I0IRW8_LEPFC          -------------PDAPDLFSPPEKLIDRNESWILRLRELSSRMRVITFFGSRGQRDRFQ
MFD_BACSU             -------HTSPQNIVNVSGRQMQSFHGQMNVLAGEMERFKKSNFTVVFLGANKERTQKLS
Q8YAD0_LISMO          -------SMRVSKTTNIVYKQMQQFHGQMNVLKTELESWHKNNYAVVILAPNLERAEKMQ
Q839B9_ENTFA          -------NLRFQEVHNFQYRSMQQFFGQMPLLKAEVDRWQKQNQTVVVFVPTKERIQKVE
F9UL13_LACPL          -------NVKLAQVTNVRTRPMQEFFGQLPALKTELDRWHKLKQTVVLMVSEAERLTKVS
MFD_STAEQ             -------QVPLQHIIKFSCKPVQQFYGQYDIMRSEFQRYVHQDYTVVVLVETETKVERIQ
MFD_STAES             -------QVPLQHIIKFSCKPVQQFYGQYDIMRSEFQRYVHQDYTVVVLVETETKVERIQ
MFD_STAHJ             -------PVQLQHIIKFSCKPVQQFYGQYDIMRSEFQRYVHNDYHIVVLVETETKVERIQ
MFD_STAA8             -------PIKLNHIIKFSCKPVQQFYGQYDIMRSEFQRYVNQNYHIVVLVETETKVERMQ
MFD_STAS1             -------PVQLNEIIKFSCKPVQQFYGQYDIMRSEFQRFIQNDYTIVVLAETETKKERIQ
Q9CJI0_LACLA          -------NLRFEQLYNFKQHSMQQFFGQLELFYTEVERFIKQEFTVVLAVS----SEKLR
Q8DRQ1_STRR6          -------NLKFDKIYQFNQYPMQEFFNQFSFLKEEIERYKKMDYTIILQSSNSMGSKTLE
Q97E98_CLOAB          -------NNF-RTGIAFEEITLSSYQGQMDLLINDIKELKEEKYRTVILCGTKSKGQRLV
A5I7R4_CLOBH          -------RLKPKSVLTFNQTTLQGYNGKIEFLIEDIKEKKKEKYKILILSGTRSRGERLV
D3R0N9_MAGIU          -------GFPAIAEFVIRGRESDSYCGKDAKLTADLKD--PSFPPCTLCAVGEVRRQKLA
B8E2E1_DICTD          -------LNSKDADIAFSIYSPPSYQGTNEFFEKNIKSFVYDGWEVYISSEHQDIVRTRL
MFD_ECOLI             --TKAANANLGFQKLPDLAVQAQQKAPLDALRKFLETF----DGPVVFSVESEGRREALG
MFD_HAEIN             --SSVRQKNLPVAALPEVTIQSQQKEPLGQLRQFIEHF----KGNVLFSVETEGRRETLL
Q8EEV8_SHEON          --TNGVAAQIDARALPEVSANHKLKQPLIALQDYAEQ-----APRMLFSAESEGRREALL
Q9HZK3_PSEAE          --PGVGRERFPALPLPNLAIEAKAAEPLAALRRFIEEF----PGRVLFCAESAGRREVLL
Q83CG9_COXBU          --EKTGQVNFATENFPPLLIDHKASQPFARLKNFLHEITAIQGGRVLFCAETDGRRETLL
Q63T69_BURPS          ---PAQPSGGWAAPLPNLALERHADAPLAAFAAYLETT----KNRVLFTVESAGRRETIA
Q7VZN3_BORPE          ---MAERPHPDFAAAPDVAVARRADDPVARLRALLAQT----GDRVLLCADSAGRRETLA
Q8P7B3_XANCP          --RIDEAAPLGDQPLPPLPVAAKDAPAGQALASFLGHY----PGRVLVAADSAGRREALM
Q5NH30_FRATT          --PKSKSKILKVDHLEKISANYKLANPFKDLQQFIDKSN---FDKVIFSTDSNGRAELLL
MFD_RICFE             -IFISYENSEQATLIENISSASFIEKKTVFDKLFEIIKAHS-SKKIVIGAASLSGLERIK
MFD_RICCN             -ILLTFENSEQASLIKNIAATSFIEKKTVFDKLFEVIKANS-HKKIIIGSSVLSSFERIK
MFD_RICPR             -ILISYENSEQASLIGNISSISFIEKKTIFDKLFEIIKANF-HKKIIICSSVLSSFERIK
MFD_RICTY             -ILISYENSEQASLIGNISSTSFMEKKTIFDKLFELIKANF-HKKIIICSSVLSSFERIK
MFD_RICBR             -ILISYENSEQASIVENIAAASFVEKKTIFDKLFEVIKANS-RKKIIIGSSVLSSFERVK
Q3YR59_EHRCJ          INAQSFNITTQIQHVPNFKVLAQDKQANIFEILTQYINTTCQTKKLIIACNSIGSLEYIQ
Q2GLL6_ANAPZ          PATVALTKST-LALLPDLKLQARERGCNIFSVTANHMQEA--KKQVLLACYSEESMQYLV
A9CIN2_AGRFC          PVATLDAHVGPRWARPPTEGDSEERVNVFDLAVKHIAERRAKGWKVLITGWSEGSLDRLL
Q89LE3_BRADU          GVVDAGARKGRDFAPERND----TTVNVFESVVSHVMALQAQRKKVVITLWSEGSRDRMT
Q9A782_CAUVC          DVIDLGAKLGRVFAAERAQ----DSVNLFEATADHAKALAAQGKRVLFASWSEGSSERLG
Q2RTL9_RHORT          VVGDFLGRPGHEFADIRAR----AGGNVFDALRDHAQALRAAGKRVVLTAATMGARERMT
Q3J2M4_RHOS4          GVLDAGGRMGRSFAPERQA----ENISLFGALVDHVRSLRED-RQVVIASWSEGARERLK
MFD_HELPY             -------------------------------------------KFLKVLENAQGYEDLEI
MFD_HELPJ             -------------------------------------------KFLKVLENAQGYEDLEI
Q7M928_WOLSU          -------------------------------------------EGLNLLATPLEHSDIII
Q0P9G9_CAMJE          --------------------------------------------NAKILPQAKKFKELQS
A0A0H3P9Q7_CAMJJ      --------------------------------------------NAKILPQAKKFKELQS
A7ZE35_CAMC1          --------------------------------------------GIEILPEPKVYKDLEV
E0UPP9_SULAO          -------------------------------------------FDLDVLEENDEVKELVV
I0GL09_CALEA          --------------------FGSMLENALDFHVKELSESLIMLGNLKDILINEKNRRTIL
Q8RH90_FUSNN          --------------------IAELSKIGIQIEIQKFSEEELKQFEVIDRVKKLSENTKIT
MFD_BORBU             --------------------SKETIEFKIESERNFFSNIALTKEEFENWLKNGFKIIIAA
F0S455_DESTD          --------------------SIYDKPVKDGIDFGIKPLPSVNDENIKELFKSLEGFKVKL
E1X1P6_HALMS          --------------------NVLDEELRTSIELKVVPAIGYLSQDINPSLSRAEYTKAIF
MFD_SYNY3             --IHEANGDSLDISARPIPTMPHQFAKLAEILRGKREIYSGLTLGQYSTWLISAQPSRTV
Q8DKA7_THEEB          --LASE-GLGLNLSARAVPAIPHQFGRLAATLREERD-------KGYTVWLVSAQPSRSV
Q7NEP2_GLOVI          --LVAE-GEAFGLGGRPLPSVPHQFGNLAEHLRQYRA-------QGLQIWMLSAQPSRAV
Q7VBU2_PROMA          --ISINQDESFHLNSSKIVTYPNQFSKISELIREFQK-------KKYSIWLLSAQPSRAS
Q8F395_LEPIN          -------ENDLVSLLKEAPSFKGKIREVREKISELRA------KGGWKIVLTSSFEAQTK
B5YL15_THEYD          -----------DKTFYGLGILPNERSSILDFPRNLKK-------------LGIPIIFSIS
A6GW35_FLAPJ          -------TFRTSETFEFHIKPQPSFNKQFDLLLNNLKDNQAHNYKNYLFCSNEQQAKRFH
Q8AB59_BACTN          -------TGTPDAKISFHTSVQPIFHKNFDLVAGSFKDYLEQGYSLYICSDSTKQTDRIR
Q2S6G5_SALRD          -------NGTPTDTLDLEADPQPSFNSDMDLVRKRLQKNGDRDLDTFILCDSHGQSSRLR
Q8KEN4_CHLTE          -------------GIDFNSSEQQRLQGNFRLLAGRLQEEAERGLKPLFACASRREIEELA
O84753_CHLTR          -------LPFIYPPALIETSGEQ--NPLLAFLKTFQDFCAGRTLSLALYCSNTKSLKEAH
M1WUP8_PSEP2          --NGIDMAEAPYSDFTDLFWKPEAARRPWSALMDSLKEWGRASGQTILSFRSERSRQKFL
Q72AT7_DESVH          --TGVDMPERKLHGFVDLFPAPDARDRPWQALVAGLHRFVATHARVLLCFGNERGRRKFL
B9KVH0_RHOSK          -------------------------RRPRAALARFVRGQIGEGRRVVLLAA-TPRDLRAL
B0UM39_METS4          -------------------------RRPAAAFGRFLAARCEAGDRVILAGP-GRALGRLA
Q1YKV9_AURMS          -------------------------RQPYKALASFVEPLRDEGYRIVLAGPDGRVMRSAA
E8TPS0_MESCW          -------------------------ARPGYEIAEFVTRQTSAGARVVLTGD-ASELQRAD
C6B9D3_RHILS          -------------------------TYPRTALINWMQDCLRHGLKVVISGK-GNGSEALC
A4YQE5_BRASO          -------------------------RSARATLRRFIESARQRGARILFTAATERDLQGME
A5EAY9_BRASB          -------------------------SSPRKALRAFIEEAQRGDARVVFVAAVESDLRLMA
D1B5L3_THEAS          -------------------------AGRLKEAEGFVLDMRSKGFRTLFLGSTRGYV----
Q9RU62_DEIRA          -------------------------RARLADLERDVAEWRAGGYRVFILVRHDRTAAYLA
Q5SJW3_THET8          -------------------------RGSLKALEKDLARWLAEGKRVHLFVGHARTLEYLK
I0IIW6_PHYMF          -------------------------EAALRLDAGRPSPFPLHADAAGRELAARSRDRRVL
                                                                                  

MFD_MYCBO             ERLSESD------------------------TPAGMLDPGQAPKPGVVGVLQGPLRDGVI
MFD_MYCTU             ERLSESD------------------------TPAGMLDPGQAPKPGVVGVLQGPLRDGVI
Q8NRS9_CORGL          DRFAEKG------------------------IPTHVATPGWEPTPGQVTLYHALSHAGLV
Q9F2P1_STRCO          EVLGGEG------------------------IAARLDNDLEALSPSVVHVSCGSIDHGFV
Q8G5I7_BIFLO          RAINTTG------------------------IAN-------------FDVIRSQAIDGFV
Q83N19_TROWT          ECRECSTRQESPQVMCTPSI----------TQSCTHDRTGAQQKSYISDLFFKQADPDAV
MFD_MYXXA             RLLMDRNVMVKVH---TEP---------------LEDAVALYEPSIRAHLFTGEVSHGFV
Q74H75_GEOSL          ELLAHYPVPLTVS---DRP---------------FPAERERDDG--RVDIVIGEISRGFR
Q1IHV1_KORVE          DIFSEYMVPFRVGSRSTRPG----------QETYIEEQGFFAEDLSATTVVKAYVPEGVA
Q2RMB9_MOOTA          QALAEQGIEALTH-----------------------PEARDTLGRGEVIMVSGRLRQGFT
A9WHG9_CHLAA          GERLAQETVS-----------------------------------GRFVPIHGGLEAGFT
I0IRW8_LEPFC          EILENQAIPFTPL---------------------SELQEENPPPEGSIQTILGDIGEGIY
MFD_BACSU             SVLADYDIEAAMTDSKK------------------------ALVQGQVYIMEGELQSGFE
Q8YAD0_LISMO          QTLTDYDMESTILKKESD-----------------------VPKYGMVQFVIGTFQNGFE
Q839B9_ENTFA          ELFQDFDIPSVVSNWDQ-------------------------LLDGHVQIVQGALQTGFE
F9UL13_LACPL          DTLDDFEIEAVMTKATN-------------------------LQPGAVQIVQGSLQNGFE
MFD_STAEQ             SMLNEMHIPTVSNIHED------------------------ID-GGQVVVTEGSLSEGFE
MFD_STAES             SMLNEMHIPTVSNIHED------------------------ID-GGQVVVTEGSLSEGFE
MFD_STAHJ             SMLNEMHIPTVTNVQND------------------------IK-SGQVVVTEGSLSEGFE
MFD_STAA8             AMLSEMHIPSITKLHRS------------------------MS-SGQAVIIEGSLSEGFE
MFD_STAS1             SMLNEMHIPTFIDTPSR------------------------RNEGGSAIITEGSLSEGFE
Q9CJI0_LACLA          KSLHELDLSLQEVDRES-------------------------IQVGKVNLIDLQLSNGFN
Q8DRQ1_STRR6          DMLEEYQIKLDSRDKTS-------------------------ICKESVNLIEGNLRHGFH
Q97E98_CLOAB          ETLGDRGIESVYKDSIL------------------------NVDYGEVVISPGSQLRGFR
A5I7R4_CLOBH          NHLRDMGVESSYKDIVR------------------------EIKPGEVVITFGNQGNGFQ
D3R0N9_MAGIU          DLLRTEGVTTE-----------------------------------QAKIIDLPLPRGFV
B8E2E1_DICTD          KNLN------------------------------------------VKYLVGEKIREGFL
MFD_ECOLI             ELLARIKIAP------------------QR-IMRLDEAS--DRGRYLMIGAAEHGFV---
MFD_HAEIN             DLLSPLKLKP------------------KQ-IQSLEQIE--NEKFSLLVSSLEQGFII--
Q8EEV8_SHEON          ELLGKIQLKP------------------SV-FSHFDEFIQSDARLGLIVSPLSRGCLLGL
Q9HZK3_PSEAE          ELLARLKLRP------------------EE-VDGWPAFLASQARLAISIAPLDEGLLL--
Q83CG9_COXBU          EFLKEIDTTP------------------QA-VKNWRTFLAENTRVGLTIAPLDKGVLL--
Q63T69_BURPS          QLFAEHHLRP------------------AG-SDSFAAWLASDERFALGVAPLANGFAVP-
Q7VZN3_BORPE          QMLGEHGLAP------------------EAQADSIQAFLDDGARFGLAVAPLSAGFCVP-
Q8P7B3_XANCP          EVLAAAQLKP------------------DVVADLPAFLAATKLRFGITVAPLEDGFALD-
Q5NH30_FRATT          EHLNKLNLNI------------------QS-CKNFNEAIEVSAKFCLIISPFQEGMIID-
MFD_RICFE             SITQNYEYK----------------------YNEINKLDEAKASVINVGIIPLNQSFYT-
MFD_RICCN             SIIQNYEYK----------------------YNEINKLDEAKASIINVAIIPLNQSFYT-
MFD_RICPR             SIIQNYEYT----------------------FNEINKLDEAKASVINIGIIPLNQSFYT-
MFD_RICTY             SIIQNYKYT----------------------FNEINKLDDAKASVINIGIIPLNQSFYT-
MFD_RICBR             SIIENYEYS----------------------YNEIEYLEEAKTNTINIAILPLNQSFST-
Q3YR59_EHRCJ          NKLKTLGIK----------------------LYKINHYQEIFYSH-NITILPTNQSFIT-
Q2GLL6_ANAPZ          EKFKHFDMH----------------------ISRVSSFSDITSKY-STAILPFQHDVET-
A9CIN2_AGRFC          QVLNEHGLEK------------------IKPVTSLKEVKKLGKGEAACAVLSLEAGFET-
Q89LE3_BRADU          SMLRDHKLAH------------------TTSVNSWRTVQATPRNETMLAVLGLDSGFET-
Q9A782_CAUVC          TMLADHGLKK------------------IPYAGYWQAAKANDPKVPQRVVLPLDHGFET-
Q2RTL9_RHORT          GVLREHGLSP------------------IVTAETWAEALERAKKATVVLTLILDRGFET-
Q3J2M4_RHOS4          GLLEEAGLQG------------------TKLAQDIRDVPE-ARGGTHLMVWALEQGFTA-
MFD_HELPY             HAHALEGFIA------------------LHSNHKITLLAPNKTILDNAISALDAGNMECV
MFD_HELPJ             HVHALEGFIA------------------LHSNRKITLLAPNKTILDNSISVLDAGNMECV
Q7M928_WOLSU          SPANFLSFLS------------------LHANKEITIIARNEALFRAF--DLKEIPCKKQ
Q0P9G9_CAMJE          SYNK--DFFE------------------FHKNKKITLLAKNEALFKAL-ELEDTQNIHFV
A0A0H3P9Q7_CAMJJ      SYNK--DFFE------------------FHKNKKITLLAKNEALFKAL-ELEDTQNIHFV
A7ZE35_CAMC1          TLNF--DFFE------------------LNKSKSITVLSRNEGLFKGY-ELDGFANVKLE
E0UPP9_SULAO          ANVA--QLLK------------------VHQDKKVTLIAANNATVKQA-GIYDTTNMTII
I0GL09_CALEA          IKTENFDR--------------------VKEILNAYELPYTTILEEKTGIYVQEGFFDRG
Q8RH90_FUSNN          IYSEEATR--------------------YKEIFKGYPVKFEKYP------------LFEG
MFD_BORBU             ESESQKEK--------------------LKYIFKELPKVSIEVLKIS---------SSLI
F0S455_DESTD          FYTSETLK---------------------IEAEKLSKKFGLDIQIEKGVSS-----GSFK
E1X1P6_HALMS          EFIKSKYKSSGEIYFSYEHDNSKNEFFHLMEVFEFDQSIQKRVFFTKSKLP-----NGFF
MFD_SYNY3             SLLQEHDCAV--------------QFIANPRDYPAIEKSQIQRTAVTLKYSGLAELEGFI
Q8DKA7_THEEB          ALLQEHDCPA--------------QFVPNPKDFPAIDKLQQQRLPIALKASGLAEISGFI
Q7NEP2_GLOVI          ALLGDHDCPA--------------QFIPNPQDLPAIEKARSTRTPIALKYSGLAEMEGSI
Q7VBU2_PROMA          ALLEEHECIT--------------KFVQNNLDISHINSLIEFKTPVSLKLHGNIDIEGVD
Q8F395_LEPIN          RLQGLFEKEG--------------VILLN-EDSTEPLPFHLGNHKSDTFLVLSELRNGFI
B5YL15_THEYD          SRGKAETIKE--------------VLFNHDIIAPLIHKNEIGTYSGKYAITISDLQEGFY
A6GW35_FLAPJ          DIFESLDEQNHET------------------------------ITKQYETIVLPLYQGFI
Q8AB59_BACTN          AIFEDRGDK------------------------------------IQFTPVVRTIHEGFV
Q2S6G5_SALRD          DLLESEIDH------------------------------------GWARLVVESLHEGFE
Q8KEN4_CHLTE          EFIADENTSKS---------------------------------PDAIEWIPANLHSGFA
O84753_CHLTR          DLAAACIPN------------------------------------TQIYDHPTTLSSSFA
M1WUP8_PSEP2          NLALQEQLPL---------------------------SLKYSPRTRGLFALVSPLRKGME
Q72AT7_DESVH          KLAEQDGITP---------------------------TLRYDPKGRGLMAVVAPYRAGVE
B9KVH0_RHOSK          RRATGAADP------------------------AQDWQDARATPQDVPAAILSTLARGFV
B0UM39_METS4          REAVDQLGHKLLR--------------------ARDWAAALRAEPGRVAVLEAPIAEGFR
Q1YKV9_AURMS          RKAGTALDGVFEP--------------------AANWDAICDAAPSSLLLFDAPITQGFV
E8TPS0_MESCW          RLLNRKLGRRAEE--------------------AVDLPQILSAARGSLLKAGFVLDEGFV
C6B9D3_RHILS          RRLGQATGTAPQS--------------------IDTWEAVLKAEPGTVLKLACELDQGFI
A4YQE5_BRASO          RVAGEKAER------------------------RKNWAAATRARDGAITSLLIDLDRGFT
A5EAY9_BRASB          RMSAAKAEC------------------------VPDWAHAT-ARGRRQAALLAGFDAGFI
D1B5L3_THEAS          -----------------------------------EWAAGCGMEVIRGSASEGALDLSER
Q9RU62_DEIRA          DKLLGTHEI--------------------------PWLKVPRLNPGELGFLRSGGEGGFV
Q5SJW3_THET8          RRLQAFSPL--------------------------ILDRFPGPK-GRLALLPGDFEGGAE
I0IIW6_PHYMF          VVSDRPDDPR---------------------------LADRLSEAPEARLMRGLLSEGFR
                                                                                  

MFD_MYCBO             IPGAN----------------LVVITETDLTGSRVSAAEG-----KRLAAKRRNIVDPLA
MFD_MYCTU             IPGAN----------------LVVITETDLTGSRVSAAEG-----KRLAAKRRNIVDPLA
Q8NRS9_CORGL          FPKVRKHRD-------GAAMPLVVITETDLTGNRVGDIAGA----KRRPAKRRNKVDPLA
Q9F2P1_STRCO          DPALK----------------LAVLTETDLTGQKAAGREG-----ARMPARRRKTIDPLT
Q8G5I7_BIFLO          DKAAK----------------IALLTERDLTGRTSA-VAV-----AKAPKRRRKAIDLVE
Q83N19_TROWT          DSGLIKHRVVVIDSYIQEGFSVPTKSFTLIGEHELFGKTTL----QKAPRISRRAIDPIN
MFD_MYXXA             DGPGG----------------LAVLADEEIFG----AR--ARRRPKRSKKLDAFGSGFGD
Q74H75_GEOSL          LPEGR----------------LVVIAEEEIFG----KR--QKRRGITELRKKQIMTSLAE
Q1IHV1_KORVE          MPESR----------------FVLFGTRDLFDESEVAS--AQQPKRSRSKVSAFLSDFRD
Q2RMB9_MOOTA          WPEMR----------------LAIIGDTEIYGPIRR-----PRRVKTP-REGSKISSFTD
A9WHG9_CHLAA          LADLH----------------LTLLTDSEIFGVRQRRP--LAERRRKT-GTTDRAAFLRT
I0IRW8_LEPFC          IAPDN----------------TLLVSDTFLFR--KKYD--RTRETRFRTAAAAFRRDQIR
MFD_BACSU             LPLMK----------------LAVITEEELFKNRVKK-----KPRKQKLTNAERIKSYSE
Q8YAD0_LISMO          LPLAK----------------VAIISETELFNKKIKK-----VKKRQKLSNAERIQSYSE
Q839B9_ENTFA          LPKNK----------------LVAITEKEIFHTTTKK-----RARRQTISNAERLKSYSD
F9UL13_LACPL          FPDGK----------------LVIVTEQEMFKKVAKK-----RPRRQTLANAERLKSYTD
MFD_STAEQ             LPYMQ----------------LVVITERELFKTRQKKQ----RKRTKTISNAEKIKSYQD
MFD_STAES             LPYMQ----------------LVVITERELFKTRQKKQ----RKRTKTISNAEKIKSYQD
MFD_STAHJ             LPYMQ----------------LVVITERELFKTKQKKQ----RKRTKTLSNAEKIKSYQD
MFD_STAA8             LPDMG----------------LVVITERELFKSKQKKQ----RKRTKAISNAEKIKSYQD
MFD_STAS1             LPYMQ----------------LVVVTERELFKSKQKKK----PKQHKTLTNAEKIKSYQD
Q9CJI0_LACLA          FLDEK----------------LVVMTEHEIFGKMRKK-----KARKLNITNAERLKDYNE
Q8DRQ1_STRR6          FVDEK----------------ILLITEHEIFQKKLKR-----RFRRQHVSNAERLKDYNE
Q97E98_CLOAB          YPEIR----------------LCVISDKEIFGTAKKK-----KEKRKNKKGVGKIKSFTE
A5I7R4_CLOBH          YYDIK----------------LSVISDKDIFGQFKKK-----GKKKQNKKGTGKIKSFTE
D3R0N9_MAGIU          YPAAD----------------MWVLGEQEIFAGKAKR------RRNRGSTTGVALDLFSD
B8E2E1_DICTD          WEKEK----------------ILVITDYEIFGKKRKR-------KVIRYEKGLKPKDLYL
MFD_ECOLI             DTVRN----------------LALICESDLLGERVAR---RRQDSRRTINPDTLIRNLAE
MFD_HAEIN             EQSLP----------------VAIIGEANLLGKRIQQ---RSRDKRKTINPDTLVRNLAE
Q8EEV8_SHEON          GAQTA----------------VSIICETELFGQRISQQ--RRREKQRQISNDTLIKNLAE
Q9HZK3_PSEAE          -DHPA----------------LALVAESPLFGQRVMQR--RRREKTR-DGGDAVIKNLTE
Q83CG9_COXBU          -SSPP----------------LAIISESQLFGEQIRQ---RRLEKERKIDPNLLIRNLTE
Q63T69_BURPS          --GEG----------------YAIVTETELYGALG--RRAGRRRQEQASNVDAMVRDLSE
Q7VZN3_BORPE          --GGA----------------LLFLTENDLYPGHAGVTRRGKRTQERTSNVEAMVRDLAE
Q8P7B3_XANCP          --TPQ----------------IAVLTERQLFPERAN---QPRRTRRVGREPEAIIRDLGE
Q5NH30_FRATT          ---KK----------------IALITEADLFPEHGYN---STKVSQHDHHPTVDLKDLTD
MFD_RICFE             ---KE----------------YLFITASELLEEKSS-------STNTNKKLKNILLELDN
MFD_RICCN             ---KE----------------YLFITASELLEEKPS-------STNTNKKLKNILLELDN
MFD_RICPR             ---KE----------------YLFITSSELLEEKTL-------YTNTNKKLKNILLELDN
MFD_RICTY             ---KE----------------YLFITSSELLEEKTL-------YTNTNKKLKNILLELDN
MFD_RICBR             ---PE----------------YLFIAASELLEEKVT-------PTNTNKKLKNILLELDH
Q3YR59_EHRCJ          ---KS----------------TIVITEHDLLYKQEV-------TNKSN--ISNIINNNTN
Q2GLL6_ANAPZ          ---ED----------------FIIITEHSLLGRQCS-------IKKA---RRTVTNNASE
A9CIN2_AGRFC          ---GT----------------LAVIGEQDILGDRMVR------RSKRRKRGADFIAEVAG
Q89LE3_BRADU          ---DE----------------IALISEQDILGDRLVR------PRRASRKLDNFISEVTS
Q9A782_CAUVC          ---DS----------------LAVISETDILGDRLAR------PRK-KRRAANFLAEASA
Q2RTL9_RHORT          ---PD----------------LAVISEADVLGDRLSR------PVRKKKLGDKFIPDISA
Q3J2M4_RHOS4          ---PG----------------LAVISEQDVLGDRLIS------KPKKRRKAENFLREHDT
MFD_HELPY             IAPFV----------------LNFKTPDGIFISLNSF-------ERKK-KRQKSKLALNE
MFD_HELPJ             IAPFV----------------LNFKTPDRIFISLNSF-------ERKK-KRQKSKLALNE
Q7M928_WOLSU          IGDFC----------------VNLLTPKEVILSLNQN-------TKKSAKKRRPTFAIDE
Q0P9G9_CAMJE          KSDLR----------------LNLISPEELIISLNQK-------EKQK-TRKKASLIIDE
A0A0H3P9Q7_CAMJJ      KSDLR----------------LNLISPEELIISLNQK-------EKQK-TRKKASLIIDE
A7ZE35_CAMC1          ISPLV----------------VNLTSSDKIVVSLNKF-------EKKR-RVKRSSLVVDE
E0UPP9_SULAO          QAPYI----------------LNILTPDELVVSLNKA-------DKKR-RRRKTSILLDD
I0GL09_CALEA          FEGDK----------------IIVLTDRELFFHLEPTK-----RP-KKIIFSREIVSLEE
Q8RH90_FUSNN          YKTDD----------------KLILTDREIKGIRVKRE-----R---VEKKALRYKTVDE
MFD_BORBU             IEKEK----------------IAIILESNIFNTGQKIN-----KA-FESSKTKAIDSFVE
F0S455_DESTD          IDERK----------------EAWLTESEVVFETAKK------------------EDITT
E1X1P6_HALMS          YESEK----------------ILVLSEADIFSSKLRKT-----KATKKVSVDVFAEQLAT
MFD_SYNY3             LPTFR----------------LVLVTDRELFGQHALAT---PEYVRKRRRATSKQVDINK
Q8DKA7_THEEB          LPTFR----------------TVLVSDREFFGQHNLVN---LGYVRKRRRAAAKQVDLNK
Q7NEP2_GLOVI          LATLR----------------VVLVTDREFFGQRVLAT---PNFVRKRRRAASKQIDLDK
Q7VBU2_PROMA          LSQWK----------------VLLLTDKELFGQQIVSS---TGFIRKRRSSSSRSVNPNK
Q8F395_LEPIN          LENQK----------------ILILSENDIFGREYKRK---TRFKKQNSKALQSFIDLK-
B5YL15_THEYD          RENL------------------MIITDFELFGEKTLK--------KKKLAIQKLPIDGLE
A6GW35_FLAPJ          DEENQ----------------IACYTDHQIFERYHKFS--IKNGYSK--KQTITLKELTS
Q8AB59_BACTN          DHTLH----------------LCIFTDHQLFDRFHKYN--LKSDKARSGKVALSLKELNQ
Q2S6G5_SALRD          WPGAG----------------LAVFTDHQIFNRYHRPS--TKQWEGH--ADGMNLRDIKN
Q8KEN4_CHLTE          FGE------------------LNLYTESDIFGKFHTHK--AHR-KRK--VRGISLKELQR
O84753_CHLTR          LVEAG----------------FAAVSLSEFAASKVLRR--QKQRNYF----STTTEEVYI
M1WUP8_PSEP2          LIWSQ----------------TRILGEEVLQPEPVKVH-------AGRDKAFKGLDKYED
Q72AT7_DESVH          LAWDG----------------TLVIGEDVLQPKTDRSA-------RVASGAFRGLDKHEG
B9KVH0_RHOSK          DLPGR----------------TAVVTARDVLGSRAAEDAAVAAVSA--WQGTPDALA---
B0UM39_METS4          VPDHA----------------LTVIAAADLLGKRAAPAWAAPARAAPGREGAPAALPFAD
Q1YKV9_AURMS          AAESG----------------VAVISLRNLEGQKAAAAVAGPSDGF-----APQVDTFM-
E8TPS0_MESCW          DAQSG----------------IAMVAAADLFGPALKADAGMAASIL-----EPELRI---
C6B9D3_RHILS          DVTER----------------IAVVAAAD----GISTASNCSTLLV-----EPELRI---
A4YQE5_BRASO          TGTRRP---------------LIVITAAEVLGSRARHLLPM--ARQAAVAGITIPVP---
A5EAY9_BRASB          VPGKKP---------------LVVITAADVLGSRAHQPQPTNWAWTPGFEAGDLPEL---
D1B5L3_THEAS          VLYLSE---------------VDVAGVRPPSSPAGKPPADVLDSLIS-------------
Q9RU62_DEIRA          IPEHK----------------TVVITEDLIYGFQGGSALRGKKMAGRPVTDALGLSV---
Q5SJW3_THET8          WGEW------------------VLLTEALVFATGG---VRARVRVGEGLSDPGALSP---
I0IIW6_PHYMF          LRGEDG---------------FEAVPGHELLGVPAPPGAAVEDPAADGAPDSGTLGSVLV
                                                                                  

MFD_MYCBO             LT--AGDLVVHDQHGIGRFVEMVERTVGG-------ARREYLVLEYASAKRGGGAKNTDK
MFD_MYCTU             LT--AGDLVVHDQHGIGRFVEMVERTVGG-------ARREYLVLEYASAKRGGGAKNTDK
Q8NRS9_CORGL          LE--PGDLVVHETHGIGRFVKMTERTISAG---DETSRREYIVLEYAPSKRG---QPGDQ
Q9F2P1_STRCO          LE--TGDYIVHEQHGVGRYIEMVQRTV-------QGATREYLVVEYAPAKRG---QPGDR
Q8G5I7_BIFLO          LK--KGDYVVHEQHGIGRFIEMRQRTIGTG---ANKTTREYLVIEYAPSKRG---APADK
Q83N19_TROWT          LA--IDDYVVHEIHGIARFKGMCSRRPK-----HDAPEQEYLILEYAKNRLG----VADK
MFD_MYXXA             LK--EGDLIVHTDFGIGRYAGLTKMEV-------NGVPGDFLVLEYA---------GRDK
Q74H75_GEOSL          LK--PGDHMVHLDHGVGIYRGLQHLSL-------SGCAGDFLLLEYA---------GGDK
Q1IHV1_KORVE          LT--INDYVVHVEHGIGQYQGLKEIAQG------DGEPAEFMILEYA---------EGAR
Q2RMB9_MOOTA          LK--EGDYVVHVHHGIGRYLGLQQLDV-------GGVKKDYLLIQYA---------GKDR
A9WHG9_CHLAA          LK--PGDYVVHIEHGIAIFDGMIRRTV-------SEVEREYLVLRYA---------GEDK
I0IRW8_LEPFC          LA--EGEPVVHLQQGIGIYRGLREIEV-------GNIPGEFLIVEYR---------DGDK
MFD_BACSU             LQ--IGDYVVHINHGIGKYLGIETLEIN-------GIHKDYLNIHYQ---------GSDK
Q8YAD0_LISMO          LK--VGDYVVHVNHGIARYVGMETLDIN-------GVHKDYLLLVYQ---------GEDK
Q839B9_ENTFA          LK--TGDYVVHANHGIGKYIGMETLEVD-------GVHQDYMTILYQ---------NDDK
F9UL13_LACPL          LK--PGDYVVHVNHGIGKYVGMETLEVD-------GVHQDYITIAYQ---------NNAK
MFD_STAEQ             LN--VGDYIVHVHHGVGRYLGVETLEVG-------DTHRDYIKLQYK---------GTDQ
MFD_STAES             LN--VGDYIVHVHHGVGRYLGVETLEVG-------DTHRDYIKLQYK---------GTDQ
MFD_STAHJ             LN--VGDYVVHVHHGVGRYLGVETLEVG-------DVHRDYIKLQYK---------GTDQ
MFD_STAA8             LN--VGDYIVHVHHGVGRYLGVETLEVG-------QTHRDYIKLQYK---------GTDQ
MFD_STAS1             LK--VGDYVVHVHHGVGRYLGVETLEVG-------GVHKDYIKLQYK---------GTDQ
Q9CJI0_LACLA          LA--VGDFVVHKNHGIGKYLGLQTLEVG-------GMHRDYLTIQYQ---------NGDT
Q8DRQ1_STRR6          LE--KGDYVVHHIHGIGQYLGIETIEIK-------EIHRDYVSVQYQ---------NGDQ
Q97E98_CLOAB          LK--PGDYIVHVNHGIGVFKGIKQLEVQ-------GHKKDYLELSYA---------VDDK
A5I7R4_CLOBH          LK--PGDFVVHANHGIGVFKGIKQLELQ-------GNKKDYLELIYH---------SDDK
D3R0N9_MAGIU          LR--PGDLVVHDIHGIGIYKGLRSVEVD-------GVRRDYIWLSYA---------NNDE
B8E2E1_DICTD          LK--DGDYVVHVNYGIGIFRGLKKLKVD-------ELEKEFIYIEYA---------NNSF
MFD_ECOLI             LH--IGQPVVHLEHGVGRYAGMTTLEAG-------GITGEYLMLTYA---------NDAK
MFD_HAEIN             LK--IGQPVVHLDHGVGRYGGLVTLDTG-------GIKAEYLLLNYA---------NESK
Q8EEV8_SHEON          LK--VGQPIVHLEHGVALYQGLVTLDTG-------GIVAEYLQLEYS---------GGDK
Q9HZK3_PSEAE          LR--EGAPVVHIDHGVGRYLGLITLEVD-------NQQAEFLMLQYA---------EDAK
Q83CG9_COXBU          LH--IGDPVVHIQHGVGRYLGLQTIKTS-------DQEAEYLTLQYA---------DNDK
Q63T69_BURPS          LK--VGDPVVHAQHGIGRYMGLVSMDLG-------EGDTEFLHLEYA---------GDSK
Q7VZN3_BORPE          LR--AGDPVVHAQHGIGRYHGLVNMDMG-------EGEMEFLHLEYA---------SGST
Q8P7B3_XANCP          LS--EGAPIVHEDHGVGRYRGLIVLDAG-------GMPGEFLEIEYA---------KGDR
Q5NH30_FRATT          LK--PGMHVVHIDHGIGRYEGLESIELN-------GKKDEFILLRYA---------NDAK
MFD_RICFE             LA--EGEFVVHKDHGIGQFLKLEALEIK-------GKLHDFLKILYA---------GNDK
MFD_RICCN             LA--EGEFVVHKDHGIGQFLKLEALEIK-------GKPHDFLKILYA---------GNDK
MFD_RICPR             LK--EGEFVVHKDHGIGQFLKLEAFKIQ-------GKLHDFLKILYF---------GNDK
MFD_RICTY             LA--EGEFVVHKDHGIGQFLKLEAFEIQ-------GKLHDFLKILYS---------GNDK
MFD_RICBR             LA--EGELIVHKDHGIGQFLKLEALEIK-------GKLHDFLKILYA---------GNDK
Q3YR59_EHRCJ          LD--IGDIVIHKDYGIGKIVELETTKVL-------DSYHDFIKIEYY---------NNDK
Q2GLL6_ANAPZ          LT--IGDVVVHKDYGVGIFIALRTLTVC-------GSCHDFVEIKYR---------NDDK
A9CIN2_AGRFC          LD--EGSLVVHAEHGIGRFVGLQTIEAA-------GAPRACLELHYA---------DDAK
Q89LE3_BRADU          LA--AGDIVVHVDHGIGRFVGLQTLDVA-------GAPHDCLELHYA---------AETK
Q9A782_CAUVC          LT--PGDLVVHIDHGIGRYEGLKTLDVQ-------GAPHDCLDLLYG---------GEAK
Q2RTL9_RHORT          LS--EGDLVVHVDHGIGQYEGLETLTAG-------GAPHDCLRVVYA---------DNNR
Q3J2M4_RHOS4          LT--PGDLVVHVEHGVGRYMGLETLRVPQPPSNKPGPPHDYLHLVYA---------EDAK
MFD_HELPY             LN--PGEWVVHDDYGVGVFSQLVQHSVL-------GSKRDFLEIAYL---------GEDK
MFD_HELPJ             LN--AGEWVVHDDYGVGVFSQLIQHSVL-------GSKRDFLEIAYL---------GEDK
Q7M928_WOLSU          LR--VGDYVVHKDYGIGIFKGIIQERVL-------GALRDFILLAYQ---------GEDR
Q0P9G9_CAMJE          LK--NGDYIVHEDYGVGKFLGLEMIVIS-------GAKKEFVAIEYQ---------NSDK
A0A0H3P9Q7_CAMJJ      LK--NGDYIVHEDYGVGKFLGLEMIVIS-------GAKKEFVAIEYQ---------NSDK
A7ZE35_CAMC1          LK--VNDYVVHEDYGIGRFLGLEKIKVL-------GATKEFVVIAYQ---------NDDK
E0UPP9_SULAO          LK--AGDYVVHEDYGVGIFEKIEQTEIL-------GGIKDFIVIKYV---------GDDK
I0GL09_CALEA          LK--VGDLVVHRDFGIGIFRGLVKLGET-------P--KEFLLIEYR---------DGEK
Q8RH90_FUSNN          IK--EQDYVIHENFGVGIFLGLENIEG-----------QDYLKIKYA---------DEDK
MFD_BORBU             IE--KNSHVVHINHGIGIFRQIKRIKTS-------SLEKDYIEIEYA---------EGEK
F0S455_DESTD          LE--PGTLVVHRDYGIGIFQGIISRVIG-------NKTFDFIEIEYA---------GGER
E1X1P6_HALMS          LK--KGDFVIHSEHGVGVYDGLESLDIG-------DSKSDYIVLIYK---------GNDK
MFD_SYNY3             LS--PGDYVVHKSHGIGKFLKLDALA-----------NREYLMIQYA---------DG-I
Q8DKA7_THEEB          LQ--PGDYVVHRQHGIGQFLRLETLTIN-------NETREYLVLQYA---------DG-I
Q7NEP2_GLOVI          LN--PGDFVVHRSHGIGRFAKLEKLTVS-------GSAREYLVIEYA---------DG-I
Q7VBU2_PROMA          LK--SGDYVVHRNHGVGKFLKIEKFIVN-------NESRDYLLVQYS---------DG-T
Q8F395_LEPIN          ----EGDYVVHIHHGVGKFLKIERTSAG-------GKERDFLKLEYS---------GG-D
B5YL15_THEYD          IN--EGDYIVHKEHGIGIFRGIKRQKYE-------GTEEDVLVLEYK---------DGDI
A6GW35_FLAPJ          LV--VGDYVTHIDHGIGKFGGLQKIQ-------VEGKTQEAIKLAYA---------DNDI
Q8AB59_BACTN          FT--PGDYVVHTDHGIGRFSGLVRIP-------NGDTTQEVLKLVFQ---------NEDV
Q2S6G5_SALRD          LT--RGDFVVHVDHGIGRFDGMKKIT-------VRDNQQEAVRLNFA---------DNDV
Q8KEN4_CHLTE          LK--VGDYVVHEDYGIGVFRSLETIQ-------VGDSEQECVLVEYE---------GGDQ
O84753_CHLTR          PV--PGETVVHLHNGIGKFIGIEKKPN------HLNIETDYLVLEYA---------DKAR
M1WUP8_PSEP2          LN--EGDLLVHRDYGLAQFGGLHHMNVG-------DAANDYLLLFFS---------GEDK
Q72AT7_DESVH          LQ--PGDLLVHRDYGVARFVGLERMDLG-------GVGNDFLLLEYA---------GDDR
B9KVH0_RHOSK          ----EGDLVVHEDRGLGRLQGLEPLPGADGR--------EAIRLGYA---------SDQH
B0UM39_METS4          PDLHRGDVVIHEDHGLCVFEGLELLRGPEGGG------GEAARLRFA---------DDAV
Q1YKV9_AURMS          ----TGDRVVHIEHGVAVLDGLVPIDPNGNGGD---PEGEALSLRYR---------NDET
E8TPS0_MESCW          -----GDVVVHEDHGLGVLAAVEQVDLAGQHQ-------DVVRLEYH---------GGAS
C6B9D3_RHILS          -----GDVVVHEDHGVGVLRDLESIAVENVCR-------DAARLEYR---------DGDS
A4YQE5_BRASO          -----GSAIIHLQRGLALLDGLELISAPNVSA------RDMIRLVFA---------NDEA
A5EAY9_BRASB          -----GSVVVHLQRGLARLGGLRSMGSGDLSA------REMVRLVFA---------GNDA
D1B5L3_THEAS          -----GDLMVHEDYGVCRFLGIEMIEQGGVQQ-------DYIALEFA---------QGKR
Q9RU62_DEIRA          -----GDFLIHPEHGIGQFLGLETRKVLGVTR-------DYLNIGYR---------GGSR
Q5SJW3_THET8          -----GDYLIHPEHGVGQYLGLETREVLGVKR-------DYLVLRYK---------GEGK
I0IIW6_PHYMF          SLE-PGDPLVHAEHGVALYEGMEPIEIGIGSR---RTTIDHLTLAFA---------EPDT
                              : *   *:     :                     : :              

MFD_MYCBO             LYVPMDSLDQLSRYVGG---QAPALSRLGG---SDWANTKTKARRAVREIAGELVSLYAK
MFD_MYCTU             LYVPMDSLDQLSRYVGG---QAPALSRLGG---SDWANTKTKARRAVREIAGELVSLYAK
Q8NRS9_CORGL          LYVPMDALDMLSRYVGG---EKPTLSKMGG---SDWKNAKKKARAAVREIAGELVELYAK
Q9F2P1_STRCO          LYIPTDQLEQITKYVGG---EAPTLHRLGG---ADWTKTKARAKKAVKEIAADLIKLYSA
Q8G5I7_BIFLO          LFIPTDQLDQVSKYIGA---EAPKLNKLGG---SDWAATKAKARKHVHEIADDLIKLYSA
Q83N19_TROWT          LYIPTDQLSMISKYIGS---DRPTLSRIGG---SDWALTKSRARKAISSIALDLVKLYSR
MFD_MYXXA             IYLPVGRMRLIQKFSGG-DPTQVQLDKLGT---TSWEKTKKRVKEQLLKMAAELLQIAAA
Q74H75_GEOSL          LYLPVDRLSLVQRYVGS-EGIEPRVDRLGG---TSWEKAKGKARAAVQEMAEELLRIYAA
Q1IHV1_KORVE          LYVPLTRLDLIQKYRSS-EGVKPALNRLGT---QQWAKTKARVKKAMKDMADELLKLYAA
Q2RMB9_MOOTA          LYVPVDQVSLVQKYVGG-EGHVPRLYRLGG---NEWNKVKSRVQEAVQEMAQELLDLYAR
A9WHG9_CHLAA          IYVPVDQIDRVTRYIGA-GDGPPTLTRLGT---QDWERTKRKVRAAVQDLAEELLRLYAQ
I0IRW8_LEPFC          LYVPVDQVDLLKPWRGP-EGSPPKLDRLGG---HSWQKTRSRVRKEIEKISQELVDLYAK
MFD_BACSU             LYVPVEQIDQVQKYVGS-EGKEPKLYKLGG---SEWKRVKKKVETSVQDIADDLIKLYAE
Q8YAD0_LISMO          LFIPVDQLDLVQKYVGA-EGKSPRLNKLGG---AEWKRVKKKVQASVQDIADDLIKLYAE
Q839B9_ENTFA          LFIPVTQLNLIQKFVAS-ESKTPKINKLGG---SEWTKTKRKVASKIEDIADDLILLYAT
F9UL13_LACPL          IFIPVTQLNLVQKYVSS-ESKTPRINKLGG---TEWTKAKRKVAAKIEDIADELVDLYAK
MFD_STAEQ             LFVPVDQMDQVQKYVAS-EDKSPRLNKLGG---TEWKKTKAKVQQSVEDIADELIDLYKE
MFD_STAES             LFVPVDQMDQVQKYVAS-EDKSPRLNKLGG---TEWKKTKAKVQQSVEDIADELIDLYKE
MFD_STAHJ             LFVPVDQMDQVQKYVAS-EDKSPKLNKLGG---SEWKKTKAKVQQSVEDIADELIALYKE
MFD_STAA8             LFVPVDQMDQVQKYVAS-EDKTPKLNKLGG---SEWKKTKAKVQQSVEDIAEELIDLYKE
MFD_STAS1             LFVPVDQMDQVQKYVAS-EDKSPKLNKLGG---TEWKKTKAKVQQSVEDMADELIELYKA
Q9CJI0_LACLA          ISVPVDHLDLLSKYTAG-EGKSPKINKLND---GRWRKTMSSVSKQVEDISDDLIKLYAE
Q8DRQ1_STRR6          ISIPVEQIHLLSKYISS-DGKAPKLNKLND---GHFKKAKQKVKNQVEDIADDLIKLYSE
Q97E98_CLOAB          LYVPVEQLDLVQKYIGS-EGKVPKVNKLGS---SEWTKAKNKVRKSINEIAEELVKLYAV
A5I7R4_CLOBH          LYVPVEQLDMVQRYIGS-EGKKPKVSKLGS---SEWTKTKNKVKKSIEEIAEDLVKLYAI
D3R0N9_MAGIU          LYLPMEALDQLQKYIGVSEQQNPKLSRLGG---TDWQKLKNKARDSVKKLAFDLVKLYAE
B8E2E1_DICTD          LYVPLEEMHLIQRYVSS-SPDPPQISRLES---RQWEETKRKVKESAKEIAEELLKIYAQ
MFD_ECOLI             LYVPVSSLHLISRYAGG-AEENAPLHKLGG---DAWSRARQKAAEKVRDVAAELLDIYAQ
MFD_HAEIN             LYVPVTSLHLISRYVGG-SDESAPLHKLGN---EAWAKSRQKAAEKIRDVAAELLDVYAQ
Q8EEV8_SHEON          LYVPVSNLHLISRYSVG-ADGETHLNKLGN---DTWAKAKNKAIEKIRDVAAELLDVYAR
Q9HZK3_PSEAE          LYVPVANLHLIARYTGA-DDALAPLHRLGS---ETWQKAKRKAAEQVRDVAAELLDIYAR
Q83CG9_COXBU          IYVPVSSLYLISRYAGA-DASHAPLQKLGS---KQWEKIKEKTQKHIRDVAAELLDIYSR
Q63T69_BURPS          LYVPVAQLHVISRYSGA-DPDSAPLHALGS---GQWERAKRRAAQQIRDTAAELLNLYAR
Q7VZN3_BORPE          LYVPVSQLHVIARYSGA-DPDAAPLHQLGS---GQWDKARRKAARQVRDTAAELLALYAQ
Q8P7B3_XANCP          LYVPVAQLHLISRYSGA-SADTAPLHSLGG---EQWTKAKRKAAEKVRDVAAELLEIQAR
Q5NH30_FRATT          IYVPITSLNLISIYNSS-LTEKIALNKLGT---DKWKKQKEKTIKKIIDVAANLLEIYAK
MFD_RICFE             LYIPVENIEVIKKYGN----DNAELDKLGS---SSWQRSKAKLKNRIKEIALHLIQIAAK
MFD_RICCN             LYIPVESIEVIKKYGN----DNAELDKLGS---VSWQRSKAKLKKRIKEIALHLIQIAAK
MFD_RICPR             LYVPVENIEVIKKYGS----DNAELNKLGS---VAWNKSKAKLKNRIKEISLHLIQIAAK
MFD_RICTY             LYVPVENIEVIKKYGS----NNVELDKLGS---AAWHKSKAKLKDRIKEISLHLIQIAAK
MFD_RICBR             LYIPVENIEVIKKYGS----DVAQLDKLGS---VSWQKNKAKLKNRIKEIALHLMQIAAK
Q3YR59_EHRCJ          LFLPVENINLISKYGQQ--NPNVTLDKLGS---TSWQQRKTKIKNHIKKIARELLAIEAA
Q2GLL6_ANAPZ          LFVPVEDTDLITKYGI---NTDVVLDRLGS---SAWHDKQNKLKKRIDDIAKTLLHAEAM
A9CIN2_AGRFC          LFLPVENIDLLSRYGS--DAAEATLDKLGG---GAWQMRKAKLKKRLLDMADELIRIAAA
Q89LE3_BRADU          LFLPVENIELLSRYGS--DQTTVELDRLGG---SGWQTRKAKLKNRIREIADELIKIAAA
Q9A782_CAUVC          LYLPVENIDLLTRYGAA-DAENVQLDKLGG---AAWQGRKAKAKERLRVMAEGLIQIAAA
Q2RTL9_RHORT          LYVPVENIEVLSRYGS--EQAGVQLDKLGG---VAWQARKAKLKQRIRDMAEQLIGVAAA
Q3J2M4_RHOS4          LYLPVENIELLSRYGH----EEGLLDKLGG---GAWQAKKARLKERIREIAERLMRIAAE
MFD_HELPY             LLLPVENLHLIARYVAQ-SDSVPAKDRLGK---GSFLKLKAKVRTKLLEIASKIIELAAE
MFD_HELPJ             LLLPVENLHLIARYVVQ-SDSVPVKDRLGK---GSFLKLKAKVRAKLLEIAGKIIELAAE
Q7M928_WOLSU          LLLPVENLDYIDRYVAD-SGSIPSVDRLGK---GSFAKLKEKIRTKLLEIASEIVALAAK
Q0P9G9_CAMJE          LLLPVENLYLIDKYLGV-SGSIPSLDKLGK---TSFIKLKEKLKTKLLAIASEIVIMAAK
A0A0H3P9Q7_CAMJJ      LLLPVENLYLIDKYLGV-SGSIPSLDKLGK---TSFIKLKEKLKTKLLAIASEIVIMAAK
A7ZE35_CAMC1          LLLPVEHLNLIDRYIAQ-NGSMAVLDRLGK---ANFAKIKEKVREKLFAIASKIVAMAAK
E0UPP9_SULAO          ILLPVENLDFIDRYIAG-GGATPVLDRLGK---GSFGKLKAKVRKRLLEIAGQIVNTAAA
I0GL09_CALEA          LYVPLERIGFVEKYIGD-RRIVTLNSLKG----NDWAKTKEKAKESAKELAKKLLLIQAK
Q8RH90_FUSNN          LFVPVDSINKIEKFINI-SDVIPEIYKLGR---KGFKRKKAKLSEDIEIFAKEIIKIQAK
MFD_BORBU             LFIPIEQTNLIQKYIGS-DPKNIKLDKISS---KTWIKNKANAKKRIEEIADKLIELYSK
F0S455_DESTD          LYAPFTQIDRIYKYSGY-KGKSPKLDKLGG---TSWKNLERKIKASLINFAKELAELYKE
E1X1P6_HALMS          VYVPVYKMNLIQKHADG-NA-TISTDSLRT---NKFSNLKSKARNSAKKLAFDLLKLQAE
MFD_SYNY3             LRVPADSLDSLSRFRHT-GTRPPELHKMGG---KVWEATKNKVRKAVKKLAVDLLNLYAK
Q8DKA7_THEEB          LRVAADQLNSLSRYRTQ-EDRAPQLNKLTG---NTWERTKARVRKAIKKVAVDLLQLYAQ
Q7NEP2_GLOVI          LRVAADQMNSLSRYRST-GGTV-QLSRMGS---KSWEKTKQKVKKAIQKIAFDLLDLYAR
Q7VBU2_PROMA          LRVAADQLSSLGRYRNS-SDKSPRINKLGG---NTWTKAKERAKKSISRVAIDLIKLYAE
Q8F395_LEPIN          SLFVPLDQISLVQRYIG-GTESPRLDSLGK---STWKKTKDRVQKAVEALAEDLVQMYSN
B5YL15_THEYD          LYVPTWNIGKIYRYSAK-EGFIPPIDKLGS---NRWQKAKERERKRIHDIADKLIKLYAQ
A6GW35_FLAPJ          VYVSIHSLHKISKYTGK-DGAPPKIYKLGS---GAWKALKQKTKARVKHIAFNLIQLYAK
Q8AB59_BACTN          VFVSIHSLHKVSKYKGK-DGEAPRLNKLGT---GAWEKLKDRTKAKIKDIARDLIKLYSQ
Q2S6G5_SALRD          LYVNVHALHKLNKYTGK-EGHQPTLTKLGS---EQWEKKKQRTKDQVKEVARDLIKLYAK
Q8KEN4_CHLTE          LYVNVQNINLLSKYTAS-EGSLPNLSKLGS---SKWSAKKERVRKKLRDIAAKLIRVYAK
O84753_CHLTR          LYVPSDQAYLISRYVGA-SEKAPDLHHLNG---AKWRRSRELSEKSVILYAEKLIQMEAQ
M1WUP8_PSEP2          LFLPVDRLNLIQRFKGPEGSGTPSLDKLGG---TRWAKTTARVRKAIEKIAHGLVEMYAF
Q72AT7_DESVH          LYLPVDRLSLVQRFKGADDT-KPSLDRLGG---GAWQSSKDKARKAIEKIAADLVEMYAY
B9KVH0_RHOSK          LLVPVEEAGRIWRYGTGAD-VSLDRLNGS-----AWTNRRKKLDEGIAEAARALVSAAKE
B0UM39_METS4          RLAPLSEAGRIWRYGAAAEAVTLDRLDGGNLPGGTWATRRAGVEAAVAESARRMLALAEA
Q1YKV9_AURMS          LLVPMSDIGAVWRCGGASTDVTLDDLKGR-----TWQKRRDEIFGAISVTADRMVERLTE
E8TPS0_MESCW          LLVPVDDFGKIWRYGSEPEAVSLDRLNGE-----GWPKRREAALREIDRLAKRLVGLAEM
C6B9D3_RHILS          VLVPMEEFGKLWRYGSEPEAVTLDRLHTA-----AWQNKREKIAADIQSTARHLIKLAKH
A4YQE5_BRASO          ILVPIADLGLIWPYAGDPSGVKLDDADGR-----SWAARCLRAEDEIDRTAVRLSDQIRA
A5EAY9_BRASB          VLVPLAELALIWPYAAELGNTSLDKADGS-----SWRPRRAAAETEIHVVAKELAKQMRQ
D1B5L3_THEAS          LLMPTYRIARLYRYAGDPAEAELDSLKRG-----RWSRSYQEAKEKAREAAERLLSAQAR
Q9RU62_DEIRA          LSVPIEQLPILRRHPGTTDDPPQLSSFDKK----DWARAKEKARKNAEEVAAKLLVQYAA
Q5SJW3_THET8          LYLPVEQLPLLKRHPGTTDDPPELSSLGKN----EWQRAKERARKDVEELAGRLLVLQAK
I0IIW6_PHYMF          LRVPADQAARVFPFHAADDAPTPDPLNSRA-----WAKKLSAAEAAASAFVRAQRRAAAE
                                :                        :                        

MFD_MYCBO             RQASPGHAFSPDTPWQAELEDAFGFTETVDQLTAIEEVKADMEKPIPMDRVICGDVGYGK
MFD_MYCTU             RQASPGHAFSPDTPWQAELEDAFGFTETVDQLTAIEEVKADMEKPIPMDRVICGDVGYGK
Q8NRS9_CORGL          RQSAPGHPFAPDTPWQKEMEDNFPYVETEDQMLAIDAVKEDMEKSVPMDRVIIGDVGYGK
Q9F2P1_STRCO          RMAAPGHAFGSDTPWQRELEDAFPYVETPDQLTTIAEVKDDMEKTVPMDRLICGDVGYGK
Q8G5I7_BIFLO          RQRARGFAFSPDTPWQKELEDAFPYQETADQLTTIDEVKSDMEKPVPMDRLICGDVGFGK
Q83N19_TROWT          RSITKGYAFSPDTPFQTHFENEFLYTETRDQEKTIVAVKADMENSKPMDRIISGDVGFGK
MFD_MYXXA             RKAHPGHAFSAPDRYFAQFEADFEFEETPDQAKAIEDVLADMQKPEPMDRLVCGDVGYGK
Q74H75_GEOSL          RQLHEGHRFSPPDDLYREFEASFAYEETSDQLAAIEDVIADMTSNRPMDRLVCGDVGYGK
Q1IHV1_KORVE          RKTAKGHAFSATGQFEREFDDAFEFNETEDQENAIRDVRQDMESDTPMDRLLCGDVGYGK
Q2RMB9_MOOTA          REAIPGHAFGPDTPWQREFEEAFPYTETPDQLRAIAEVKADMEKPRPMDRLLCGDVGYGK
A9WHG9_CHLAA          RQLKSGYAFSPDNEWQRELEASFPYLETDDQLRAIAEVKADMEKPTPMDRLVCGDVGFGK
I0IRW8_LEPFC          RKALPGFPFSQDSVMISEFENAFPHDLTPDQEEATRDIREDMESPTPMDRLVLGEVGFGK
MFD_BACSU             REASKGYAFSPDHEMQREFESAFPYQETEDQLRSIHEIKKDMERERPMDRLLCGDVGYGK
Q8YAD0_LISMO          REAEKGYAFSADDEMQREFEEAFPYQETEDQLRSISEIKKDMERPRPMDRLLVGDVGYGK
Q839B9_ENTFA          RESEKGYAFPPDDAYQKEFEEAFPYSETDDQLRSAAEIKHDMEKSRPMDRLLVGDVGFGK
F9UL13_LACPL          REAEKGYAFPPDDSYQDDFDNDFPYPETPDQIRSINEIKHDMERPKPMDRLLVGDVGYGK
MFD_STAEQ             REMSVGYQYGQDTAEQSAFEHDFPYELTPDQSKSIDEIKGDMERARPMDRLLCGDVGYGK
MFD_STAES             REMSVGYQYGQDTAEQSAFEHDFPYELTPDQSKSIDEIKGDMERARPMDRLLCGDVGYGK
MFD_STAHJ             REMSVGYQYGEDTAEQSAFEMDFPYELTPDQAKSIDEIKGDMERERPMDRLLCGDVGYGK
MFD_STAA8             REMAEGYQYGEDTAEQTTFELDFPYELTPDQAKSIDEIKDDMQKSRPMDRLLCGDVGYGK
MFD_STAS1             REMSVGYKFGPDTAEQNDFEIDFPYELTPDQSKSIEEIKQDMEIERPMDRLLCGDVGYGK
Q9CJI0_LACLA          RQAKKGFAFSPDDTSQEEFDSGFSYVETEDQMRSINEIKHDMELERPMDRLLVGDVGFGK
Q8DRQ1_STRR6          RSQLKGFAFSADDDDQDAFDDAFPYVETDDQLRSIEEIKRDMQASQPMDRLLVGDVGFGK
Q97E98_CLOAB          RTTVNGFKYSKDTVWQKQFEEEFPYNETQDQLLAIDEIKNDMESGKVMDRLICGDVGYGK
A5I7R4_CLOBH          RATLKGYKYSDDTVWQKQFEEEFPYEETPDQLLAIEDIKRDMESPKPMDRLLCGDVGYGK
D3R0N9_MAGIU          RRKIKGYKFPPETTWEREFAESFPFEETDDQLRCIKEVSADMESDKVMDRLLCGDVGFGK
B8E2E1_DICTD          REITKGFAFSPDSPLQEELEASFPYIETEDQIKALREIKKDMESTKPMERVLIGDVGFGK
MFD_ECOLI             RAAKEGFAFKHDREQYQLFCDSFPFETTPDQAQAINAVLSDMCQPLAMDRLVCGDVGFGK
MFD_HAEIN             REAKKGFAFKYDREEFQQFSATFPFEETYDQEMAINAVISDMCQPKAMDRLVCGDVGFGK
Q8EEV8_SHEON          RQARPGESCEINDEEYAQFAQGFPFEETVDQESAIHAVLADMQSPTAMDRLVCGDVGFGK
Q9HZK3_PSEAE          RAAREGFAFKDPQADYATFSAGFPFEETPDQQSAIEAVVADMLAPRPMDRLVCGDVGFGK
Q83CG9_COXBU          RQAATGFTFSIPEKEYSLFRQAFPFEETPDQSAAINDVIVDMSSKRSMDRLICGDVGFGK
Q63T69_BURPS          RAAREGHAFGLDPRDYVKFADSFGFEETPDQAAAIAAVIGDMTSGKPMDRLVCGDVGFGK
Q7VZN3_BORPE          RAAREGYAFKLPMSDYEAFAEGFGFEETPDQAAAIQAVIMDMTSGRPMDRLVCGDVGFGK
Q8P7B3_XANCP          RRARAGLALQVDRAMYEPFAAGFPFEETTDQLAAIDATLRDLGSSQPMDRVVCGDVGFGK
Q5NH30_FRATT          REMRQGFSNSLDEEEYLRFCADFPYEETPDQLSAINDVFKDMISAKPMDRLICGDVGFGK
MFD_RICFE             RKLNSSASVEFDLEEYDKFCANFPFSETEDQLTAINDIKEDLRNGMLMDRLICGDVGFGK
MFD_RICCN             RKLNSSASVEFDLEEYDKFCANFPFSETEDQLIAINDIKEDLRNGMLMDRLICGDVGFGK
MFD_RICPR             RKLNISTPIELDLEAYDKFCANFPFSETEDQLTAINDIREDLTNGMLMDRLICGDVGFGK
MFD_RICTY             RKLNISTPIEFDLEEYDKFCANFPFIETEDQLTAINDIRKDLTNGMLMDRLICGDVGFGK
MFD_RICBR             RKLNTTAAIEFDLEEYDKFCAKFPFTETEDQLNAINDIREDLSNGMLMDRLICGDVGFGK
Q3YR59_EHRCJ          RKLSTGQIFCKD-ENYQHFCNEFSYTETEDQLQAIKDMEHDLSSGKIMNRLICGDVGFGK
Q2GLL6_ANAPZ          RKLADGSRFLPS-SLYIDFCKECPYVETEDQLKAIADVENDLARGKVMDRLICGDVGFGK
A9CIN2_AGRFC          RLVRHAPALIAPDGLYDEFAARFPYDETEDQLNAIEAVRDDLGAGRPMDRLICGDVGFGK
Q89LE3_BRADU          RHLHEAPKLPVQPGLYDEFCARFPYDETEDQLGAIESTLKDLELGRPMDRLICGDVGFGK
Q9A782_CAUVC          RQLKTVEETDPPSGVFDEFCARFPYEETDDQLSAIHDVLEDLSSGKPMDRLICGDVGFGK
Q2RTL9_RHORT          RQLKVGEVISPPEGLYDEFAARFPYAETDDQLRAIADTLDDLAAGRPMDRLICGDVGFGK
Q3J2M4_RHOS4          RHLRHAPILEAPHSLWEAFSARFPYQETDDQLSAIADVVKDLESGSPMDRLVVGDVGFGK
MFD_HELPY             RNLILGKKMDVHLAELEVFKSHAGFEYTSDQEKAIAEISKDLSSHRVMDRLLSGDVGFGK
MFD_HELPJ             RNLILGKKMDTHLAELEIFKSHAGFEYTSDQEKAIAEISRDLSSHRVMDRLLSGDVGFGK
Q7M928_WOLSU          RELIEGRAIRTDFPEIEIFQHSSGFVYTSDQEKSIREIFSDLEGGKVMDRLLSGDVGFGK
Q0P9G9_CAMJE          RSLVQAKKITVDLNRQTDFIASAGFIYTSDQDKACHEILQDFQSGKVMDRLLSGDVGFGK
A0A0H3P9Q7_CAMJJ      RSLVQAKKITVDLSRQADFITSAGFIYTSDQEKACHEILQDFQSGKVMDRLLSGDVGFGK
A7ZE35_CAMC1          RELIAGKILQKEDISYLNFVQDAGFSYTSDQQKAVNDIKDELKSGKVMDRLLSGDVGFGK
E0UPP9_SULAO          RALIKAPKISLGKKELQEFQALSGFEYTEDQTQAVNEILNQMSSGHIMDRLLSGDVGFGK
I0GL09_CALEA          RKIYKRPPFKPHPQEERILDLSFPYELTEDQMKAIEEVYADLEDTEPMDRLIVGDVGYGK
Q8RH90_FUSNN          RNLGNGFKFSKDTVMQEEFEETFPFTETPAQSKAIEDVKRDMESGKVMDRLICGDVGFGK
MFD_BORBU             RESIKGIKYPEDNELQLLFESEFPYDETPDQIRAIKEIKEDMMSFKVMDRLLCGDVGFGK
F0S455_DESTD          RKSAKGEKILGDENLLREFERRFPYKPTPDQLKAIREVYKDMESEKPMDRLICGDVGFGK
E1X1P6_HALMS          RQSSSGYSFSAPDQEYRDFEMAFPFQETPDQINAVNEVIESMQKPIAMDHLVCGDVGFGK
MFD_SYNY3             RAKQVGYAYPPDSPWQQELEDSFPYQPTPDQLKAVQDVKRDLEGDRPMDRLVCGDVGFGK
Q8DKA7_THEEB          RAQQRGFAFPPDTPWQREMEDSFPYQPTPDQLKAIQEVKADMESDRPMDRLVCGDVGFGK
Q7NEP2_GLOVI          RAQESRIPFPPDQPWQREMEESFPYPLTPDQARAIQEVKIDMESERPMDRLVCGDVGFGK
Q7VBU2_PROMA          RSNSQGFSFPKDGPWQRELEEAFPYEATPDQIKAVSEIKSDMEKSFPMDRLVCGDVGFGK
Q8F395_LEPIN          RLKLQGYAFPPDTIYQEEFEAEFEYEETPDQIEAIEAVKKDLESSRPMDRLVCGDVGYGK
B5YL15_THEYD          RKTERGFIYSEDTEIHKNFDDFFPYEETEDQQKAIDAILKKMREPFPMEVLLCGDAGYGK
A6GW35_FLAPJ          RRLDKGFAFAPDSYLQHELESSFIYEDTPDQLKSTQEVKADMESDRPMDRLVCGDVGFGK
Q8AB59_BACTN          RRQEKGFSYSPDSFLQRELEASFIYEDTPDQSKATMEVKADMESDRPMDRLVCGDVGFGK
Q2S6G5_SALRD          RKASDGYAFSSDTTWQREMEASFEFEDTPDQAEATKAVKRDMEEPVPMDRLVCGDVGFGK
Q8KEN4_CHLTE          RKMTPGFAFGPDSIFQREFEASFMFEETPDQLKAIQEVKKDMQSPSPMDRLICGDAGFGK
O84753_CHLTR          RSTANSFIYPPHGEEVIKFAESFPYEETPDQLKAIDQIYADMMSDKLMDRLICGDAGFGK
M1WUP8_PSEP2          RRVAKGFSYGPLDDMYAEFEATFGFEETPDQDKAVKDVFRDMEKAEPMDRLVCGDVGFGK
Q72AT7_DESVH          RKIAKGYTYGPIGELYREFEASFGFEETPDQARAIQDVLEDMDKPVPMDRLVCGDVGFGK
B9KVH0_RHOSK          RAAKSARSFEPPPDIYERFAGRFPFTLSADQRRAIAEVRDDLVAGRPMNRLVLGDVGFGK
B0UM39_METS4          RRRATAPALVPPERQMERFGAGFGFPPTPDQAAAIDAVMADLAAGRPMDRLVCGDVGFGK
Q1YKV9_AURMS          KAEAKAPKIVPDRVSFERFCARFAYELTADQNNACLDVLDDLASGRPMERLVCGDVGYGK
E8TPS0_MESCW          RSSQPAEIIKPSRADLARFAAKFPYTETPDQAAAIRAVLDDLSSGRTMNRLVCGDVGFGK
C6B9D3_RHILS          RQASRAEAFVPPRAGFSAFTRRFPFTETHDQAEAIRSVLSDLATGRAMNRLVCGDVGFGK
A4YQE5_BRASO          RRRAEAPRIVAPAVEYERFVARFPYLVTPDQAAAIEDVLKDLGAGHPMDRIVCGDVGFGK
A5EAY9_BRASB          RRRRPAPKLVPRPAAYEKFVARFPYFTTPDQAKAIRDVLDDLASGHPMDRIVCGDVGFGK
D1B5L3_THEAS          RHSARGIAFDPLEREMEELRSTFPYRETVDQVRCWEEIRADMERPVPMDRLLVGDVGFGK
Q9RU62_DEIRA          RQVTPGNAFDPQPEWDEQVEKNFEFELTKDQVTALKETMRDLEKPTPADRLISGDVGFGK
Q5SJW3_THET8          RKATPGRAFPPLPEWDPLVEKGFPYELTPDQKRALEEVLRDLESPHPMDRLVSGDVGFGK
I0IIW6_PHYMF          AADRPGRAHPPEPDRLRAFEADFPFEPTPDQAEAFAAVAADLEAEIPMDRLVCGDVGFGK
                                        .     .  :  *         .:      : :: *:.*:**

MFD_MYCBO             TEIAVRAAFKAVQDG-------KQVAVLVPTTLLADQHLQTFGERMSGF-PVTIKGLSRF
MFD_MYCTU             TEIAVRAAFKAVQDG-------KQVAVLVPTTLLADQHLQTFGERMSGF-PVTIKGLSRF
Q8NRS9_CORGL          TEVAVRAAFKAVQDG-------KQVAVLVPTTLLAQQHQSTFEERMTGF-PVTIKGLSRF
Q9F2P1_STRCO          TEIAVRAAFKAVQDG-------KQVAVLVPTTLLVQQHFGTFSERYAQF-PVSVKALSRF
Q8G5I7_BIFLO          TEIALRAAFKAVQDG-------KQVAVLVPTTLLVQQHYETFRERFEGF-PVNVAAMSRF
Q83N19_TROWT          TEIAMRAAFKAVQDN-------KQVAVLVPTTLLARQHIQTFCERFDKW-PVTIASLSRF
MFD_MYXXA             TEVAMRAAFKAALDR-------KQVAVLVPTTVLAQQHFLSFKKRFADY-PVTVEVISGL
Q74H75_GEOSL          TEVAMRGAFKAVMDG-------KQVAVLVPTTVLAQQHLETFRARLGAY-PVTIEMVSRF
Q1IHV1_KORVE          TEVSMRAAFKAVSDN-------KQVAVLAPTTVLAFQHFETFKRRFSAF-PVKVEMISRF
Q2RMB9_MOOTA          TEVAMRAAFKAVMDG-------MQVAVLVPTTILAQQHYETFKARFAPF-PVKIAVLSRF
A9WHG9_CHLAA          TEVALRAAFKAVQDG-------KQVAILVPTTVLAQQHFDTFRKRMAAF-PVTVEMLSRF
I0IRW8_LEPFC          TEVAMRAAFKAVADG-------KQVAVLVPTTLLCLQHFETFKERFSGF-PVRVEQISRI
MFD_BACSU             TEVAIRAAFKAIGDG-------KQVALLVPTTILAQQHYETIKERFQDY-PINIGLLSRF
Q8YAD0_LISMO          TEVALRAAFKAIMDG-------KQVAFLVPTTILAQQHFETMKERFQGF-PIEIGLLSRF
Q839B9_ENTFA          TEVALRAAFKAVSNN-------KQVAFLVPTTILAQQHYETIQERFEGF-PVEIGLLSRF
F9UL13_LACPL          TEVALRAAFKAIEAG-------KQVAFLVPTTILAQQHYETMLNRFEGY-PINVGMLSRF
MFD_STAEQ             TEVAVRAAFKAVMDG-------KQVAFLVPTTILAQQHYETLLERMQDF-PVEIQLVSRF
MFD_STAES             TEVAVRAAFKAVMDG-------KQVAFLVPTTILAQQHYETLLERMQDF-PVEIQLVSRF
MFD_STAHJ             TEVAVRAAFKAVMEG-------KQVAFLVPTTILAQQHYETLIERMQDF-PVQIELISRF
MFD_STAA8             TEVAVRAAFKAVMEG-------KQVAFLVPTTILAQQHYETLIERMQDF-PVEIQLMSRF
MFD_STAS1             TEVAVRAAFKAVMEG-------KQVAFLVPTTILAQQHYETLIERMQDF-PIEVQLISRF
Q9CJI0_LACLA          TEVAMRAAFKAINDG-------KQVAVLVPTTVLAEQHFNNFTERFINF-GVNVEVLSRF
Q8DRQ1_STRR6          TEVAMRAAFKAVNDH-------KQVVILVPTTVLAQQHYTNFKERFQNF-AVNVDVLSRF
Q97E98_CLOAB          TEVAIRAAFKTVMDG-------KQVAFLVPTTILAEQHYNNFKKRFKDF-PVEVDMVSRF
A5I7R4_CLOBH          TEVAIRAAFKAVMDG-------KQVAFLVPTTILAQQHYNNFKQRFSDF-PITVDVISRF
D3R0N9_MAGIU          TEVAFRALFKAVMGG-------KQAALLAPTTVLAQQHYENFMNRINGF-PIRVGLLSRF
B8E2E1_DICTD          TELALRASFKAVLDG-------KQVAILVPTTILAYQHWKVFKERLEVF-PVNVEILSRL
MFD_ECOLI             TEVAMRAAFLAVDNH-------KQVAVLVPTTLLAQQHYDNFRDRFANW-PVRIEMISRF
MFD_HAEIN             TEVAMRAAFLAVMNH-------KQVAVLVPTTLLAQQHYENFKDRFANL-PVNVEVLSRF
Q8EEV8_SHEON          TEVAMRAAFVAVNDG-------KQVVVLVPTTLLAQQHYENFKDRFADW-PVVIEVMSRF
Q9HZK3_PSEAE          TEVAMRAAFVAVHSG-------KQVAVLVPTTLLAQQHYNSFRDRFADW-PVSVEVMSRF
Q83CG9_COXBU          TEVAMQAAFIAVQNN-------KQVAVLVPTTLLAEQHFYNFQDRFADW-PVRIAAISRL
Q63T69_BURPS          TEVALRAAFIAVMGG-------KQVALLSPTTLLAEQHTQTFADRFADW-PVRIVELSRF
Q7VZN3_BORPE          TEVALRAAFLAVANG-------KQVALLCPTTLLAEQHAQTFSDRFADW-PVRVVELSRF
Q8P7B3_XANCP          TEVAVRAAFAAASAG-------KQVAVLVPTTLLAEQHYRNFRDRFADY-PMKVEVLSRF
Q5NH30_FRATT          TEIAMRAAFLATQNQ-------KQVAILVPTTILAQQHYNSFKDRFTNT-AFNIEVITRS
MFD_RICFE             TEVAMRAVFMVAKSLNEHL---PQVAVVVPTTILCSQHFSRFIERFKGF-GLNIKQLSSV
MFD_RICCN             TEVAMRAVFMVAKSLNEHL---PQVAVVVPTTILCSQHFSRFIERFKGF-GLNIKQLSSV
MFD_RICPR             TEVAMRAVFMVAKSLNEYL---PQVAVVVPTTILCSQHFSRFIERFKGF-GLNIKQLSSV
MFD_RICTY             TEVAMRAVFMVAKSLNEYL---PQVAVVVPTTILCSQHFSRFIERFKGF-GLNIKQLSSV
MFD_RICBR             TEVAMRAAFMVAKSLNENS---PQVAVVVPTTILCSQHFARFTERFKDS-DLNIKQLSSV
Q3YR59_EHRCJ          TEIALRAAFLVANKN-------YQVAVIVPTTLLCRQHFIVFTERFKKFPNIKIKQLSKI
Q2GLL6_ANAPZ          TEIALRAAFLVVNEDIT-----CQVAVLVPTTLLCRQHFLAFKERFKNY-KVNIQQLSKA
A9CIN2_AGRFC          TEVALRAAFLAAMNG-------VQVAVVVPTTLLARQHFRTFSERFRGL-PIRVQQASRL
Q89LE3_BRADU          TEVALRAAFAVALEG-------KQVAVVVPTTLLARQHARTFTERFKGF-PVNVAQASRL
Q9A782_CAUVC          TEVALRAAFVVAMSG-------KQVAIVCPTTLLARQHYKTFKDRFQGW-PVKVTRLSRL
Q2RTL9_RHORT          TEVALRAAFATAMSG-------RQVAVVVPTTLLARQHHLTFKERFAGL-PVRIGQLSRL
Q3J2M4_RHOS4          TEVAMRAAFVAALAG-------MQVAVICPTTLLARQHFRSFAERFRGF-PMKVHQLSRF
MFD_HELPY             TEVAMHAIFCAFLNG-------FQSALVVPTTLLAHQHFETLRARFENF-GVKVARLDRY
MFD_HELPJ             TEVAMHAIFCAFLNG-------FQSALVVPTTLLAHQHFETLKARFENF-GVKVARLDRY
Q7M928_WOLSU          TEVAMNAILATVMSG-------YQAALVAPTTLLAHQHFQSLKKRFEGR-GIKMARLDRF
Q0P9G9_CAMJE          TEVAMNAIYPVVKSG-------FCAFLFAPTTLLSHQHYKTLKKRFDPF-DIKVFKLDRF
A0A0H3P9Q7_CAMJJ      TEVAMNAIYPVVKSG-------FCAFLFAPTTLLSHQHYKTLKKRFDPF-DIEVFKLDRF
A7ZE35_CAMC1          TEVAMNAIFTCIKSG-------FSAFFFVPTTLLSSQHYKTLSQRFSKF-GIKVFRLDRF
E0UPP9_SULAO          TEIALNTIYAACQSG-------YQSAFIVPTTLLSAQHWRSLDERFKDL-GIRYAKMDRF
I0GL09_CALEA          TEVAIRASLRVVLNG-------KKVMVLAPTTILAMQHERTFKERLRLF-PVRIEMLSRL
Q8RH90_FUSNN          TEVAIRATFKAVMDG-------KQVILLVPTTVLAEQHYERFSERFKNY-PVHIEILSRV
MFD_BORBU             TEVAMRAAFKAVMGN-------KQVIVLSPTTILAEQHFNTFKKRFKNF-PIKIEVLSRF
F0S455_DESTD          TEVAMRAAMKAVTDG-------RQVAVIVPTTILADQHYRTFKKRFKGF-PVKIEAISRF
E1X1P6_HALMS          TEVAMRAAFKAVLDK-------KQVCVLVPTTVLALQHYNSFVKRFSKF-PVEIEFLSRF
MFD_SYNY3             TEVAVRAIFKAVTSGN------KQVALLAPTTVLTQQHYHTLKERFAPY-PITIGLLNRF
Q8DKA7_THEEB          TEVAIRAIFKAVMAG-------KQVAVLAPTTILTQQHYHTLKERFAPY-PIQVGLLNRF
Q7NEP2_GLOVI          TEVAIRAAFKALTSG-------VQCAVLVPTTVLASQHYHTFKERFAPY-PISIGLLNRF
Q7VBU2_PROMA          TEVAIRALFKAITAG-------KQVAILAPTTVLAQQHWRTLTDRFAPY-PIKVSLLNRF
Q8F395_LEPIN          TEVAIRAAFKVAMAG-------RQIMMLAPTTILALQHYNTFKNRFENY-PVRVELVSRF
B5YL15_THEYD          TEVAMRASFRAVYDG-------KQVAVLVPTTLLCEQHYRTFKKRFEAF-PVKIEYLSRF
A6GW35_FLAPJ          TEVAIRAAFKAVDNG-------KQVAILVPTTILAYQHYRTFTERLKDM-PVTINYLNRF
Q8AB59_BACTN          TEVAIRAAFKAVADN-------KQVAVLVPTTVLAYQHFQTFRERLKGL-PCRVEYLSRA
Q2S6G5_SALRD          TEVAVRAAFKAVQDG-------KQVAMLVPTTILAQQHHDTFSERMERF-PVNVEVLSRF
Q8KEN4_CHLTE          TEIAMRAAFKAVENK-------KQVAILTPTTILTHQHGESFARRFANF-PVNIAVLSRF
O84753_CHLTR          TEIIMRAAVKAVCDGH------KQVIVMVPTTILANQHFETFSQRMAGL-PITIGLLSRF
M1WUP8_PSEP2          TEVALRAAFRAALEG-------LQTALLCPTTVLAEQHYQTFSKRMEGF-PVRIGLLSRF
Q72AT7_DESVH          TEVALRAAFRAASEG-------RQVALLCPTTVLAEQHYQTFRSRLAGF-PVNVGMLSRF
B9KVH0_RHOSK          TEIALRAAAAVALSG-------AQVALVAPSTVLARQHAETFRRRFEGF-GVTVAHLSRL
B0UM39_METS4          TEVALRAAAAALFAG-------KQVAVAAPTTVLVRQHVETFRRRFARF-GIVPAQLSRL
Q1YKV9_AURMS          TEVALRAAAAAVFSG-------RQVAVIAPTTVLAQQHFREFSARFGAQ-GVEIVRLSRL
E8TPS0_MESCW          TEVALRACAAAALCG-------KQVAVIAPTTVLARQHYETFSRRFAGT-GLQVAHLSRM
C6B9D3_RHILS          TEIALRAAAAVALAG-------GQVVVIAPTTVLTRQHFATFTRRFAGT-GVSVGMLSRL
A4YQE5_BRASO          TEIALRAAAATVFAG-------RQVALIVPTTVLAAQHVQTFVKRFAPF-GISVGHLSRL
A5EAY9_BRASB          TEVALRAAAAAVLAG-------KQVAIVVPTTVLARQHFETFRKRFAPL-GFDVGNLSRV
D1B5L3_THEAS          TELALRAAFKAAMSG-------YQVVVVTPTTLLASQHLSTFASRLSPF-PLRVEALYRF
Q9RU62_DEIRA          TEVALRAAHRVVGHG-------KQVAVLVPTTLLAEQHTATFVERFKGL-PVRVEGLSRF
Q5SJW3_THET8          TEVALRAAHRVVGHG-------AQVAFLVPTTLLAEQHGKTFRERFQGL-PVRVAVLSRF
I0IIW6_PHYMF          TEVAARAIFRVVRPRRRGGRRGHQAVLLAPTTVLAEQHGRSLAERLGPH-GVSVGVLSRL
                      **:  .                    .  *:*:*  **   :  *               

MFD_MYCBO             TDAAESRAVIDGLADGSVDIVIGTHRLLQTGVRWKDLGLVVVDEEQRFGVEHKEHIKSLR
MFD_MYCTU             TDAAESRAVIDGLADGSVDIVIGTHRLLQTGVRWKDLGLVVVDEEQRFGVEHKEHIKSLR
Q8NRS9_CORGL          TSPAESREILSGLAAGSVDIVIGTHRLLQTGVQWKNLGLVIVDEEQRFGVEHKEHIKALR
Q9F2P1_STRCO          QSDTESKATLEGLREGSVDIVIGTHRLFSSETKFKDLGLVIVDEEQRFGVEHKEQLKKLR
Q8G5I7_BIFLO          QTTKEINETIEGLETGTVDVVIGTHKLLNPKIKFKDLGLVIIDEEQRFGVEHKETLKALR
Q83N19_TROWT          QSKSEIQKTICGISSGGIDIVIGTHMLLNKKIQFKDLGLLIIDEEHRFGVNHKEAIKKLK
MFD_MYXXA             KKAPEVREILKRAKEGKVDILIGTHKLLGGEVAFKELGLMIVDEEQRFGVKQKESLKKWR
Q74H75_GEOSL          RTPKEQKDILERVKKGTVDVIIGTHRLLQNDVTFKDLGLLIVDEEQRFGVTHKEKLKKYK
Q1IHV1_KORVE          RTAKQQKEIVERVNNGQVDILIGTHRVLSKDIHFPDLGLVVIDEEQRFGVRHKERLKQLR
Q2RMB9_MOOTA          CSPREQKVVVEALKRGEVDIVIGTHRLLSSDVNFKNLGLVIIDEEQRFGVAHKEKLKQLR
A9WHG9_CHLAA          RSPKEQDAIIRDLARGKIDIIIGTHRLLSNDVVFRNLGLVIIDEEQRFGVRHKERLKLMR
I0IRW8_LEPFC          LTAKEQRLLRQDLSEGKIDIMIGTSALLGAQNIFRDLGLLIIDEEQRFGVGHKEKLKNKY
MFD_BACSU             RTRKEANETIKGLKNGTVDIVIGTHRLLSKDVVYKDLGLLIIDEEQRFGVTHKEKIKQIK
Q8YAD0_LISMO          RTKKQQTETLKGMKNGTVDVVVGTHRLLSKDVEYQDLGLLIVDEEQRFGVTHKEKIKQMR
Q839B9_ENTFA          RTKKQQNETIEKIKHGQVDIVIGTHRLLSQDINFSDLGLLIIDEEQRFGVKHKERLKQLR
F9UL13_LACPL          RTTKEMKETVQQLKSGEIDIVVGTHRLLSKDVAFADLGLLIIDEEQRFGVKHKERLKALK
MFD_STAEQ             RTAKEIRETKEGLKSGYVDIVVGTHKLLGKDIQYKDLGLLIVDEEQRFGVRHKERIKTLK
MFD_STAES             RTAKEIRETKEGLKSGYVDIVVGTHKLLGKDIQYKDLGLLIVDEEQRFGVRHKERIKTLK
MFD_STAHJ             RSTKEVKETKEGLKSGYVDIVVGTHKLLGKDIHYKDLGLLIVDEEQRFGVRHKERIKTMK
MFD_STAA8             RTPKEIKQTKEGLKTGFVDIVVGTHKLLSKDIQYKDLGLLIVDEEQRFGVRHKERIKTLK
MFD_STAS1             RTTKEVKETKEGLKSGFVDIVVGTHKLLGKDIQYKDLGLLIVDEEQRFGVRHKERIKSLK
Q9CJI0_LACLA          QTKTQQTEILAKLKKGRVDLIIGTHRLLSKDVEFFDLGLMIIDEEQRFGVKHKERLKELK
Q8DRQ1_STRR6          RSKKEQTATLEKLKNGQVDILIGTHRVLSKDVVFADLGLMIIDEEQRFGVKHKETLKELK
Q97E98_CLOAB          RSQAQQKATFKALKEGNIDIIIGTHRILNKEITFKDLGLLIIDEEQRFGVSHKEKLKKFK
A5I7R4_CLOBH          RTLSEQKATIKSIKEGNVDILIGTHRILQKDIKFKDLGLLIIDEEQRFGVKHKEKMKNLK
D3R0N9_MAGIU          ANDAMQHKTLSGLATGNIDVVIGTHRLLSKDVKFKKLGLLIIDEEQRFGVEHKEKLKVNY
B8E2E1_DICTD          KPKSEQKRIIEKIRKGEIDIIIGTHRILQKDVEFKDLGLIIVDEEHRFGVLQKEAFKKKY
MFD_ECOLI             RSAKEQTQILAEVAEGKIDILIGTHKLLQSDVKFKDLGLLIVDEEHRFGVRHKERIKAMR
MFD_HAEIN             KTAKEQKQILENLAEGKVDILIGTHKLIQSDVKFNDLGLLIIDEEHRFGVGQKEKIKQLR
Q8EEV8_SHEON          RTAKEQTQVLKQLEEGKVDIVIGTHKLLQSEAKFENLGLLIIDEEHRFGVRQKEKIKALR
Q9HZK3_PSEAE          KSAKEVENAARLLAEGKIDILIGTHKLLQEDVKFANLGLVVIDEEHRFGVRQKEQLKALR
Q83CG9_COXBU          RTQKQRQQITQELAEGKIDIIIGTHKLLSKDIRFKDLGLLIVDEEHRFGVTQKERIKSLR
Q63T69_BURPS          KTAKEVNAAIAQINEGSVDIVIGTHKLLSSDVQFKRLGLVIIDEEHRFGVRQKEALKALR
Q7VZN3_BORPE          RSAKEVAAAVEGINDGRVDIVIGTHKILSKDVRFKRLGLVIIDEEHRFGVRQKETLKALR
Q8P7B3_XANCP          KSTKEIKAELEKVASGDIDVIIGTHRLLQPDVKFKDLGLVVVDEEQRFGVRQKEALKAMR
Q5NH30_FRATT          KTPKAQQQLFEDLKKGTIDIIIGTHKLISSKIDFKNLGLLIIDEEHRFGVAQKEKLKSLK
MFD_RICFE             ISAKEAKIIRSELESGKINIIIGTHSLLHKNTKFFNLKLLIIDEEQHFGVGQKEFLKSLK
MFD_RICCN             ISSKEAKIIRSELESGKINIIIGTHSLLHKNIKFFNLKLLIIDEEQHFGVGQKEFLKSLK
MFD_RICPR             ISSKEANIIRLELASGKINIIIGTHALLHKNTKFFNLKLLIIDEEQHFGVSQKEFLKSLK
MFD_RICTY             VSSQEANIIRLELASGKINIIIGTHTLLHKNIKFFNLKLLIIDEEQHFGVSQKEFLKSLK
MFD_RICBR             VSSKEAKIVRSELESGKINIIIGTHSLLHKVTKFCNLKLLIIDEEQHFGVGQKEFLKSLK
Q3YR59_EHRCJ          VERSEIKKTKESLSCGQVQIIIGTHAILAKDVTFANLSLLIIDEEQQFGVKQKESLKKIK
Q2GLL6_ANAPZ          TAK-KKQQIREGLEEGSINIIIGTSALLSDSIQFLDLRLLIIDEEQHFGVQQKEKLRLLK
A9CIN2_AGRFC          VGSKELALTKKEVAEGKTDIVVGTHALLGAGISFANLGLLIIDEEQHFGVKHKERLKELK
Q89LE3_BRADU          IPTKELNQVKKGIADGSVDIVVGTHALLGKAIKFRDLGLVIVDEEQHFGVTHKERLKALR
Q9A782_CAUVC          VTGKEAAETREGLANGQFEIVVGTHAILSKQVSFKDLGLVIVDEEQHFGVKHKEKLKELR
Q2RTL9_RHORT          VTARDTKAVKEEMAAGTLDIVVGTHALLAKTVRFRDLGLLIVDEEQHFGVAHKERLKQMR
Q3J2M4_RHOS4          VSAREAAETRSGLADGTVDICIGTHALLAKGVKLKNLGLLIIDEEQHFGVSHKERLKEMR
MFD_HELPY             --ASEKNKLLKAVELGQVDALIGTHAILG--AKFKNLGLVVVDEEHKFGVKQKEALKELS
MFD_HELPJ             IKTSEKSKLLKAVELGLVDVLIGTHAILG--TKFKNLGLMVVDEEHKFGVKQKEALKELS
Q7M928_WOLSU          LSSKERTSLLNALKEGEVDVVVGTHAILS--AVFKRLALIIVDEEHKFGVKQKERIKAIA
Q0P9G9_CAMJE          TSSAEKKQVLQNLKENKACVVVGTHALLS--VECENLALVIIDEEHKFGVKQKEKLKEIT
A0A0H3P9Q7_CAMJJ      TSSAEKKQVLQNLKENKACVVVGTHALLS--VECENLALVIIDEEHKFGVKQKEKLKEIT
A7ZE35_CAMC1          SSAKEKSNLQKALKENEPIVCVGTHALLS--VKAENLGLIVVDEEHKFGVKQKEQLKEIS
E0UPP9_SULAO          VSTKDKNAIIKGLASGEIDCVVGTHTLFG--LEFKKLGVVIIDEEHKFGVKQKEKIKELY
I0GL09_CALEA          TNTKKEKEILKDLKDGKIDIVIGTHRLLSKDVEIKDLGLLIIDEEQKFGVKHKEIIKELR
Q8RH90_FUSNN          QSKKEQTESLKRIENGSADLVIGTHRLLSDDIKFKDVGLLIIDEEQKFGVKAKEKLKKIK
MFD_BORBU             IKNNAESRILKELKSGKIDIIIGTHKILSKKFTCKNLGLIIIDEEQRFGVKEKEKLKEIR
F0S455_DESTD          KTKKEQKEILEKLKNGEIDIIIGTHRLTQDDVEFKNLGLLIIDEEHRFGVKTKEKLTKIK
E1X1P6_HALMS          KTAKQTKEVIEKLKDGKIDILIGTHKLLSDKIKYQDLGLVIVDEEQRFGVAHKEKLKLLK
MFD_SYNY3             RTASEKKEILAKLKSGELDIVVGTQQVLGTSVKFKDLGLLVIDEEQRFGVNQKEKIKTLK
Q8DKA7_THEEB          RSERERQDLLQKLKIGEIDVVVGTHQLLSNSVKFRDLGLLVVDEEQRFGVNQKEKIKALK
Q7NEP2_GLOVI          RTASEKKDLLARLATGELDLVIGTHQLLGAGVRFQNLGLLVIDEEQRFGVAQKEKIKTLK
Q7VBU2_PROMA          KSSSEKKEIAKSLKNGTIDAIVGTHLLLSKNIEYKDLGLLVVDEEQRFGVNQKEKIKSLK
Q8F395_LEPIN          KTPAEIRDILADFSAGKVDMVVGTHAILSSKLKPKNLGLLIIDEEQRFGVNHKETIKKFK
B5YL15_THEYD          RSEKEIKKVIEDTKLGKVDILIGTHIIILKEVDFFDLGLLIIDEEQKFGVIHKEKIKEKY
A6GW35_FLAPJ          KTAKQKAETLKDLEAGKVDIVIGTHQLVSKNVIFKDLGLLIVDEEQKFGVNVKDKLKTIT
Q8AB59_BACTN          RTAAQSKAVLKGLKEGEVSILIGTHRILGKDVQFKDLGLLIIDEEQKFGVSVKEKLRQLK
Q2S6G5_SALRD          RSRTEQSKVLEKLEKGQVDILIGTHRITSDDITFDDLGLLVVDEEQRFGVKTKEKLRKMR
Q8KEN4_CHLTE          VPRKEQKETIERIASGAMDIVIGTHRLVSKDVVFKDLGLLVIDEEQHFGVEVKEKLRHQF
O84753_CHLTR          SQGKTMKKTLEDIAQGRIDILIGTHKVINKAIEFHNPGLLIIDEEQRFGVKAKDSLKERF
M1WUP8_PSEP2          VSRKRQKTVLEAAARGEIDILIGTHRLLSKDVELPNLGLLILDEEQRFGVKHKEKLKHFR
Q72AT7_DESVH          VSKQKQTEVLAAAAKGHVDILIGTHRLLSDDVRLPNLGLLVLDEEQRFGVRHKEKLKQFR
B9KVH0_RHOSK          VPSKEAKAARDGLRDGSIRIVVGTHALLGKGVAFADLGLLIVDEEQRFGAAHKARLRALG
B0UM39_METS4          VPPAEAKRVRAGLADGSVRLVIGTHALAGRGLVYADLGLVVIDEEQRFGAAQKARLRRAA
Q1YKV9_AURMS          VGKDEADAAKAAMQDGTAKIVVGTHAILSGDVAFDDLALVIIDEEQRFGSEQKAAMRTLA
E8TPS0_MESCW          VGAAKAKAAKEGLRSGQVTIVVGTQALASRSVTFANLGLLVIDEEHRFGVKLKLALRNMA
C6B9D3_RHILS          LKPREAKKVKAALAVGEIGVIVTTQAILAKDVRFAHLALVIVDEEHRFGLKEKRAMNTLV
A4YQE5_BRASO          STTADARSTRRQLADGTLKLVIGTTALAADDVRFADLGLVIVDEEQHFGAADKARLSALR
A5EAY9_BRASB          ASAADARDVRERLKSGELRIVVGTLSLASKEVKFADLGLIIIDEEQHFGAAEKAMLSNLN
D1B5L3_THEAS          VPRSRQEEILNDFAEGRVDILIGTHRILGDDVRARNLGLIVLDEEHRFGVMQKERWRERF
Q9RU62_DEIRA          TTDKQARNILAELKAGRVDILIGTHRLLSGDIEFKDLGLIIVDEEHRFGVGQKEKLRQLR
Q5SJW3_THET8          TPPKEEEAILKGLAEGTVDIVIGTHRLLQEDVRFRDLGLLIVDEEHRFGVAQKERIRELK
I0IIW6_PHYMF          RPADEQKQLKAGLAGGTLDLLIGTTALLGEGIEPDDLGLVVIDEEHRFGSGDKEALRRLR
                                     .     : *  :           ::::***::**   *       

MFD_MYCBO             T----------------HVDVLTMSATPIPRTLEMSLAGIREMSTILTPPEERYPVLTYV
MFD_MYCTU             T----------------HVDVLTMSATPIPRTLEMSLAGIREMSTILTPPEERYPVLTYV
Q8NRS9_CORGL          T----------------HVDVLTMSATPIPRTLEMSMAGIREMTTMLTPPEDRHPILTYV
Q9F2P1_STRCO          A----------------NVDVLTMSATPIPRTLEMAVTGIREMSTITTPPEERHPVLTFV
Q8G5I7_BIFLO          T----------------NVDVLSLSATPIPRTLEMAVTGIREMSTLATPPEDRLPVLTYV
Q83N19_TROWT          I----------------GIDILAMSATPIPRTLEMSLMGIKEISTLSTPPENRMPILTHV
MFD_MYXXA             S----------------QIDVLTLTATPIPRTLHMSMSGVRDMSIIATPPQDRRAIRTFV
Q74H75_GEOSL          A----------------AVDILTLTATPIPRTLYMSLMGIRDLSIIDTPPVDRLAVKTFV
Q1IHV1_KORVE          K----------------EVDVLTMSATPIPRTLHMSLLGLRDMSVIETPPKDRMAIQTVV
Q2RMB9_MOOTA          Y----------------SVDVLTMTATPIPRTLHMSLAGVRDMSMIETPPEDRFPVQTYV
A9WHG9_CHLAA          T----------------EVDVLTLTATPIPRTLHMALAGIRDLSVIDTPPEDRIPIKTYV
I0IRW8_LEPFC          P----------------TVDVLTLSATPIPRTLQMSLSGLRGISFIMTPPPGRKPIKTAI
MFD_BACSU             A----------------NVDVLTLTATPIPRTLHMSMLGVRDLSVIETPPENRFPVQTYV
Q8YAD0_LISMO          S----------------KIDVLTLTATPIPRTLHMSMLGVRDLSVIETPPANRFPVQTYV
Q839B9_ENTFA          S----------------QVDVLTLTATPIPRTLHMSMLGVRDLSVIETPPENRYPIQTYV
F9UL13_LACPL          A----------------SVDVLTLTATPIPRTLHMSMLGVRDLSVIETPPTNRYPIQTYV
MFD_STAEQ             K----------------NVDVLTLTATPIPRTLHMSMLGVRDLSVIETPPENRFPVQTYV
MFD_STAES             K----------------NVDVLTLTATPIPRTLHMSMLGVRDLSVIETPPENRFPVQTYV
MFD_STAHJ             T----------------NVDVLTLTATPIPRTLHMSMLGVRDLSVIETPPENRFPVQTYV
MFD_STAA8             H----------------NVDVLTLTATPIPRTLHMSMLGVRDLSVIETPPENRFPVQTYV
MFD_STAS1             N----------------NVDVLTLTATPIPRTLHMSMLGVRDLSVIETPPENRFPVQTYV
Q9CJI0_LACLA          T----------------QVDVLTLTATPIPRTLHMSMLGIRDLSVIETPPTNRYPVQTYV
Q8DRQ1_STRR6          K----------------QVDVLTLTATPIPRTLHMSMLGIRDLSVIETPPTNRYPVQTYV
Q97E98_CLOAB          K----------------NIDVLTLSATPIPRTLHMSLTGVRDISVIETPPEERYPVQTYV
A5I7R4_CLOBH          K----------------NVDVLTLSATPIPRTLHMSLVGVRDISVIETPPEERYPVQTYV
D3R0N9_MAGIU          Q----------------GVDVLTLSATPIPRTLHMALSGIRDISVIEEAPLDRRSVLTYV
B8E2E1_DICTD          P----------------HVDILYLSATPIPRTLSMVLSGIRQFSVLETPPENRLPIQTFV
MFD_ECOLI             A----------------NVDILTLTATPIPRTLNMAMSGMRDLSIIATPPARRLAVKTFV
MFD_HAEIN             A----------------NIDILTLTATPIPRTLNMAMNGIRDLSIISTPPARRLSIKTFV
Q8EEV8_SHEON          A----------------NVDILTLTATPIPRTLNMAMSGMRDLSIIATPPAKRLAVKTFV
Q9HZK3_PSEAE          S----------------EVDILTLTATPIPRTLNMAVSGMRDLSIIATPPARRLSVRTFV
Q83CG9_COXBU          A----------------HVDILTLTATPIPRTLNMSLSGIRDLSLITTPPAKRLSVKTFV
Q63T69_BURPS          A----------------EVDVLTLTATPIPRTLGMALEGLRDFSVIATAPQKRLAIKTFV
Q7VZN3_BORPE          A----------------EVDVLTLTATPIPRTLGMSLEGIRDFSVIATAPQKRLAIKTFV
Q8P7B3_XANCP          A----------------NVHLLTLTATPIPRTLNMAMAGLRDLSIIATPPPNRLAVQTFI
Q5NH30_FRATT          A----------------EIDILTMSATPIPRSLSMAFSALRDLSIIASPPAKRLSVKTFV
MFD_RICFE             S----------------SSHVLAMSATPIPRTLQMSMTGLKELSIIATPPLNRLEVRTMV
MFD_RICCN             S----------------SSHVLAMSATPIPRTLQMSMTGLKELSIIATPPLNRLEVHTSV
MFD_RICPR             S----------------STHVLAMSATPIPRTLQMSMTGLKELSIIATPPLNRLEVRTSV
MFD_RICTY             Y----------------SSHVLAMSATPIPRTLQMSLTGLKELSIIATPPLNRLEVRTSV
MFD_RICBR             S----------------STHVLAMSATPIPRTLQMSMTGLKELSIIATPPLNRLEVRTSV
Q3YR59_EHRCJ          T----------------NVHVISLSATPIPRTLYMSLCGIKDLSLIKTSPKNRLPVTICT
Q2GLL6_ANAPZ          H----------------DVHVLSLSATPIPRTLHMSLSNIKDLSILRTPPIGRTTVEISI
A9CIN2_AGRFC          S----------------DVHVLTLSATPIPRTLQLAMTGVRELSLITTPPVDRMAVRTFI
Q89LE3_BRADU          S----------------EVHVLTLSATPIPRTLQLALTGVRELSIIASPPVDRLAVRTFV
Q9A782_CAUVC          A----------------DVHMLTLTATPIPRTLQMALSGIREMSIIATPPVDRLAVRTYI
Q2RTL9_RHORT          A----------------DVHVLTLTATPIPRTLQLALTGVREMSIIATPPVDRLAVRTFV
Q3J2M4_RHOS4          S----------------EVHVLTLTATPIPRTLQLSLTGVRDLSIIATPPVDRLAIRTYV
MFD_HELPY             K----------------SVHFLSMSATPIPRTLNMALSQIKGISSLKTPPTDRKPSRTFL
MFD_HELPJ             K----------------SVHFLSMSATPIPRTLNMALSQIKGISSLKTPPTDRKPSRTFL
Q7M928_WOLSU          Q----------------DVHMLSMSATPIPRTLNMALSSIKGMSTLLTPPSEKLPVRTFV
Q0P9G9_CAMJE          Q----------------NSHILSMSATPIPRSLNQALSSIKSYSVLQTPPEDRMDVRTFV
A0A0H3P9Q7_CAMJJ      Q----------------NSHILSMSATPIPRSLNQALSSIKSYSVLQTPPEDRMDVRTFV
A7ZE35_CAMC1          Q----------------HSHILSMSATPIPRSLNMALSKIKTYSILATPPSSRLDVRTSV
E0UPP9_SULAO          H----------------NVHLLSMSATPIPRSLNQALSSIKTMSQLLTPPSERQGVRTFV
I0GL09_CALEA          A----------------TVDVLTLSATPIPRTLYASLIKLRPVSLILTAPTGRIPVKTFA
Q8RH90_FUSNN          G----------------DIDVLTLTATPIPRTLNLSLLGIRDLSVIDTSPEGRQKIHTEY
MFD_BORBU             I----------------SVDCLALSATPIPRSLHMSLIKLRDISVLKIPPQNRVKIEAYL
F0S455_DESTD          K----------------NLDVLYLSATPIPRTLYSALSGFRDISVIETPPVGRRGTKVVV
E1X1P6_HALMS          A----------------NVDFLTLTATPIPRTLQLSFLGIREMSLIQTAPPRRQSIKSYL
MFD_SYNY3             T----------------EVDVLTLTATPIPRTLYMSLSGIREMSLITTPPPSRRPIKTHL
Q8DKA7_THEEB          T----------------QVDVLTLSATPIPRTLYMALSGVREMSLITTPPPSRRPIQTHL
Q7NEP2_GLOVI          T----------------QVDVLTLTATPIPRTLYMSLSGVREMSLITTPPPSRRPIKTHL
Q7VBU2_PROMA          K----------------NIDVLTLTATPIPRTLYMSLSGVREMSLITTPPPQRRAIKTHL
Q8F395_LEPIN          N----------------LVDVLTLTATPIPRTLHMALTGIRELSIIATPPKNRQSVETYV
B5YL15_THEYD          P----------------KVDLITITATPIPRTLQIGLSGLWDIFVIQTPPKERLAVKTFV
A6GW35_FLAPJ          Q----------------NVDTLTLTATPIPRTLQFSLMAARDLSVITTPPPNRYPIETHV
Q8AB59_BACTN          V----------------NVDTLTMTATPIPRTLQFSLMGARDLSVISTPPPNRYPIQTEV
Q2S6G5_SALRD          E----------------AIDTLTLTATPIPRTLQFSLLGARDLSLIETPPPNRQPINTEI
Q8KEN4_CHLTE          P----------------GVDTLTMSATPIPRTMQFSMLGARDISIVSTPPKNRQPVETII
O84753_CHLTR          P----------------TIDCLTVSATPIPRTLYLSLSGARDLSLITMPPLDRLPVSTFV
M1WUP8_PSEP2          Q----------------NIDVLTLTATPIPRTLQLSLSGIRGLSIIETPPLDRKPVETAI
Q72AT7_DESVH          R----------------NVDALTLTATPIPRTLQLSMSGIRELSVIETAPPERKPVATAL
B9KVH0_RHOSK          A----------------DLHVLTMTATPIPRTLQTALVGLQDLSEIATPPARRRAVRTLT
B0UM39_METS4          S----------------GAHVLTLTATPIPRTLQSALVGLQDLSVIATPPVVRRPIRTVV
Q1YKV9_AURMS          D----------------GVHILTMTATPIPRTLQSGFVGLSDLSIIATPPNRRSPVKTRV
E8TPS0_MESCW          P----------------CLHTLSMSATPIPRTLQSALSGIQDVSVLNSPPAKRRPVRTIL
C6B9D3_RHILS          P----------------SLHTLAMSATPIPRTLQSAMVGVHEVSLLTTPPFRRRPVRTSL
A4YQE5_BRASO          A----------------GVHALTMSATPIPRTMAGAMAGLRDLSIIATPPVRRRPVLTKV
A5EAY9_BRASB          K----------------NGHRLWMSATPIPRTLAAGLTGLRDLSVIATPPVHRVPVATKV
D1B5L3_THEAS          P----------------GADVLMLSATPIPRTLQLALGGYKDISVMTTPPVDRRPVVTVV
Q9RU62_DEIRA          GLPEMVDGKLTMTGDEKAVDTLALSATPIPRTLYMSMVGLRDMSSIQTPPKGRRPIQTIL
Q5SJW3_THET8          A----------------EVDTLYLSATPIPRTLYSALVGLKDLSSIQTPPPGRKPIKTFL
I0IIW6_PHYMF          D----------------GVDTLALTATPIPRTLHTALAGLRAVSTLRTPPAGRRAVVTEV
                                         . : ::******::   .        :  .*  :       

MFD_MYCBO             GPHDD--KQIAAALRRELLRDGQAFYVHNRVSSIDAAAARVREL--------VPEARVVV
MFD_MYCTU             GPHDD--KQIAAALRRELLRDGQAFYVHNRVSSIDAAAARVREL--------VPEARVVV
Q8NRS9_CORGL          GPYED--KQVAASIRRELLRDGQVFFIHNKVADIEKKAREIRDL--------VPEARVVV
Q9F2P1_STRCO          GPYEH--RQIGAAIRRELLREGQVFYIHNRVESIDRAAAKLREI--------VPEARIAT
Q8G5I7_BIFLO          GAYED--AQVTAAVRRELLRGGQVFYVHNRVQDISSIADKIHTL--------VPEAHVGI
Q83N19_TROWT          GPYRD--KQVIAAVRREIIRGGQVFYIHNDTATISRVAQRLEQL--------IPEARVVS
MFD_MYXXA             MKYED--TVVKEAIEREVARGGQVFFVHNRVESLPSIETQLRAL--------VPQVSIGV
Q74H75_GEOSL          ARTSD--ELIREAVLRELRRGGQVFFVHNRVQSIGAWYEHLRRI--------VPEAKIAV
Q1IHV1_KORVE          AKWDE--KLIKSAIEQELDRGGQIYFVHNRVESIYEISDKIHEL--------VPKAKILV
Q2RMB9_MOOTA          VEYNP--ELVREAIRRELDRGGQVFIVHNRVQDIDRFAYHIQQL--------VPEARVGI
A9WHG9_CHLAA          VPTDD--HLIQEVIRRELEREGQVYVVHNRVQSIYHVAERLRRL--------VPEARIAV
I0IRW8_LEPFC          LPFDR--HRIREAIDRELARDGQVFFIHNRVSSISRMAHYISSL--------FPGVPVGV
MFD_BACSU             VEYNG--ALVREAIERELARGGQVYFLYNRVEDIERKADEISML--------VPDAKVAY
Q8YAD0_LISMO          AEQNN--VLVREAIERELARDGQVYYLYNRVESITQKADEISAM--------VPDARVAT
Q839B9_ENTFA          MENNP--GAIREAIEREMARDGQVFYLYNRVDTIERKVEELQAL--------VPDARIAY
F9UL13_LACPL          MEQNF--GVIKEGIEREMQRNGQVFYLHNRVHDIDKVVAQIKDL--------VPDAAVAH
MFD_STAEQ             LEQNT--NFIKEALERELSRDGQVFYLYNKVQSIYEKREQLQRL--------MPDANIAV
MFD_STAES             LEQNT--NFIKEALERELSRDGQVFYLYNKVQSIYEKREQLQRL--------MPDANIAV
MFD_STAHJ             LEQNS--NFIKEALERELSRDGQVFYLYNRVQSIYEKREQLQML--------MPDANIAV
MFD_STAA8             LEQNM--SFIKEALERELSRDGQVFYLYNKVQSIYEKREQLQML--------MPDANIAV
MFD_STAS1             LEQNT--NFIKEALERELSRDGQVFYLYNKVQSIYEKREQLQML--------MPDANIGV
Q9CJI0_LACLA          METNY--GVVRDAVLREISRGGQVYYVYNRVDTIEQKVSQLEEL--------IPEARIGF
Q8DRQ1_STRR6          LEKND--SVIRDAVLREMERGGQGYYLYNKVDTIVQKVSELQEL--------IPEASIGY
Q97E98_CLOAB          VEYND--QLIRDAIMREIGRDGQVFFVYNKVESIKEMAANLGKL--------IPEARIAI
A5I7R4_CLOBH          VEYND--QLIRDSILREISRGGQIYFVYNRVESIHEMASYISKL--------VPEGRVQI
D3R0N9_MAGIU          MEYDP--AIVIDAINREFSRHGQVFYLYNNTAGIDAKVNELQEA--------LPGARIAA
B8E2E1_DICTD          VEYNP--EIIQEGIRRELERGGQVYYVCNDIERLEKIREELSKL--------VPEATYAI
MFD_ECOLI             REYDS--MVVREAILREILRGGQVYYLYNDVENIQKAAERLAEL--------VPEARIAI
MFD_HAEIN             RQNDD--LVVREAILREILRGGQVYYLHNDVASIENTAEKLTAL--------VPEARVIV
Q8EEV8_SHEON          RESDP--ATVREAILREILRGGQVYYLHNNVETIEKCAQDISTL--------LPEARVVV
Q9HZK3_PSEAE          MEQQN--AVIKEALLRELLRGGQVYYLHNEVKTIEKCARDLAEL--------VPEARIGI
Q83CG9_COXBU          HDYSP--VLIREAILRENLRGGQVYFLHNDVATLAATAEKLRTI--------IPEARLAI
Q63T69_BURPS          RREEE--SVIREAMLRELKRGGQVYFLHNEVETIENRKAMLEEL--------VPEARIVI
Q7VZN3_BORPE          RREDG--STIREALLRELKRGGQVYFLHNEVETIHNRRARLEEL--------VPEARIAV
Q8P7B3_XANCP          TAWDN--TLLREAFQRELSRGGQLYFLHNDVESIVRMQRDLSEL--------VPEARIGI
Q5NH30_FRATT          KEYDN--NIIREAVSRETIRGGQIFYLYNKVETIQKKKEILQEL--------FPRLRIAI
MFD_RICFE             MPFDP--VIIRDALLREHFRGGRSFYVVPRIKDIEDIEKQLKQI--------VPELSYKI
MFD_RICCN             MPYDP--VIIRDALLREHFRGGRSFYVVPRIKDIEDIAKQLKQI--------VPELSYKI
MFD_RICPR             MPFDP--VIIRDALLREHFRGGRSFYVAPRIKDMEDIEKQLKQI--------VPELSYKI
MFD_RICTY             MPFDT--VIIRDALLREHFRGGRSFYVVPRIKDMEDIEKQLKQI--------VPELSYKI
MFD_RICBR             MPFDP--VIIRDALLHEHFRGGKSFFVVPRINDIEDIEKQLKQI--------VPELSYKV
Q3YR59_EHRCJ          THYDD--TIIKDAIIREHNRGGRVFYVCPQISNIKSISDNLTKL--------VPGIKINT
Q2GLL6_ANAPZ          THFDE--KTIKTAILNEVNRGGRVFFTCPLIADIEPVLTRLQKL--------VPEVKIAV
A9CIN2_AGRFC          SPFDP--LVIRETLMREHYRGGQSFYVCPRLADLADIHAFLQSD--------VPELKVAV
Q89LE3_BRADU          APHDP--LMIREALLRERYRGGQAFYVVPRIDDLAEVKDFLDKN--------VPEMKVAV
Q9A782_CAUVC          SPFDP--VTLREALLREKYRGGQSYYVVPRIKDLEDIEKFLRTQ--------VPEVKFVV
Q2RTL9_RHORT          LPFDP--VVVREAILRERFRGGQCFYVCPRLTDIDKVMERLTTL--------VPDIRAVV
Q3J2M4_RHOS4          SEFDT--VTIREALLRERYRGGQSFFVVPRLSDLPDMEAFLRDH--------VPEVSYVV
MFD_HELPY             KEKND--ELLKEIIYRELRRNGQIFYIHNHIASILKVKTKLEDL--------IPKLKIAI
MFD_HELPJ             KEKND--ELLKEIIYRELRRNGQIFYIHNHIASISKVKTKLEDL--------IPKLKIAI
Q7M928_WOLSU          KEYQE--ALLKEIVHREIRRGGQIFYIHNNIATIERRQKELLEL--------MPNLKIAI
Q0P9G9_CAMJE          KENDD--ALLKEAIARELRRGGQIFYIHNHIASIEQCKKHLLEL--------FSTLRILI
A0A0H3P9Q7_CAMJJ      KENDD--ALLKEAIARELRRGGQIFYIHNHIASIEQCKKHLLEL--------FSTLRILI
A7ZE35_CAMC1          REWDE--KVIKEAIMRELRRGGQTFYIHNHIADIEQTANELRKI--------LPKLRILI
E0UPP9_SULAO          KEYDE--KLIKEVILRELRRGGQVFYVHNSIDHMPIKLDELQAL--------LPDLRMLM
I0GL09_CALEA          MPFNV--DVMKNAINYEIKRGGQVFVVYNNIEKIYSMGEFIRNL---------TNTKVAV
Q8RH90_FUSNN          IDNNK--NFIKEIILSEISREGQVFYIFNSVKRMESKVKEIRELL-------PEYIKVSY
MFD_BORBU             ESFSE--LLIKHAIESELSRDGQVFLVNHNIEELYYLKTLIERL--------TPYARIAI
F0S455_DESTD          SKYSD--RILKTAVERELKRNGQVFIVQNDIDELEPLKIKVEEM--------FPNIPVDI
E1X1P6_HALMS          IKEDD--LTLQTAIKKELNRGGQVFIVHNKVSDIDHFSNYIQEL--------VPEAKIVY
MFD_SYNY3             SPYNP--EVIRTAIRNELDRGGQVFYVVPRIEGIEELGGQLRQM--------VPSARIAI
Q8DKA7_THEEB          APYDP--ETVRSAIRQELDRGGQVFYVVPRVEGIEAVAAKLQGM--------VVGARILI
Q7NEP2_GLOVI          APYDP--EHVRTAILQELGRGGQIFYVYNRIEDIQDVAARLQAM--------IPTARVCV
Q7VBU2_PROMA          VSKEN--EIIRSAICQEIGRGGQIFYVVPRIEGIEEVATEIKQM--------VPNIKLII
Q8F395_LEPIN          LEEDD--DLISDAIRNEIQRGGQVFYLYNRVETIEEETNYLSKL--------VPEVSIGI
B5YL15_THEYD          IQENE--LIIKEAIEKEIQRGGQIYFLHNRIHDIELVKSKIQKL--------VPMARIGV
A6GW35_FLAPJ          VGFNE--ETIRDAISFEIERGGQVFFINNRIENIKEVAGMIQRL--------VPDAKVGI
Q8AB59_BACTN          HTFNE--EVITDAINFEMSRNGQVFFVNNRIANLPELKVMIERH--------IPDCRVAI
Q2S6G5_SALRD          HTFDE--DVIRDAIVYETSRGGQVFFIHNRVKTIHEVAEMVRAM--------VPNVRVGV
Q8KEN4_CHLTE          TEFDP--ETVRAAIKREIQREGQVFFLHNRITSLEETALKLREL--------VPYARMAT
O84753_CHLTR          MEHSE--ETLSAAIRHELLRGGQVYVIHNRIESIFRLGETIRTL--------IPEARIGV
M1WUP8_PSEP2          TEREA--LSLKAVLRRELDRGGQIYWVYNRVNGLERVAEFVREL--------APDAKVGM
Q72AT7_DESVH          IERDD--AALKSILEREIAREGQVFWVHNRVQGLERTTEYVRKL--------VPDARVGM
B9KVH0_RHOSK          AEDDA--AVLRQALLRERRRGGQSFVIVPRIAEIDATEARLRDL--------LPEAQLRV
B0UM39_METS4          APFDP--ETVRAALTREHRRGGQSFVVCPRIADLAPMEARLRAI--------VPDLSLAV
Q1YKV9_AURMS          GPFDD--AAVRDALTAERARGGQSFVVCPRIEDLEPMAAKLQEL--------VPEQTTVT
E8TPS0_MESCW          AAFDP--ASVRAALLREFHRGGQSFFVVPRIEDIGPVSDQLNRL--------VPELGVMT
C6B9D3_RHILS          SVFDH--ASMRTGLMREKRRGGQSFVVVPRIEDIDVVKTILRKI--------VPELSVKV
A4YQE5_BRASO          EPLLD--ATLSMALRREHRRGGQSFVICPRIKDLAPMRERLSHL--------VPELGIAM
A5EAY9_BRASB          APLSD--IAIAAALVREHRRNGQSFVICPRIQDLDPLLAKVHAL--------VPELRINT
D1B5L3_THEAS          SPWQD--ELVKGAVLRELSRGGQVFWVHNRIQSMHRAFLRAKAL--------LPGVRVEM
Q9RU62_DEIRA          SPFDP--LTVRDAIMTEIGRGGKVFYIHDRIASIGARSLYLRNL--------VPEARIGV
Q5SJW3_THET8          APFDP--LLVREAILFELERGGKVFYVHDRVASIEARRRFLENL--------VPEARIGV
I0IIW6_PHYMF          LPAEDGRPRVRTALSRELARGGQAFVVHNRVEGLAEAAEEVRDLLGGVTRPDRSTPVVAS
                               :   .  *  * *: :        :                          

MFD_MYCBO             AHGQMPEDLLETTVQRFWNREHDILVCTTIVETGLDISNANTLIVERA-DTFGLSQLHQL
MFD_MYCTU             AHGQMPEDLLETTVQRFWNREHDILVCTTIVETGLDISNANTLIVERA-DTFGLSQLHQL
Q8NRS9_CORGL          AHGQMSEELLEQTVQGFWDREYDVLVCTTIVETGLDISNANTLIVENA-HHMGLSQLHQL
Q9F2P1_STRCO          AHGQMSEQALEQVVVDFWEKKFDVLVSTTIVESGIDISNANTLIVERG-DNFGLSQLHQL
Q8G5I7_BIFLO          AHGKMGEKQLDQIIRDFWHRGIDVLVCTTIIETGLDISNANTLIVDHA-DRFGLSQLHQL
Q83N19_TROWT          AHAKLAERMLEKTVIDFWEGKYDILVCTTIIETGLDNANANTIIIDSA-ENYGLSQLHQL
MFD_MYXXA             AHGQMGEGQLEKVMLAFTEKKYQVLLCTSIIESGIDISSANTMIVNRA-DQFGLAQLYQL
Q74H75_GEOSL          GHGQMDEGELEKVMLGFMHGETNLLLCTTIIESGLDIPSANTLIVDRA-DTFGLAQLYQL
Q1IHV1_KORVE          GHGQMGEGQLEDIMLKFMRHDADILVATTIIENGLDIPLCNTMIVNRA-DRHGLSELYQL
Q2RMB9_MOOTA          GHGQMGEEELENVMLDFISGRYDVLVSTTIVENGLDIQNANTLIVDES-DNFGLAQLYQL
A9WHG9_CHLAA          GHGQLAERELEQVMIDFFEGRYDVLVCTTIIESGLDVPNANTIIIDDA-TNYGLAQLYQL
I0IRW8_LEPFC          AHGQMDSQLMETIMDRFISGHYRILVSTAIVESGLDIPQANTIIINRS-DLFGIAELYQL
MFD_BACSU             AHGKMTENELETVMLSFLEGESDVLVSTTIIETGVDIPNVNTLIVFDA-DKMGLSQLYQL
Q8YAD0_LISMO          AHGQMGESELESVILSFLEGEFDVLVTTTIIETGVDIPNVNTLFVQDA-DRMGLSQLYQL
Q839B9_ENTFA          AHGQMTEVQLENTLFDFIEGQYDILVTTTIIETGVDIPNANTLFVENA-DYMGLSTLYQL
F9UL13_LACPL          IDGQMPESQLEGILYDFIRGEYDVLVTTTIIETGVDIPNVNTLFVENA-DRMGLSQLYQL
MFD_STAEQ             AHGQMTERDLEETMLSFINHEYDILVTTTIIETGVDVPNANTLIIEEA-DRFGLSQLYQL
MFD_STAES             AHGQMTERDLEETMLSFINHEYDILVTTTIIETGVDVPNANTLIIEEA-DRFGLSQLYQL
MFD_STAHJ             AHGQMTERDLEETMLSFINGEFDILVTTTIIETGVDVPNANTLIIEEA-DRFGLSQLYQL
MFD_STAA8             AHGQMTERDLEETMLSFINNEYDILVTTTIIETGVDVPNANTLIIEDA-DRFGLSQLYQL
MFD_STAS1             AHGQMNERDLEETMLSFINHEYDIIVTTTIIETGVDVPNANTLIIEDA-DRFGLSQLYQL
Q9CJI0_LACLA          IHGQMTEVQLENTLLAFIAGDYDVLVATTIIETGVDIPNANTLFIENA-DMMGLSQLYQL
Q8DRQ1_STRR6          VHGRMSEVQLENTLLDFIEGQYDILVTTTIIETGVDIPNANTLFIENA-DHMGLSTLYQL
Q97E98_CLOAB          AHGQMSERELEKVMIDFMEGNYDILLCTTIIETGIDIQNVNTLIIYNA-DKMGLSQLYQL
A5I7R4_CLOBH          AHGQMKEKELENVVLDFTENKFDILIATTIIETGMDIKNVNTMIIYDA-DKMGLSQLYQL
D3R0N9_MAGIU          GHGKMSEKQLEQVINDFYAGETDILVCTTIIESGIDMPNVNTLIVENA-DRLGLAQLYQL
B8E2E1_DICTD          AHGKMDDEKLTEVMSNFYDGKIDVLVATTIIESGIDVPNANTLFVENA-EHMGLAQLYQL
MFD_ECOLI             GHGQMRERELERVMNDFHHQRFNVLVCTTIIETGIDIPTANTIIIERA-DHFGLAQLHQL
MFD_HAEIN             GHGQMRERELERVMSDFYHQRYNVLVCSTIIETGIDVPTANTIIIERA-DHFGLAQLHQL
Q8EEV8_SHEON          AHGQMRERDLERVMSDFYHQRFNVLVCTTIIETGIDVPSANTIIIERA-DTFGLAQLHQL
Q9HZK3_PSEAE          GHGQMHERELEQVMSDFYHKRFNVLVASTIIETGIDVPSANTILIERA-DKFGLAQLHQL
Q83CG9_COXBU          AHGQMRERDLERVMSDFYHQKYNLLVCTTIIESGIDIPTANTIIINRA-DRFGLAQLHQL
Q63T69_BURPS          AHGQMHERELERVMRDFVAQRANVLLCTTIIETGIDVPSANTIIMHRA-DKFGLAQLHQL
Q7VZN3_BORPE          AHGQMPERELEQVMKGFYQQRHNVLLCTTIIETGIDIPTANTIVIHRA-DRFGLAQLHQL
Q8P7B3_XANCP          AHGQMPERELERVMLDFQKQRFNVLLSTTIIESGIDIPNANTIIINRA-DRFGLAQLHQL
Q5NH30_FRATT          AHGQMSEKEIQKVMFDFKHNKYHILLCTTIIETGIDIPNANTLIIEDA-NNLGLAQLHQL
MFD_RICFE             AHGKMTPSKIDEVMSEFYAGKFDILVSTTIIESGIDIAEANTMVIHKA-DMLGLSQLYQL
MFD_RICCN             AYGKMTPSKIDEVMSEFYAGKFDILVSTTIIESGIDIAEANTMIIHNA-DMLGLSQLYQL
MFD_RICPR             AHGKMTPSKIDEVMSEFYVGKFDILISTTIIESGIDIAEANTMIIHKA-DTLGLSQLYQL
MFD_RICTY             AHGKMTPSKIDEVMSEFYAGKFDILISTTIIESGIDITEANTMIIHNA-DTLGLSQLYQL
MFD_RICBR             AHGKMSPNKIDEIMSEFYAGKFDILISTTIIESGIDIQDANTMIIHKA-DMLGLSQLYQL
Q3YR59_EHRCJ          AHGQLPPTQLDTIMNDFFDGKFTILLTTSIIECGLDIPFANTIIIHNA-DMFGLAQLYQL
Q2GLL6_ANAPZ          AHGGTAPLALDKIMNDFFDGKFSLLLTTSIIESGIDIPFANTIIIYNA-DMFGLAQLYQL
A9CIN2_AGRFC          AHGQMAAGELEDIMNAFYDGKYDVLLSTTIVESGLDVPTANTLIVHRA-DMFGLAQLYQL
Q89LE3_BRADU          AHGQMPPAVIEDIMTAFYDGKFDILLSTTIVESGLDIPNANTLIVHRA-DMFGLAQLYQL
Q9A782_CAUVC          GHGQMAATQLEDVMTAFYEGQYDVLLATTIVESGLDIPSANTLIVHRA-DMFGLAQLYQI
Q2RTL9_RHORT          AHGQMAPSRLEEVMTAFADGQYDVLVATNIVESGLDIPRANTIIIHRA-DMFGLAQLYQL
Q3J2M4_RHOS4          AHGQLAAGELDERMNAFYDGKFDVLLATTIVESGLDIPTANTMIVHRA-DMFGLSQLYQI
MFD_HELPY             LHSQINANESEEIMLEFAKGNYQVLLCTSIVESGIHLPNANTIIIDNA-QNFGLADLHQL
MFD_HELPJ             LHSQINANESEEIMLEFAKGNYQVLLCTSIVESGIHLPNANTIIIDNA-QNFGLADLHQL
Q7M928_WOLSU          LHSQIPEKETEEIMLAFEEGRYHLLLSTSIIESGIHLPNANTIIIDSS-DRFGIADLHQL
Q0P9G9_CAMJE          LHSKIDAKMQEEEMLKFENKEYDLLLSTSIVESGIDLPNANTIIVEKS-DRFGMADLHQL
A0A0H3P9Q7_CAMJJ      LHSKIDAKVQEEEMLKFENKEYDLLLSTSIVESGIDLPNANTIIVEKS-DRFGMADLHQL
A7ZE35_CAMC1          LHSKINAKVAEDEMMKFERGEYDLLLCTSIVESGIHLPNANTIIVENA-NKFGMADLHQL
E0UPP9_SULAO          LHSKISAVETEKELLKFEAGEYDLMIATSIIESGIHMPRVNTIIVDGA-DRFGIADLHQL
I0GL09_CALEA          AHGKMRKEVIEDVMLDFYEGKTDVLVATTIIENGLDIPTVNTLIVIEA-ENFGLSQMYQL
Q8RH90_FUSNN          IHGQMLPRDIKKNIQDFENGNVDVLVATTIIENGIDIENANTMIIEGV-EKLGLSQVYQL
MFD_BORBU             IHGKLTGEEIENIMHNFIKKAYQILLATTIIENGIDIPNANTIIINNA-NKFGLAQLYQL
F0S455_DESTD          VHGQMKTEKIEKVMHKFFEGDIKILIATSIIESGLDIPSANTLIVIGA-ERFGLSQLYQL
E1X1P6_HALMS          AHGQMSEKELEEKMSAFYNGTYQILISTTIIESGIDIPNANTMIIDRA-DNYGLAQLHQL
MFD_SYNY3             GHGQMEESELESTMLAFNDGEADILVCTTIIEAGLDIPRVNTIIVEDA-QKFGLAQLYQL
Q8DKA7_THEEB          AHGQMAEGELESTMLGFSNGEADILVCTTIIESGLDIPRVNTILVEDA-QRFGLAQLYQL
Q7NEP2_GLOVI          GHGQMEEGELESTMLAFSGGEFDILVCTTIIESGLDIPRVNTILVENA-HQFGLSQLYQL
Q7VBU2_PROMA          AHGQMNEGELENAMIAFNAGEADLMLCTTIIESGLDIPRVNTILIEDA-HKFGLSQLYQL
Q8F395_LEPIN          LHGQMTEDEIEETLLDFYNRKYDILVTTTIIESGIDMPNVNTLFVKRA-DLFGLSQLYQI
B5YL15_THEYD          AHGRMKEKMLDKIMLDFIYGKIDILLCTSIIASGLDIPNVNTIIIDQA-QTFGLSDLYQI
A6GW35_FLAPJ          GHGQMDGKKLEELMLAFMEGEFDVLVATTIIESGLDVPNANTIFINNA-NNFGLSDLHQM
Q8AB59_BACTN          GHGQMEPTQLEQIIFDFVNYDYDVLLATTIIESGIDIPNANTIIINQA-QNFGLSDLHQM
Q2S6G5_SALRD          GHGQMSASELEDVMLDFVNEKLDVLVSTSIIENGLDISNANTMIINHAGEHFGLSELHQL
Q8KEN4_CHLTE          AHGQMPAKELENVMMDFMQQELDVLISTSIIGSGLDISNANTIIINRA-DMFGLSDLYQL
O84753_CHLTR          AHGQMHANELASIFYKFKTQQTNVLVATALIENGIDIPNANTILIDHA-DKFGMADLYQM
M1WUP8_PSEP2          AHGKMTEKGLEETMRGFWHGEIDVLVCTAIVESGLDFPNANTLIVDQA-QLFGLGQLYQL
Q72AT7_DESVH          AHGQMTERALEETMHRFWHGELDVLVCTAIVESGLDFPRANTLIVDQA-QMFGLGQLYQL
B9KVH0_RHOSK          AHGDLAPEELDRAMVEFAAGRGDILLATSIVETGLDVPRANTMIVMQP-QLFGLAQLHQL
B0UM39_METS4          AHGEMPPAAMDEAMVRFAEGEGDVLLATNIIESGLDVPRANTMLVWHP-ERFGLAQLHQL
Q1YKV9_AURMS          LHGKMKPDEVEDAMLAFAHGEHDVLLATAIVESGLDVANANTMVVCHA-DRFGLAELHQL
E8TPS0_MESCW          AHGEMKGRQLDEVMVGFADGDGDILLSTDIIESGLDVPRANTIIVWRP-DRFGLAQLHQL
C6B9D3_RHILS          AHGDMPAAAIDEAIVGFAEGDGDVLLATNIIENGLDVPRANTMFVWQA-DRFGLAQLHQL
A4YQE5_BRASO          IHGRMPAREIDAEMMRFVAGKADILLATNIVENGLDIPRANTILISGA-EHFGLSQLHQL
A5EAY9_BRASB          IHGKLPTDEIDERLMGFVEGRTDVLLATNIVESGLDIPRANTIVVCWP-EKFGLAQLHQL
D1B5L3_THEAS          AHGRMRDSELESLMARFVEGRLDVLLCTTIIESGLDLPRVNTIIVEDA-HRMGLAQLYQL
Q9RU62_DEIRA          AHGRMNEEELEEIMLGFEQGAFDVLLATTIVETGLDIPEANTILIERS-DRLGLAQLYQL
Q5SJW3_THET8          VHGQMPESLIEETMLLFAEGAYDVLLATTIIEAGLDVPEANTILIERA-DRLGLATLYQL
I0IIW6_PHYMF          AHGQLREEELEDALLAFTAGDTDVLVCTTIVENGLDVARAGTIVVEGA-DRFGLASLHQL
                        .          .  *      ::: : ::  *:.    .*:.:       *:. ::*:

MFD_MYCBO             RGRVGRSRERGYAYFLYPPQVPLTETAYDRLATIAQNNELGAGMAVALKDLEIRGAGNVL
MFD_MYCTU             RGRVGRSRERGYAYFLYPPQVPLTETAYDRLATIAQNNELGAGMAVALKDLEIRGAGNVL
Q8NRS9_CORGL          RGRVGRSRERGYAYFLYPKGATLTEMSYDRLATIAQNNDLGAGMAVAMKDLEMRGAGNVL
Q9F2P1_STRCO          RGRVGRGRERGYAYFLYPPEKPLTETAHERLATIAQHTEMGAGMYVAMKDLEIRGAGNLL
Q8G5I7_BIFLO          RGRVGRGRERAYAYFLYDPSKPMTEQSHDRLATIAQNTALGSGFDVAMKDLELRGTGNLL
Q83N19_TROWT          RGRVGRGTKRAYAYLFY--TSTLKDTAYKRLEAIARNNHLGAGAQIAMKDLELRGAGSLL
MFD_MYXXA             RGRVGRSKERAYAYLLVPSRRAVTKDAQRRLEVLQNFTELGAGFSIASHDLEIRGAGNLL
Q74H75_GEOSL          RGRVGRSRQRAYAYLLIPGEGAISSDARERLRIIQELNELGAGFRLATHDLEIRGAGDLL
Q1IHV1_KORVE          RGRVGRSNRRAYAYLLVPPDRELTELARRRLAALKEFSDLGAGFKIAALDLELRGAGNLL
Q2RMB9_MOOTA          RGRVGRTNRLAYAYFTYRPDKVLGEIAEKRLAAIREFTAFGSGYKIALRDLQIRGAGNFL
A9WHG9_CHLAA          RGRVGRGATRAYAYLLYNAARVMTNDARLRLEAIQEATELGAGFRIAMRDLEIRGAGNLL
I0IRW8_LEPFC          RGRVGRSGTQAYCYFLVAGEGGLTELAKKRLKTLQDNTELGSGYQIAMRDLEIRGAGSLL
MFD_BACSU             RGRVGRSNRVAYAYFTYRRDKVLTEVAEKRLQAIKEFTELGSGFKIAMRDLTIRGAGNLL
Q8YAD0_LISMO          RGRVGRWNRIAYAYFMYQKDKILREEAEKRLSAIKEFTELGSGFKIAMRDLSIRGAGNIL
Q839B9_ENTFA          RGRVGRSNRVAYAYFMYEQQKILNEVSEKRLEAIKDFTELGSGFKIAMRDLSIRGAGNLL
F9UL13_LACPL          RGRIGRSSRVAYAYFTYQQNKVLTEVGEKRLQAIKDFTELGSGFKIAMRDLSIRGAGNLL
MFD_STAEQ             RGRVGRSSRIGYAYFLHPANKVLNETAEERLQAIKEFTELGSGFKIAMRDLNIRGAGNLL
MFD_STAES             RGRVGRSSRIGYAYFLHPANKVLNETAEERLQTIKEFTELGSGFKIAMRDLNIRGAGNLL
MFD_STAHJ             RGRVGRSSRIGYAYFLHSANKVLTETAEERLQAIKEFTELGSGFKIAMRDLNIRGAGNLL
MFD_STAA8             RGRVGRSSRIGYAYFLHPANKVLTETAEDRLQAIKEFTELGSGFKIAMRDLNIRGAGNLL
MFD_STAS1             RGRVGRSSRIGYAYFLHPTNKVLSETAEDRLQAIKEFTELGSGFKIAMRDLNIRGAGNLL
Q9CJI0_LACLA          RGRVGRSNRVAYAYFMYRPEKILSEVSEKRLEAIKGFTELGSGFKIAMRDLSIRGAGNLL
Q8DRQ1_STRR6          RGRVGRSNRIAYAYLMYRPEKSISEVSEKRLEAIKGFTELGSGFKIAMRDLSIRGAGNLL
Q97E98_CLOAB          RGRVGRTNRMAYAYFTYKKDKILTEVAEKRLKAIKEFTQLGSGFKIAMRDLEIRGAGNIM
A5I7R4_CLOBH          RGRVGRTNRMAYCYLTYKRDKILTEVAEKRLKAIKDFTELGSGFKIALKDLEIRGAGNMM
D3R0N9_MAGIU          RGRVGRSGRQAYAYITYRRDKVLTEVAEKRLTAIRDFTELGSGFKIAMKDLEVRGAGNIL
B8E2E1_DICTD          RGRIGRSYKQAYAYFLHAPLKKLSLESIKRLEALKEFSSLGSGLRLALRDLEIRGAGKIL
MFD_ECOLI             RGRVGRSHHQAYAWLLTPHPKAMTTDAQKRLEAIASLEDLGAGFALATHDLEIRGAGELL
MFD_HAEIN             RGRVGRSHHQAYAYLLTPPPKMMTKDAERRLDALENLDNLGAGFILATHDLEIRGAGELL
Q8EEV8_SHEON          RGRVGRSHHQAYAYLMTPHPKRMTTDARKRLEAIDALEDLGAGFMLATQDLEIRGAGELL
Q9HZK3_PSEAE          RGRVGRSHHQAYAYLLTPPRRQMTPDAEKRLEAIANAQDLGAGFVLATHDLEIRGAGELL
Q83CG9_COXBU          RGRVGRSHHQAYAYLLIPDQEALTADAEKRLSAISQLDDLGVGFNLATHDLEIRGAGELL
Q63T69_BURPS          RGRVGRSHHQAYAYLLVHDPQALTKQAQRRLEAIQQMEELGSGFYLAMHDLEIRGTGEVL
Q7VZN3_BORPE          RGRVGRSHHQAYAYLLTPGEDAITNNAKKRLEAIQAMEELGSGFYLAMHDLEIRGTGEIL
Q8P7B3_XANCP          RGRVGRSHHRAYAYLVVPDRRSMTSDAEKRLEAIASMDELGAGFTLATHDLEIRGAGELL
Q5NH30_FRATT          RGRVGRSHHQAYAYMLIPNEASITKDALKRLEAISNTESLGGGFTLANHDLEIRGAGEIL
MFD_RICFE             RGRIGRGKVRGYAYLTVASHKKMTSHSLRRLEIIQNSCALGSGFTIASHDMDLRGFGNLI
MFD_RICCN             RGRIGRGKMRGYAYLTVASHKKMTSHSLRRLEIIQNSCALGSGFTIASRDMDLRGFGNLI
MFD_RICPR             RGRIGRGKIRGYAYLTVASNKKITSHSLRRLEIIQNSCSLGSGFTIASHDADLRGFGNLI
MFD_RICTY             RGRIGRGKIRGYAYLTVASNKKLMQHSLRRLEIIQNSCALGSGFTIASHDADLRGFGNLI
MFD_RICBR             RGRIGRGKMRGYAYLTLPSHKKMTPHSLRRLEIIQNSCALGSGFTIASHDMDLRGFGNLI
Q3YR59_EHRCJ          KGRVGRSNIKGFVYFILSEKVTNKPT--TKLEIIQSINSISSGFTLSLHDMDIRGFGNLV
Q2GLL6_ANAPZ          KGRVGRSTTQGYAYLILSNKATSNSPGMKRLEALKSLNSVGSGFALSLQDMDMRGFGNLV
A9CIN2_AGRFC          RGRVGRSKVRAFALFTLPVNKVLTTMAERRLKVLQSLDTLGAGFQLASHDLDIRGAGNLL
Q89LE3_BRADU          RGRVGRSKLRAYALFTLPAQQKITTQAERRLIVLQSLETLGAGFQLASHDLDIRGAGNLL
Q9A782_CAUVC          RGRVGRSKARAYAYLTTPVEKSLTPSAEKRLQVLQSLDSLGAGFQLASHDLDQRGGGNLL
Q2RTL9_RHORT          RGRVGRARARGYAYLTLPPGRTVSKTAAKRLDVMQTLDTLGAGFTLASHDLDIRGAGNLL
Q3J2M4_RHOS4          RGRVGRAKTRAYCYLTTKPRAPLTPQAIKRLRLLASLDSLGAGFNLASHDLDLRGAGNLL
MFD_HELPY             RGRVGRGKKEGFCYFLIEDQKSLNEQALKRLLALEKNSYLGSGESVAYHDLEIRGGGNLL
MFD_HELPJ             RGRVGRGKKEGFCYFLIEDQKSLNEQALKRLLALEKNSYLGSGESIAYHDLEIRGGGNLL
Q7M928_WOLSU          RGRVGRGSKEGFCYFLVEEKESLTPEAKKRLLALESNSFLGSGSVLAYHDLEIRGGGNLL
Q0P9G9_CAMJE          RGRVGRSDKQGYCYFLIEDKNAITKDALKRLVSLESNSFLGAGSILAYHDLEIRGGGNLL
A0A0H3P9Q7_CAMJJ      RGRVGRSDKQGYCYFLIEDKNAITKDALKRLVSLESNSFLGAGSVLAYHDLEIRGGGNLL
A7ZE35_CAMC1          RGRVGRSDKQAYCYFLVEDKDAISKDALKRLVALEGNSFLGAGSVLAYHDLEIRGGGNII
E0UPP9_SULAO          RGRVGRGHSEGFAYFIVQNKENLTDEAKKRLLALESNSFLGSGSVLAHHDLEIRGGGNLV
I0GL09_CALEA          RGRIGRSSIQAYAYFFYT-EKSLNAIAEERLEAIREFSDEGAGLKIAMKDLEIRGAGNIL
Q8RH90_FUSNN          RGRIGRSTKKSYCYMLTN-ENK-TKNAKKREESIREF-DNLTGIDLAMEDSKIRGVGEIL
MFD_BORBU             KGRVGRGSQKAYAYFLYQDSEKLNERSIERLRAITEFSELGAGFKIAMKDMEIRGVGNLL
F0S455_DESTD          RGRVGRGIEKGYCYLLTSSKGKLTPEAVKRLEAMKKVSPVGGGFQLAMKDLEIRGAGTLL
E1X1P6_HALMS          RGRIGRSDKKAYAYFVIPKHKPISEIAQRRLKALQTYADMGSGFNIATCDLEIRGAGDIL
MFD_SYNY3             RGRVGRSGIQAHAWLLYPNQKQLTEKARLRLRALQEFSQLGSGYQLATRDMEIRGVGNLL
Q8DKA7_THEEB          RGRVGRAGIQAHAWLFYPRQEVLTDAARQRLRAIQEFTQLGSGYQLAIRDMEIRGVGNLL
Q7NEP2_GLOVI          RGRVGRSGVQAHAWMFYKQEEALTDEARKRLRAIQEFTQLGSGYQLAMRDMEIRGVGNLL
Q7VBU2_PROMA          RGRVGRSGVQAHAWLFFPQDKEVTNNASQRLKAIQEFSELGSGYQLAMRDMEIRGVGNLI
Q8F395_LEPIN          RGRVGRSDRKAFAYMLLPKDRVVTEQAEKRLNTIFEYQELGSGFKVAMRDLEIRGAGNLL
B5YL15_THEYD          RGRVGRSYRQANAYLVIPPEEILSEDAKKRIKAIQEMSYLGAGFHIALRDLEIRGAGELL
A6GW35_FLAPJ          RGRVGRSNKKAFCYFICPPYSVMTEDARKRIQALEQFSELGSGLNIAMKDLEIRGAGDLL
Q8AB59_BACTN          RGRVGRSNKKAFCYLLAPPLSSLTAEGKRRLQAIENFSDLGSGIHIAMQDLDIRGAGNLL
Q2S6G5_SALRD          RGRVGRSQRKAFCHLLVPSVHGLTDDARERLKAVEQFSDLGSGFDIAMRDLDIRGAGSLL
Q8KEN4_CHLTE          RGRVGRSERKAYCYLITPPLHTLKREAVQRIAVIETFTELGSGINVALRDLDIRGAGNLL
O84753_CHLTR          KGRVGRWNKKAYCYFLVPHLDRLSGPTSKRLEALNK-QEYGGGMKIALHDLEIRGAGNIL
M1WUP8_PSEP2          RGRVGRSDRQAYAYFVVPKIDDISEIVRKRLRIILDMNYLGAGFKIAMEDLRLRGAGNIL
Q72AT7_DESVH          RGRVGRSDRQAYAIFVVPDADNLSDIARERMRVILDMDYLGAGFQVAMEDLRIRGAGNIL
B9KVH0_RHOSK          RGRVGRGARQAYCYLMHGPGDDLDEAALRRLGTLQAFDRLGAGAAIAAEDLDQRGAGELF
B0UM39_METS4          RGRVGRGQRRAAAYLLTDPEAPPPPASEARLRALTALDRLGAGFALSARDLDLRGAGDLF
Q1YKV9_AURMS          RGRVGRGARRGHVLLTTEADRELGEHARSRLEALEEFSTLGAGFDIAARDLDLRGTGELL
E8TPS0_MESCW          RGRVGRGAMQAAAFLLTEPGVELADGTRARLSTMLALDRLGSGLAISQRDLDLRGAGDLF
C6B9D3_RHILS          RGRVGRGGAQGIATLLTE-NAELSDETRLRLSTLVENDRLGAGLSISLRDLDLRGGGDIA
A4YQE5_BRASO          RGRVGRGGIRAYAYLLADTPGDA---AQKRLSALQELHFAGAGFQISARDLDLRGAGDLL
A5EAY9_BRASB          RGRVGRGGIRAFAHFLTEGGSDR---SEKRLSVLEELSRPGAGFAISARDLDLRGGGDLR
D1B5L3_THEAS          RGRVGRRSDQAFALFLYPRGAEAG-RALERLEAIGSLEELGSGFHLAMMDLSIRGGGELL
Q9RU62_DEIRA          RGRVGRRAQTAYAYLFYPPRMTEN--AQRRLWAIADLQDLGSGHLLAEKDMEIRGVGNIL
Q5SJW3_THET8          RGRVGRREEEAYAYLFHPPRLTEA--AEKRLAAIADLSDLGSGHLLAERDMEIRGVGNLL
I0IIW6_PHYMF          RGRVGRSGRRGFCLLEVPKNARLSEGAQKRLAAMEDADGLGAGFAIAEADLALRGAGDLL
                      :**:**    .   :              :   :        *  ::  *   ** * . 

MFD_MYCBO             GIEQSGHVAGVGFDLYVRLVGEALETYRDAYRAAADGQTVRTAEE-PKDVR---------
MFD_MYCTU             GIEQSGHVAGVGFDLYVRLVGEALETYRDAYRAAADGQTVRTAEE-PKDVR---------
Q8NRS9_CORGL          GAEQSGHIAGVGFDLYVRLVGEAVE----AYRALADGKVVDGTVKGPKEIR---------
Q9F2P1_STRCO          GGEQSGHIAGVGFDLYVRMVGEAVA----DYRASLEG---GVEEEPPLEVK---------
Q8G5I7_BIFLO          GDEQSGHIEGVGFDLYVRMVSEAVE----KYKEP-------EENVEPVAVS---------
Q83N19_TROWT          GHAQSGHIASVGFDLYIRMVTDAISNFK-------------GEQSRTNNLR---------
MFD_MYXXA             GDKQSGAIAEIGFDMYAQLLEEAVAEMQ-------------GQPPKVQIEP---------
Q74H75_GEOSL          GAKQSGNIAAVGFDLYTELLEEAVQKLK-------------GEEPVERVEP---------
Q1IHV1_KORVE          GGEQSGQIEAVGFELYTTMLERTVREMK-------------GEVQEEQAET---------
Q2RMB9_MOOTA          GPEQHGHMVAVGFDLYCQLLEEAVRKLKEQRGE--------GVPRPALAEPQATP-----
A9WHG9_CHLAA          GAEQSGHIAAVGFDLYSRLLEQAVRKLKQDVDELAETATDSSVTPAVMAESLRAPNVSER
I0IRW8_LEPFC          GHQQTGHISMVGLDLYMEMVEEAIQTRVEP-----------VAIPVVRETP---------
MFD_BACSU             GAQQHGFIDSVGFDLYSQMLKEAIEERKGDT-------------AKTEQFE---------
Q8YAD0_LISMO          GAQQHGFIDSVGFDLYSQMLKEAIEAKKPKE-------------EQKQIVP---------
Q839B9_ENTFA          GAQQHGFIDSVGFDMYSQMLSEAVARKQGKN-------------IQDQKTS---------
F9UL13_LACPL          GKQQHGFIDSVGYDLYTQMLSEAVAKKRGQ--------------AAKVKTD---------
MFD_STAEQ             GKQQHGFIDSVGFDLYSQMLEEAVNEKRGIKE------------ESPDAPD---------
MFD_STAES             GKQQHGFIDSVGFDLYSQMLEEAVNEKRGIKE------------ESPDAPD---------
MFD_STAHJ             GKQQHGFIDSVGFDLYSQMLEEAVNEKRGIKE------------EEPDAPE---------
MFD_STAA8             GKQQHGFIDTVGFDLYSQMLEEAVNEKRGIKE------------PESEVPE---------
MFD_STAS1             GKQQHGFIDSVGFDLYSQMLEEAVNEKRGIKA------------EKQDAPE---------
Q9CJI0_LACLA          GSEQSGFIDSVGFDLYSQLLEEAIHAKLGTSK-------------QKRTSN---------
Q8DRQ1_STRR6          GKSQSGFIDSVGFELYSQLLEEAIAKRNGNANA-----------NTRTKGN---------
Q97E98_CLOAB          GSAQHGHMATIGYDLYCRMLEDTIKEIKGEIQ--------------NEPVE---------
A5I7R4_CLOBH          GSAQHGHMASIGYDLYCRMLEDTIKLVRGDID--------------KEPVE---------
D3R0N9_MAGIU          GGEQHGQMAAVGYDMYCRMLDEEIAKAETELNGEAG----SKPKNSLPAVE---------
B8E2E1_DICTD          GKEQHGHINSVGFYLYLQLLEEAINELKSNKEG-----------SEKNKIN---------
MFD_ECOLI             GEEQSGSMETIGFSLYMELLENAVDALKAGRE--------PSLEDLTSQQ----------
MFD_HAEIN             GNEQSGQIESIGFSLYMELLDAAVKALKEGRE--------PSLEELTQQQ----------
Q8EEV8_SHEON          GDEQSGHISKIGFSLYMEMLESAVKALKQGKE--------PSLAQMLNQQ----------
Q9HZK3_PSEAE          GDGQSGQIQAVGFTLYMEMLERAVKAIRKGEQ--------PNLEQPLGGG----------
Q83CG9_COXBU          GVEQSGQIHDIGFSLYLELLEEAVSALKAGRE--------PQFEKPLHAV----------
Q63T69_BURPS          GDKQSGEIHEIGFQLYTEMLNDAVKALKNGKE--------PDLTAPLAAT----------
Q7VZN3_BORPE          GDSQSGNIQEVGFSMYNEMLNEAVRALKAGEE--------PDLDAPFNLA----------
Q8P7B3_XANCP          GEDQSGQMAEVGFSLYTELLERAVRSIRQGKL--------PDLDAGEEVRG---------
Q5NH30_FRATT          GEEQSGNIDGIGLNLYMDLLDKTIANLRAGKK--------LNIEEVINSTV---------
MFD_RICFE             GEEQSGQIKEVGTELYQEMLEEQIAIFKD-----------EPIVSE-QLFI---------
MFD_RICCN             GEEQSGQIKEVGTELYQEMLEEQIAIFKD-----------ESIVSE-QPFI---------
MFD_RICPR             GEEQSGQIKEVGTELYQEMLEEQIALLKD-----------DPIVLE-QAFI---------
MFD_RICTY             GEEQSGQIREVGAELYQEMLEEQIALLKD-----------ESIVSE-QSFI---------
MFD_RICBR             GEEQSGQIREVGTELYQEMLEEQIAIFKD-----------EPISGE-QPFI---------
Q3YR59_EHRCJ          GEEQSGNIKDVGIELYQQMLEEELNIHNE-----------NPKD----FDH---------
Q2GLL6_ANAPZ          GEEQSGNIKEVGIELYHRMLEEALETCKM-----------TTESSAVSCHN---------
A9CIN2_AGRFC          GEEQSGHIKEVGFELYQQMLEEAVAEVK---G--------DEEVRDSG-WS---------
Q89LE3_BRADU          GEEQSGHIKEVGFELYQSMLEEAIVNLKA--G--------VSEPAADR-WS---------
Q9A782_CAUVC          GDEQSGHIKEIGVELYQQMLEDAVAELRQRQG--------QEALLEDRGWS---------
Q2RTL9_RHORT          GDEQSGHIKEVGIELYQQLLEEAVAAARE--G--------PGVEEASGAWS---------
Q3J2M4_RHOS4          GEEQSGHIKEVGYELYQQMLEETIQKIRSGEL--------QGLSEPDEQWA---------
MFD_HELPY             GQDQSGHIKNIGYALYTRMLEDAIYELSG-------------GKK-RLEKS---------
MFD_HELPJ             GQDQSGHIKNIGYALYTRMLEDAIYELSG-------------GKK-RLEKS---------
Q7M928_WOLSU          GEAQSGHIKGIGYALYLKMLEEAIHSLSS-------------KAL-PKRED---------
Q0P9G9_CAMJE          GVDQSGHIEQIGYSLYLKMLEDELNALSK-------------NEVDQKENK---------
A0A0H3P9Q7_CAMJJ      GVDQSGHIEQIGYSLYLKMLEDELNALSK-------------NEVDQKENK---------
A7ZE35_CAMC1          GEAQSGHIEAIGYSLYLKMLEDEINKLLN-------------QDS-AKLDK---------
E0UPP9_SULAO          GDAQSGHIKNIGYSLYLRMLEDAIKELSN-------------TVE-GERAK---------
I0GL09_CALEA          GKEQHGHIISVGYNMYLSLLDQAIKELEGVS--------------VSEVKE---------
Q8RH90_FUSNN          GEKQHGAVETFGYNLYMKMLNEEILKLKGEA--------------EEELDE---------
MFD_BORBU             GREQHGEIESIGLDYYLTMLNKAIEKKMGKI--------------SSDEEE---------
F0S455_DESTD          GPKQSGFVNTIGLDLYLKLFEEVTTEKEEE--------------------D---------
E1X1P6_HALMS          GAEQSGQIDNVGLELYMQLLKEAIQELRGEK--------------KLIKQD---------
MFD_SYNY3             GAEQSGQMEAIGYEFYMEMLQDAIKEIQG--------------QEIPKVED---------
Q8DKA7_THEEB          GAQQHGQLDSVGFDLYVELLEEAIAEIRG--------------QEIPTVDD---------
Q7NEP2_GLOVI          GAEQSGQLNAIGFDLYMELLEEAIQEIRG--------------RKLPKVED---------
Q7VBU2_PROMA          GIQQSGQMEIIGFDLYMEILHESIAEIQG--------------QTIPVVEE---------
Q8F395_LEPIN          GKEQSGDIMEVGFDLYVRMLEDAIARIKG--------------EEIVVEVR---------
B5YL15_THEYD          GVEQSG-VNRLGFDLYIEMLNEAVKEIKG--------------EVLPALKL---------
A6GW35_FLAPJ          GGEQSGFINEIGFDTYQKIMNEAIEELKENEF------------KDLYENDN----ETVE
Q8AB59_BACTN          GAEQSGFIADLGYETYQKILAEAVHELRNDEF------------AELYADEIKGEGQISG
Q2S6G5_SALRD          GAEQSGFIEDVGYETYHKILDQAVKELREEEF------------DDVFDGEA--------
Q8KEN4_CHLTE          GAEQSGFIHEIGFDLYQKMIEETVAELKLTEF------------NHLFSDSE-----KAA
O84753_CHLTR          GTDQSGHISAVGFNLYCKLLKKAVAALKHKQK------------PMLFHDDI--------
M1WUP8_PSEP2          GEAQSGQIAKVGLELFLEMLEEEVRRLQGESE--------------ARASE---------
Q72AT7_DESVH          GEAQSGHMTRVGLELFLEMLEEAVTRLKGDPP--------------RESVE---------
B9KVH0_RHOSK          GERQSGHVRLIGLPLYQHLLAQAVRAARGEP-----------------------------
B0UM39_METS4          GEEQAGHVKLIGLGLYRDLLERAIRAARGEP-----------------------------
Q1YKV9_AURMS          GDEQAGHVQTIGIGLYRKILERAVALAQGQPE----------------------------
E8TPS0_MESCW          GEDQAGHMKLIGVGLYEHLLERAVSAAGEGAD----------------------------
C6B9D3_RHILS          GEDQAGHMKVIGIGLYQKLLAGAVARLRKQPA----------------------------
A4YQE5_BRASO          SEQQAGHVQVFGPALYQELLSRALQGR-PHRA----------------------------
A5EAY9_BRASB          SDRQSGHMQVFGPTLYGHLLTLALEGD-RDGM----------------------------
D1B5L3_THEAS          GTAQHGHVSSLSPELYFQMLEREVTRLKGGA-----------------------------
Q9RU62_DEIRA          GEEQHGHVQAVSIDVYTELLAEAVAKLKGEKV----------------------------
Q5SJW3_THET8          GPEQHGHIRALSLEVYTELLEEAIRKLKGEAK----------------------------
I0IIW6_PHYMF          GDEQSGHVAAVGHALYSRLLQRAAREQAGDLR--------------PAPER---------
                      .  * * :  ..   :  :.                                        

MFD_MYCBO             --------IDLPVDAHLPPDYIASDRL------RLEGYRRLAAASSDREVAAVVDELTDR
MFD_MYCTU             --------IDLPVDAHLPPDYIASDRL------RLEGYRRLAAASSDREVAAVVDELTDR
Q8NRS9_CORGL          --------VDLPVDAHIPEKYINAERL------RLEIYRKLAQSESEVDLRLAVEEMEDR
Q9F2P1_STRCO          --------IELPVDAHVPHDYAPGERL------RLQAYRSIASANSEEDVKAVREELVDR
Q8G5I7_BIFLO          --------IDLPIEASIPIEYIDSDKL------RLEAYRKLASARNEADLKDLEEELTDR
Q83N19_TROWT          --------LEIPVDASIPKAYVDSERL------RIELYKKISEALSDADIKDIGDEILDR
MFD_MYXXA             -------DVTLPMPALIPDDYVSDVHQ------RLVFYKRFSQASHPDEVTDLRAELVDR
Q74H75_GEOSL          -------EINLRVPAFIPEDYVREPNQ------RLVIYKKLTQATAEEEVGEVMEELVDR
Q1IHV1_KORVE          -------QLNLGLNIRIPPEYIKEENQ------RLRMYKRVAGVEGEPQLNDVAAELQDR
Q2RMB9_MOOTA          --------IELSVDTFLGDNYIPEATL------KMELYHRLMNAGDLAAVEDIAAEMEDR
A9WHG9_CHLAA          VLVAPLVTIDLPLTAYLPPDYISDETV------RLAVYQRMVDATTLDEVRGLRQELIDR
I0IRW8_LEPFC          -------RIDLGREARLPEDYVVHPGL------RIDFYRRLAHSFKDLEIDQIESELRDR
MFD_BACSU             ------TEIDVELDAYIPETYIQDGKQ------KIDMYKRFRSVATIEEKNELQDEMIDR
Q8YAD0_LISMO          ------VEIDIQADAYIPEYYITDGRQ------KIEMYKRFRNIETLSELEDLQSDMIDR
Q839B9_ENTFA          ------VEIDLGIDAYIPGTYITDERQ------KIEIYKRIRQLENMDMYEELEADLLDR
F9UL13_LACPL          ------ATVELGIEAYLPTSYIEDERQ------KIEIYKRIRQLENNDQYMEVQDDLMDR
MFD_STAEQ             ------IEVELHLDAYLPAEYIQSEQA------KIEIYKKLRKVETEEQLFDVKDELIDR
MFD_STAES             ------IEVELHLDAYLPAEYIQSEQA------KIEIYKKLRKVETEEQLFDVKDELIDR
MFD_STAHJ             ------VEMELNLDAYLPAEYIQNEQA------KIEIYKKLRKVETEEQLFDIKDELIDR
MFD_STAA8             ------VEVDLNLDAYLPTEYIANEQA------KIEIYKKLRKTETFDQIIDIKDELIDR
MFD_STAS1             ------IEIELNIDAYLPAEYIPNEQS------KIEIYKKLRKIESETQLMDVKDELIDR
Q9CJI0_LACLA          ------VEISLELDAFIPAYYISDERQ------KIEIYKRIRQIDSREIYEELQEELVDR
Q8DRQ1_STRR6          ------AELILQIDAYLPDTYISDQRH------KIEIYKKIRQIDNRVNYEELQEELIDR
Q97E98_CLOAB          ------TTVDLKVDAYIPSLYIEDETL------KISIYKKIAAIDSYEEMMDVKEELEDR
A5I7R4_CLOBH          ------TSVELKIDAYIPNTYIKDETQ------KIEVYKKIASIDSKEEFMDIEEELEDR
D3R0N9_MAGIU          ------TIVDIPVDAYLPREFIADEGQ------RMDMYKRLTAIESDRDYHDVIDELLDR
B8E2E1_DICTD          ------CHIIHPFPAIIPEYYISQSSD------RIYYYQKLAHLEDINDIEKIKKEMEDI
MFD_ECOLI             ------TEVELRMPSLLPDDFIPDVNT------RLSFYKRIASAKTENELEEIKVELIDR
MFD_HAEIN             ------ADIELRVPALLPDDYLGDVNM------RLSFYKRIAAAESKAELDELKVELIDR
Q8EEV8_SHEON          ------CEMELRIPALLPEDYVGDVNI------RLSLYKRIASCDSEEALDELKVELIDR
Q9HZK3_PSEAE          ------PEVNLRVPALIPEDYLPDVHA------RLILYKRIANAPDEEGLRELQVEMIDR
Q83CG9_COXBU          ------SEIDLGITTLLPEDYVPDVNA------RLILYKRLANCKNKREIQALKEELIDR
Q63T69_BURPS          ------TEINLHAPAILPADYCGDVQE------RLSLYKRLANCEHGDAIDGIQEELIDR
Q7VZN3_BORPE          ------CEVNLHAPALLPSDYCPDVHG------RLAIYKRLSHADGEDDLIRIQEELIDR
Q8P7B3_XANCP          ------AEVELHVASLIPEDYLPDVHT------RLTLYKRISSARDSDALRELQVEMIDR
Q5NH30_FRATT          ------CEVELNIPTLIPDYYIYDVNT------RLNIYKRISKASHQD-LVNIKIELIDR
MFD_RICFE             ------PTINLGLSVFIPDNYISDSAL------KLGLYRRIGNLSNEIEVEKFKDEMIDR
MFD_RICCN             ------PTINLGLSVFIPDNYVADAAL------KLGLYRRIGNLSNEIEVETFKDEMIDR
MFD_RICPR             ------PNINLGLSVFIPDSYVSDSAL------KIGLYRRIGNLSNEMEVEKFKDEMIDR
MFD_RICTY             ------PNINLGLSVFIPDHYVSDSAL------KIALYRRIGNLSNEIEVEKFKDEMIDR
MFD_RICBR             ------PTINLGLSVFIPDNYVSDSVL------KLGLYRRIGNLNDDLEVEKFKDEMIDR
Q3YR59_EHRCJ          ------INISINVNIRIPEHYIKDIGL------RMRVYKKIGNLKTKQEIDNYHIELINK
Q2GLL6_ANAPZ          ------IKVDINANVRIPESYIQELEL------RMQVYKKISSLKTPEEISRYSEELKDR
A9CIN2_AGRFC          ------PQISVGTSVMIPEDYVPDLHL------RMGLYRRLGELADISEIDGFGAEMIDR
Q89LE3_BRADU          ------PSITIGMPVLIPEDYVSDLSV------RLSLYRRLADLDTEEEIENFGAEMRDR
Q9A782_CAUVC          ------PQINTGAAVMIPDDYVPDLNV------RLSLYRRLSEAEQAADREALAAEMIDR
Q2RTL9_RHORT          ------PQIQLGTPILIPDSYVKDLGL------RLGLYRRIAGVTDEAEIDEMAAEMVDR
Q3J2M4_RHOS4          ------PQINLGVPVLIPEEFVPDLDV------RLGLYRRLSGLTTKVELEGFAAELIDR
MFD_HELPY             ------VEIQLGVSAFLNPELIASDSL------RLDLYRRLSLCENTDEVGQIHEEIEDR
MFD_HELPJ             ------VEIQLGVSAFLNPELIASDSL------RLDLYRRLSLCENVDEVGQIHEEIEDR
Q7M928_WOLSU          ------VDLKLSINAFLSPELIESDRL------RLELYRRLSRCESTQEVNEIEVEIHDR
Q0P9G9_CAMJE          ------LDLKLNVNAFLNSELISEDRL------RLELYRRLSKCEQVHEVYEIESEIEDR
A0A0H3P9Q7_CAMJJ      ------LDLKLNVNAFLNSELISEDRL------RLELYRRLSKCEQVHEVYEIEGEIEDR
A7ZE35_CAMC1          ------IDLKLGVSAFLNQEFIREDRL------RLEIYRRLSKCKEVSEVYEIQSELEDR
E0UPP9_SULAO          ------VDVKLTISAFISDEIVKEDRL------RLDIYRRLSQCENAVEIYEIEEEVIDR
I0GL09_CALEA          ------VSVRLNESYYIKETYIPLNAE------RINYYRRITLAESIDELRKIEGELWDK
Q8RH90_FUSNN          ------VDVELNFPRFLPDNYIEKN-E------KVKIYKRALALKNLDELENLYNELEDR
MFD_BORBU             ------VDIKINYSGFIPENYAKNEQD------KILIYKKIFKIQTEEESKKIRSELHND
F0S455_DESTD          ------VKITVPFEAFIPEDYIEDTKE------RLRIYGELSKSENPEE---ILSEIEKV
E1X1P6_HALMS          ------VEVKTPFPSYIPANYIKDSSE------RLKQYKRLSNCDNLENLFNIKDEFVDV
MFD_SYNY3             ------TQIDLPLTAFIPSDYIPDLEE------KMAAYRRITSIESTDELPKIALDWGDR
Q8DKA7_THEEB          ------TQIDLNVTAFIPADYMPDLAQ------KMAAYRAVSAATTKEDLMQLAAEWSDR
Q7NEP2_GLOVI          ------TQIDLRVTAFIPADYIPDLEQ------KMRAYRQVAAAPDRAQLQAAALEWTER
Q7VBU2_PROMA          ------TKVDLPITAFIPNTWIKSNEE------KLTAYKQASECSTIDKLLELTAIWIDR
Q8F395_LEPIN          ------TSVTLNTNFFIPETYISDTRQ------KIEFYKKLEGARDLDEIEEIYSEMLDR
B5YL15_THEYD          ------PEIKFSIPAFIPEEYIKETPM------RIRIYRKLSQISEDSEIEKLYDEIIDR
A6GW35_FLAPJ          KEYVKDLQIDSDFELLFPDDYINSVTE------RLALYNALAIIKEENGLLEYEKQLIDR
Q8AB59_BACTN          EEFVDECQIESDLELLLPATYVTGSSE------RMLLYRELDGLTLDKDVDAFRFRLEDR
Q2S6G5_SALRD          VPPGPETSVDVEEDAYIPESYLRDNTE------RLNLYRRISDAPDETTLVDLLDEMEDR
Q8KEN4_CHLTE          LKPQRPCDMIFFFDALLPDYYITATQE------RFSCYDRISKAADNTALQNIAKELEDR
O84753_CHLTR          -------KIEFPYHARIPEDYIDLASM------RIEFYQKIGNAESEEELEAIEEELRDR
M1WUP8_PSEP2          ------PELNFIFEAHIPGDYIDDARE------RLRYYKSLSSAKDEIALKELEAEIKDR
Q72AT7_DESVH          ------TELNIGIPAHIPEGYIEDARD------RLRFYKALSSATDAAAQQDIEMEMRDR
B9KVH0_RHOSK          -PTAQHVSLAMEGDGALPADYIPEAGL------RLGLYRRLARAADPREVALLADEIEDR
B0UM39_METS4          -PEAAPAEIRLGLAGAIPAAYLPEPEL------RFGLAARIARLRSPEEAEALRDEIEDR
Q1YKV9_AURMS          -PDDVRPVIALGLPATIPADYVPEPDM------RIELALLLERVSDAATLDALRVEIEDR
E8TPS0_MESCW          -PNRQLANINVPAKGAFPESYVNEPTV------RVGLYARLSRIRSDLDLDAFSEELEDR
C6B9D3_RHILS          -GTPLRAIVNLGVAGTIPSDYVSDPAV------RLNLYAKLLRASTLSEMDDLEEEFEDR
A4YQE5_BRASO          -AEFWLPELRIDRPAFLPSDYVQDQVT------RLDVYARLAHAETVADIDDIEDDMQLR
A5EAY9_BRASB          -SALWIPELNLPIPELLPASYVQSEAV------RLEIYARAARCRSDDELEELEDETQRR
D1B5L3_THEAS          ----ELPPVEWGYSPSIPEWYVEDQPL------RVRLYRRLFLPMDASELDQLRDEMVDR
Q9RU62_DEIRA          -EAAPSISIDLPVNARLTPEYFVDADGQPNEGERIATYGRLSDARTLQAISRVERDLRKK
Q5SJW3_THET8          -EERRHVTLDLALSARLPAEYVGSLEA------RSRYYSRFAEAKSLAELSRLVRELKER
I0IIW6_PHYMF          ------TGHALPNTGNLPAAWIPPSLP------RLNAYRWLTHVDDEDQLGVAVAHLTRT
                                      .                :                          

MFD_MYCBO             YG-ALPEPARRLAAVARLRLLCRGSGITDVTAASAAT-----VRLSPLTLPDSAQVRLKR
MFD_MYCTU             YG-ALPEPARRLAAVARLRLLCRGSGITDVTAASAAT-----VRLSPLTLPDSAQVRLKR
Q8NRS9_CORGL          YG-PIPEEVERLLAVSRLRHLMREAHLTDI-AVQGTR-----IKVHPVDLADSQQVRLKR
Q9F2P1_STRCO          YG-KLPEPVENLLLVAGLRMLARACAVGEI-VLQGNN-----IRFAPVELRESQELRLKR
Q8G5I7_BIFLO          YG-KPPVEFETLFDVARLKFKARKLGISEI-LAQSNR-----VRIGRIDPPESIQMRMGR
Q83N19_TROWT          FG-NLPSQVINLLELARLRILASSRGIDLITLKSDFRQGGDVVTVSPVSFSDTAHQNLLR
MFD_MYXXA             YG-EAPDEVDHLSELTLLKIDMRDLRLRGLEVGTTRLVVTLGADALLDGPKVAGLVQRSK
Q74H75_GEOSL          FG-TLPLAASYLLDVMKLRIMLKHFLVRMAEFDGKRLCLSFHEKTPVSPDTIIGLIKANP
Q1IHV1_KORVE          YG-APPAPVRNLIQYARLRLLAERIGIAGIDRQRDQINMRFTEKAQIDPEKLAKFVGRTK
Q2RMB9_MOOTA          YGPPPPE-ARNLLALTRVRILAREVGVISVNQKNREVELSFGQHTGLRGEKLLQLNQYFP
A9WHG9_CHLAA          FGGPLPEPVLHLILWLQIRLLALQAGVASITTEGD--VFFIRLSTPLAAGVRERLRRRFP
I0IRW8_LEPFC          FG-PLPRSARALILGAKIRVMTTRMGISEVRLKDREIFLKPSAEKALSPRNAGKIAQAFP
MFD_BACSU             FG-NYPKEVEYLFTVAEMKVYARQERVELIKQDKDAVRLTISEEASAEIDGQKLFELGNQ
Q8YAD0_LISMO          FG-EYPEEVEYLFTMTELKVRALEVGIESVKQEQNKITMLFSESGTAGIRGDIVMQIIGE
Q839B9_ENTFA          FG-EYPDEVAHLLTTGRIKMDGDRALLESIRKRDQKVKFVLSKIGTKTYSVEQLFEALSA
F9UL13_LACPL          FG-DYPVEVAGLLAVGKLKLLADDALIEKIQRDDSELHLTLSKQGTAKLDTKDIFKALAK
MFD_STAEQ             FN-DYPIEVERLLDIVEIKVHALHAGVELIKDKGKSIQIILSPKATEDINGEELFKQTQP
MFD_STAES             FN-DYPIEVERLLDIVEIKVHALHAGVELIKDKGKSIQIILSPKATEDINGEELFKQTQP
MFD_STAHJ             FN-DYPVEVERLLEMVEIKIHALHAGVTLIKDKGKQIEVSLSTKATEQMNGEELFKQTQP
MFD_STAA8             FN-DYPVEVARLLDIVEIKVHALHSGITLIKDKGKIIDIHLSVKATENIDGEVLFKATQP
MFD_STAS1             FN-DYPIEVERLLEMMEIKVHALHAGVTLIKDVGKQVEVYLSEKGTTDINGETLFKQTQP
Q9CJI0_LACLA          FG-EYPDEVAYLLEIGLLKPFADNVLVEKIEKSRFEATVTLEKVANTTYDPQDYFKALAK
Q8DRQ1_STRR6          FG-EYPDVVAYLLEIGLVKSYLDKVFVQRVERKDNKITIQFEKVTQRLFLAQDYFKALSV
Q97E98_CLOAB          FS-SIPQSVNNLMTIAYLRSIGRQLGILEIKDKMTQLEIKFESNDRVNKKLINGLLKNYS
A5I7R4_CLOBH          FS-DIPISVYNLMNISYIRSLGKKVDIEEIKEISNEVVFQFEDKSSLREKIVKIIMDKYS
D3R0N9_MAGIU          FG-ELPPEVTVLAAISYIRHMASKAGIERVSRQDDRIIMRLPAGQKVNMPLIAAIMAQQS
B8E2E1_DICTD          YG-PIPDSVENLCLLSQIKFFAEKIGIEKIEISENQVKLTYSKGIERTLNLP--------
MFD_ECOLI             FG-LLPDPARTLLDIARLRQQAQKLGIRKLEGNEKGGVIEFAEKNHVNPAWLIGLLQKQP
MFD_HAEIN             FG-LLPDATKNLLQITELRLLVEPLNVVRIDAGTQGGFIEFSAKAQVNPDKFIQLIQKEP
Q8EEV8_SHEON          FG-LLPDATKNLMEMTLYKHQATRLGATKIEVHAKGGSIEFSQDHSIDPGFIIGLLQSQP
Q9HZK3_PSEAE          FG-LLPDPAKNLMRLTLLKLQAEKLGILKVDAGPQGGRIEFAADTQVDPLVLIKLIQGQP
Q83CG9_COXBU          FG-PLPPAAQHLLQSAELRLIANELGIQKINIGSKYGYFHFDKKPAIDLTKLIKLVQTQP
Q63T69_BURPS          FG-KLPPQAHALVETHRLRLAAKPLGIVKIDASEAAIGLQFVPNPPIDPMRIIDMVQKH-
Q7VZN3_BORPE          FG-KLPEAAQTLLATHRLRLAAQPLGIVKIDASETQALLQFGAKTTVDPLRIIELVQRQ-
Q8P7B3_XANCP          FG-LLPDPVKHLFAIAELKLQANALGVRKLDLGENGGRLVFEAKPSIDPMTVIQMIQKQP
Q5NH30_FRATT          FG-KLPLEVLYLLKVAHIKIDAIALGISQIKMFATSGKISFSNNTKFEPQKLIKLIQSQP
MFD_RICFE             FG-SLPIEFNNLLDIVKIKLLCFKLNIENLDSGDNGFVIKFYKNADMTD-KILKFVSTYS
MFD_RICCN             FG-LLPIEFNNLLDIVKIKLLCFKLNIENLDSGDNGFVIKFYKNADMTD-KILKFVTTYS
MFD_RICPR             FG-LLPIEFNNLLDIVKIKLLCFKLNIENLDSGDDGFVIRFYKNADMTD-KILKFVSRYS
MFD_RICTY             FG-LLPIEFNNLLDIVKIKLLCFKLNIENLDSGDDGFVIRFYKNADMSD-KILKFVSRYS
MFD_RICBR             FG-SLPTEFNNLLDIVKIKLLCFKLNIENLDSGDNGFVIKFYKNADMAD-KILKFVSTYT
Q3YR59_EHRCJ          FG-NLPNEVENLLNTIYIKQLCANIGIYEIEQVKNIIYLRIQSNTTFKQ-EALNYFINNP
Q2GLL6_ANAPZ          FG-MPPREVINLLDIIHIKHLCARIGIAEITHFKNHLTLLFGRSFTPQE-SLLKYFVNNA
A9CIN2_AGRFC          FG-PLPKEVQHLLKIVYIKSLCRTANVEKVDAGPKGVVVQFRNKEFPNPAALVGYIGKQG
Q89LE3_BRADU          FG-VLPDEVRYLFKVAAIKAFCRRANVEKIDAGPKGAVIAFRDNSFAYPDRLVTFIRSHG
Q9A782_CAUVC          FG-PLPPETDSLLKVVAIKGLCREANVAKIDVGPKGAVASFRGDSYANPLGLMQHVAKNS
Q2RTL9_RHORT          FG-PLPDEVENLLKVVTIKVLCRRANAEKVDAGPKGAVLSFRDNLFPNPGGLVRFIGQNV
Q3J2M4_RHOS4          FG-PLPREVNTLLLVVRIKAMCKRAGISRLETGPRGATVQFHNDKFANPAGLVDFIKAQG
MFD_HELPY             FG-KIDDLSAQFLQIITLKILANQLGIIKLSNFNQNITITYSD-----------------
MFD_HELPJ             FG-KMDDLSAQFLQIITLKILANQLGILKLSNFNQNITLTYSD-----------------
Q7M928_WOLSU          FG-SPDLYTKQFLELILIKVLASLQGIKTITNYNQNITFFYRD-----------------
Q0P9G9_CAMJE          FG-KLDIYTKQFLSLITIKILALNK-FKSISNYEQNIQFTALN-----------------
A0A0H3P9Q7_CAMJJ      FG-KLDIYTKQFLSLIIIKILALNK-FKSISNYEQNIQFTALN-----------------
A7ZE35_CAMC1          FG-KIDTFTKQFLDLIIIKILALKAGIKTISNSEQNILITKND-----------------
E0UPP9_SULAO          FG-ELDVPTKQFFELMVIKLLSLEKKIKTIANYGQNITFTYLN-----------------
I0GL09_CALEA          FG-YPPIEVRNLLTVGEIMVHAREIQAREIYQ---EGKRVFIIIERTSKITVDDLMSLSK
Q8RH90_FUSNN          FG-KIKSEAKGFFDFIKIRIIARDLGITTIKQDK-ENKDRILINFNEKKINVDKIIYLLS
MFD_BORBU             FG-PIPEEINSLLMLAELKILAKDLNITKLKE---KNRALEIEYKNIESIPMEKIIEILQ
F0S455_DESTD          HG-AIPDPLVNIFKIMKIKKLAKEIGIKEITMTP---SGRLVIVFGESPNILPEKLVEFV
E1X1P6_HALMS          YG-AIPIELENLFTTLEVRMSLMDASLKMIQVGGRLATLTFDKNYIEQNLELRNRMLDYF
MFD_SYNY3             YG-MLPSPVEELFKVVKLKHLAKSLGFSRIKVEGKQNLVLETPMEEPAWKLLAENLPNHL
Q8DKA7_THEEB          YG-ALPKSVQQLLRVVELKQLARQCGISRIRPEGKQHVILETSMAEPAWKLLLEQLPTHL
Q7NEP2_GLOVI          YG-PVPPAAQQLLRVMELKQVARALGFARIRPEG-TNIVLETPMEAPAWEQIHQALPAEV
Q7VBU2_PROMA          YG-VLPAPVEALILIMKLKIKSKACGFSRIRLNK-PNIVLETMMNESTFSSLRDGLEGHL
Q8F395_LEPIN          FG-EPPEDAKTFILLEKIRTLASNLGFEFVTEMKDEIKMKSGSYFRGDHTKIIQLISART
B5YL15_THEYD          FG-MPPKEVENIFKIARIRLLVSKIKASEVKQKKNTFKFKMEENLDTGFVNRLLHILTGF
A6GW35_FLAPJ          FG-PLPKQAIALLNSLRIKWIATQIGVEKLILKQGKMVCYFVSDQQSDYYQSKRFHQVLQ
Q8AB59_BACTN          FG-PVPPETQELLRIVPLRRLAARLGVEKVFLKGGRMTLFFVSNADSPFYQSQAFGKMID
Q2S6G5_SALRD          FG-DAPEPVQNLLTGARLRLLGERLRMPKVVYKNERLFLYLPSEDADPYFYDEVFHPLLE
Q8KEN4_CHLTE          FG-AMPAEVQNLLALARLKHLGSSLGLEKIDLQQSSATIFLPSDEDKEFYDSAFFQNLIV
O84753_CHLTR          FG-PSPEAISWLFALARIRLIAQEYHLSSIKGTGNALYIQQYHDKDKQIQKTLPYSLSPT
M1WUP8_PSEP2          FG-HLPQQLETFFGVLHIKQSLSRLQAERAELYPGRVVVTWGA-QSSVNPAELMGWINER
Q72AT7_DESVH          YG-VFPPELETFLALLVLKRQLRRMQVQRADIYPDKVRLVWDERQTAVDIGRLIEWVGQH
B9KVH0_RHOSK          FG-PPPAAAAGLLVAAEIRALARSLGIERVSAGPSGVALDLAPDACVERFAEDLPEGV--
B0UM39_METS4          FG-PLPPETETLLTLAGLRMACRDLGIAQLGAGPQGLAADFHPGRAAAVARAIAEVER--
Q1YKV9_AURMS          FG-PMPATLLTHFRLAELRLRCRAAGVAKLDHGPKATALGFTPAMSAALQDAGIEDRLDD
E8TPS0_MESCW          FG-DMPGEVTVLLELTRLRIAASELGVGKVDVGPEAVAITLRNKPLASRWRD-RKVLG--
C6B9D3_RHILS          FG-ELPQDVLLLLRTTRLQLAAGRLGIAKLEAGPKALAMTLTPKTPAKVIAALTKKAG--
A4YQE5_BRASO          FG-HPPQEASNLIASARIRLDCHALGIARLDVGTEGIAARLRPAATAGTPRPGRPR----
A5EAY9_BRASB          FG-KLPSEAGNFFAVARLRVNCRERGIMRLDVGPDAIAATMLAGKIRKSCSRLLQREG--
D1B5L3_THEAS          FG-PVPHQVEELILAARLRVLLAGL-ASEITIGRDQVQVRFRDSAAVPKGLPPIWRVK--
Q9RU62_DEIRA          YG-PPTPEVQNFIDLAKLRLTALAKRVLSIGETMTQLQITFAYKALDYDAPGLKKFPH--
Q5SJW3_THET8          YG-PLPEEAENFVALARLRLVAERKGVVSITEGLTHLEVVFPRYPLDYDARGLKGLPY--
I0IIW6_PHYMF          WG-EPPEQARRFVAGVRLRLAMADAGVLHAAKSKKGITLTLALPPARDEHEAHRGSAVEQ
                       .                                                          

MFD_MYCBO             MYPGAHYRATTATVQVPIPRAGG-LGAPRIRDVELVQMVADLITALAGKPRQHIGITNPS
MFD_MYCTU             MYPGAHYRATTATVQVPIPRAGG-LGAPRIRDVELVQMVADLITALAGKPRQHIGITNPS
Q8NRS9_CORGL          LFPGATYRAAAKAIQLSFPKTGNKVTDPLLRDVDLLQWVANFISNMFNLEEIDVRGPQPG
Q9F2P1_STRCO          LYPGSVIKPGTHQVLVPRPKTAK-VGGKPLVGRELLGWVGEFLTSILGS-----------
Q8G5I7_BIFLO          IYKGTQYRPVTHQLIVPTPFTGS-LGQGPMSSDQVVLWTNQLLDDLAWTPSSSKRQSRL-
Q83N19_TROWT          DGQFSFICYRNSKLSACINRSSSEHSGYSEHSAQIINSIRHFIITSCN------------
MFD_MYXXA             GVYRLTPDMKLIARAPQGASGQDLISEAKKVLRDLSHCALPQA-----------------
Q74H75_GEOSL          KRYQFTPDFRLVAELADTSF-EGVLAEARNLLKRLG------------------------
Q1IHV1_KORVE          G-AKFTPQGILKFALKAITA-DEVLNGLLALLQQLSDAAVAKIQTPSS------------
Q2RMB9_MOOTA          RKLAFSSAGGLTIRVRVMGLSQEELLDLLEKVLTRIKYLVTEAAS---------------
A9WHG9_CHLAA          RDAAIA-FGPQSIRLDRRLLGSQ----WPERLLAVVELLAGYSGT---------------
I0IRW8_LEPFC          DRITFHRDGSFTLSGPASGFPDDLARLEELLS----------------------------
MFD_BACSU             YGRQIGLGMEGKKLKISIQTKGRS-ADEWLDTVLGMLKGLKDVKKQTISST---------
Q8YAD0_LISMO          FGRMVGVGMEGTQLKITINVQNKP-LKEWLYQVKSLAEKLRGAMKEKASTEN--------
Q839B9_ENTFA          TSLKADLAVEKEQMTISLKLPKDCKEAVWIQEIAAFTTALRQEKYKHSQGTDSL------
F9UL13_LACPL          TKLKATVGIDDDKMKVKLVIQPKMQQDEWLAQLTQFVEQLSLILAEDDVASAS-------
MFD_STAEQ             LGRAMKVGVQNNAMNVTLTK-----SKQWLDSLKFLVRCIEESMAIKDED----------
MFD_STAES             LGRAMKVGVQNNAMNVTLTK-----SKQWLDSLKFLVRCIEESMAIKDED----------
MFD_STAHJ             LGRAMKLGVKENRMHVTLTK-----SKQWLDNLKFLVRCLEGSMVIEDEN----------
MFD_STAA8             LGRTMKVGVQNNAMTITLTK-----QNQWLDSLKFLVKCIEESMRISDEA----------
MFD_STAS1             LGRTMKVGVQEGKMKVTLNK-----TGNWLDSLKFLTKSLEESMVITDEI----------
Q9CJI0_LACLA          TSMKASVGEKYGKMTFRFKIENRN-SVVLLSEIMNFIEELSKIRDSYENK----------
Q8DRQ1_STRR6          TNLKAGIAENKGLMELVFDVQNKK-DYEILEGLLIFGESLLEIKESKEKNSI--------
Q97E98_CLOAB          KSILFKMGDNPVILYNLKDVK----REDMLENLQKFLKYMKSLVETN-------------
A5I7R4_CLOBH          KEVAFKLNEKPAIGYNIKNIK----KEQLLPIIRNFLEHIVNNNQ---------------
D3R0N9_MAGIU          YSGEMNFAAGAKPYIEYRIGALKP--AEAVEKLRKLFMNAEKAFNDQK------------
B8E2E1_DICTD          -------------------------KGDYRKKAQFLLQFLKDISNIK-------------
MFD_ECOLI             QHYRLDGPTRLKFIQDLSERKTRIEWVRQFMRELEENAIA--------------------
MFD_HAEIN             IVYRFDGPFKFKFMKDLSDNKVRLEFVVDLLRTIAA------------------------
Q8EEV8_SHEON          QIYRMDGPNKLKFILSAETAKDRLALVKLLLEQLSQHQSQHRLGDK--------------
Q9HZK3_PSEAE          NRYKFEGATLFRFQVPMERPEERFNTLEALFERLTPQTT---------------------
Q83CG9_COXBU          QRYQLQGDESLRFILSNPTPQSKLETIYELIKNLK-------------------------
Q63T69_BURPS          RHIKLAGQDKLRIETRTPDLAVRVSTVKETLRALGQPQQPRAQAAAR-------------
Q7VZN3_BORPE          RHIKLSGQDKLRVEIKAPQIAARADAVRAVLRALK-------------------------
Q8P7B3_XANCP          KIYTMDGPDKLRIKLPLPEAADRFKAARGLLTALAPR-----------------------
Q5NH30_FRATT          SDFRLTKEHDLIITKVTKTAEQRIEFIENFLKKIVQ------------------------
MFD_RICFE             NQAKIKPDNKLVYIKKLVDKNIIVEVNQLLWKLGGCRLDVIPNTSLRGAKRRGNLIK---
MFD_RICCN             NQAKIKPDNKLVYIKKLVDKNIIVEANQLLWNLSEV------------------------
MFD_RICPR             NQTKIKPNNKLVFIKKLVDKNIITEVNQLLWTLLEI------------------------
MFD_RICTY             NQTKIKPNNKLVFIKKLVDKNIITEANQLLWTLLEI------------------------
MFD_RICBR             ANAKIKPDNKLVFIKKLVGKTIITEANQLLWNLSEI------------------------
Q3YR59_EHRCJ          LIFKIQNNSILMLINN-SSYCTTSFIIHHLGKINALNSR---------------------
Q2GLL6_ANAPZ          GIFTMQGNSVNVLISAVHANNVTRYLIACLRKINSLLTHTPASKETKTD-----------
A9CIN2_AGRFC          SMAKIRPDHSLFLNRDLPTPEKRLTGAAMVMTQLAELARS--------------------
Q89LE3_BRADU          QAAKVRPDMKVVFLQDWETPEDRLAGTTEIMRQLAQLAQAKKAA----------------
Q9A782_CAUVC          LIWKVRPDQKVVIKGEWDTPAQRLDAAEKILTVLAKLAKG--------------------
Q2RTL9_RHORT          ATVKLRPDHKLVYRRDWEVARERIQGLGKLMRTLADIADEERPGR---------------
Q3J2M4_RHOS4          ETARVK-DNKIVLARDWKTEGERIKGAFAIARDLAEKVVKPEKTPAKVARPAG-------
MFD_HELPY             -------EKKESLKAPSKDDNDILETLLKHLRAQISLKRR--------------------
MFD_HELPJ             -------EKKESLKAPSKDDNDILETLLKHLHAQISLKRR--------------------
Q7M928_WOLSU          -------ETKKSFSAKSRDDDDLLAAILEQLQGKSA------------------------
Q0P9G9_CAMJE          -------DEKELIKAKSKDDDDILEAILTHLRKA--------------------------
A0A0H3P9Q7_CAMJJ      -------DEKELIKAKSKDDDDILEAILTHLRKA--------------------------
A7ZE35_CAMC1          -------DEKIRLKSRSKDDDDVLAEILVYLRKDKR------------------------
E0UPP9_SULAO          -------DSKETIKSDSRDDDDIIKATLYYLRNNKPKVL---------------------
I0GL09_CALEA          VAKNVQFGEDYISFEANFPLQDTLKVLHLLSGYEKVK-----------------------
Q8RH90_FUSNN          -NKKIMYSKFTRTIGYNGDIFEFFKLYSS-------------------------------
MFD_BORBU             KHPNLLILNPSYQKSIFLSFKNIEKSEKINYIYKNINLLKTST-----------------
F0S455_DESTD          KSKD---------ATFTPDKKLYMEAENLDKIIEILEEMMKG------------------
E1X1P6_HALMS          LSRPRSFQLTPDFKVIYTHKNELTQSEFLKFSKDLAEKILPC------------------
MFD_SYNY3             QSRFVYSAKK----VVVRGLGVLAPAKQMDNLIDWFGKMQGALPETKMETLVGK------
Q8DKA7_THEEB          QSRFVYSQGK----ITVRGLGTQPVEKQLEQLIDWFSQMKTTVATAP-------------
Q7NEP2_GLOVI          RGRFFFQPGK----VTVRNLGVLPSAQQLENLVQWLDKVQLPSLEMAG------------
Q7VBU2_PROMA          HGRVIYKAGQSFSEVTLRGLGILPLESHLETIIEWLENMSNQLPYIDSSITNIIRDKLT-
Q8F395_LEPIN          GLTLNPKEPN----VLIFQTEKKLEKEKLDTLIFLLSEMLPSKKV---------------
B5YL15_THEYD          KNRGIIKNLK------FYQDGFEVNIEELDGLILFLKRLIAKVEDKK-------------
A6GW35_FLAPJ          FVQKQPQLCKMKEKETKNGLRLLLTFENVKSIKKALELMEMV------------------
Q8AB59_BACTN          YMMKYTRRCDLREQ---NGRRSMLIKDVTNVETAVSVLQEIVALPVKELDDH--------
Q2S6G5_SALRD          KLTLLDREYVMKDD-VEGGLMRAIVQDVNTLDEALQVTESLLLEETKTMATVEA------
Q8KEN4_CHLTE          ALQD-GSIKEYHPQFKHEKKMKLVFRHPETADTAPLALIARYEALLKQIAER--------
O84753_CHLTR          PELLVKEVQESVEKAFPK------------------------------------------
M1WUP8_PSEP2          IERAKLLPPTKLELRYTDSISMREALDKTAVELEELLESETPASVQ--------------
Q72AT7_DESVH          ADRARLQPPATLEWRLDTGLAAGARLDAMRGELFRLVPDSTPSSA---------------
B9KVH0_RHOSK          ---TLEGRRLLR--QEETDEDAARRALDLLRDLG--------------------------
B0UM39_METS4          ---RGDRLILHR--PCADPVACGRLARRFVRALEAAQG----------------------
Q1YKV9_AURMS          AKWSKNRLIFPA--PEDDEADPLAHANELLDRLAAVVPAAEGSDEA--------------
E8TPS0_MESCW          LEYRNGRVIFRRIEPRVSGIDAVRLALDAIRAV-QPKHEV--------------------
C6B9D3_RHILS          AVRRVDRLIFE--ASNMTGEEQLLFFERVVPAANRPKFRNQ-------------------
A4YQE5_BRASO          -----SRLVYKHKIRPDRILTAAIRFLAALKRDASNKQGQPTSRQRSRGRASPVGDSP--
A5EAY9_BRASB          -----DRVVYPGRS-SEPALRRVELFLDLLDE----------------------------
D1B5L3_THEAS          -------------GVVTVGPAGVRGLSELIEALSRWVTV---------------------
Q9RU62_DEIRA          ---KTEVVTFPPSVKIDKRGIKPDEYARMLIEVLGYFG----------------------
Q5SJW3_THET8          ---RVELTQYPPGFRLEKKGLRPRDYPEALMEVLYLFADL--------------------
I0IIW6_PHYMF          LNANLDKPRFRAGVGADELLYTPPPEVEDAGLVEHLTGVLAGGAS---------------
                                                                                  

MFD_MYCBO             PPGEDGRGRNTTIKERQP
MFD_MYCTU             PPGEDGRGRNTTIKERQP
Q8NRS9_CORGL          KP----KKKSSVISVSL-
Q9F2P1_STRCO          ------------------
Q8G5I7_BIFLO          ------------------
Q83N19_TROWT          ------------------
MFD_MYXXA             ------------------
Q74H75_GEOSL          ------------------
Q1IHV1_KORVE          ------------------
Q2RMB9_MOOTA          ------------------
A9WHG9_CHLAA          ------------------
I0IRW8_LEPFC          ------------------
MFD_BACSU             ------------------
Q8YAD0_LISMO          ------------------
Q839B9_ENTFA          ------------------
F9UL13_LACPL          ------------------
MFD_STAEQ             ------------------
MFD_STAES             ------------------
MFD_STAHJ             ------------------
MFD_STAA8             ------------------
MFD_STAS1             ------------------
Q9CJI0_LACLA          ------------------
Q8DRQ1_STRR6          ------------------
Q97E98_CLOAB          ------------------
A5I7R4_CLOBH          ------------------
D3R0N9_MAGIU          ------------------
B8E2E1_DICTD          ------------------
MFD_ECOLI             ------------------
MFD_HAEIN             ------------------
Q8EEV8_SHEON          ------------------
Q9HZK3_PSEAE          ------------------
Q83CG9_COXBU          ------------------
Q63T69_BURPS          ------------------
Q7VZN3_BORPE          ------------------
Q8P7B3_XANCP          ------------------
Q5NH30_FRATT          ------------------
MFD_RICFE             ------------------
MFD_RICCN             ------------------
MFD_RICPR             ------------------
MFD_RICTY             ------------------
MFD_RICBR             ------------------
Q3YR59_EHRCJ          ------------------
Q2GLL6_ANAPZ          ------------------
A9CIN2_AGRFC          ------------------
Q89LE3_BRADU          ------------------
Q9A782_CAUVC          ------------------
Q2RTL9_RHORT          ------------------
Q3J2M4_RHOS4          ------------------
MFD_HELPY             ------------------
MFD_HELPJ             ------------------
Q7M928_WOLSU          ------------------
Q0P9G9_CAMJE          ------------------
A0A0H3P9Q7_CAMJJ      ------------------
A7ZE35_CAMC1          ------------------
E0UPP9_SULAO          ------------------
I0GL09_CALEA          ------------------
Q8RH90_FUSNN          ------------------
MFD_BORBU             ------------------
F0S455_DESTD          ------------------
E1X1P6_HALMS          ------------------
MFD_SYNY3             ------------------
Q8DKA7_THEEB          ------------------
Q7NEP2_GLOVI          ------------------
Q7VBU2_PROMA          ------------------
Q8F395_LEPIN          ------------------
B5YL15_THEYD          ------------------
A6GW35_FLAPJ          ------------------
Q8AB59_BACTN          ------------------
Q2S6G5_SALRD          ------------------
Q8KEN4_CHLTE          ------------------
O84753_CHLTR          ------------------
M1WUP8_PSEP2          ------------------
Q72AT7_DESVH          ------------------
B9KVH0_RHOSK          ------------------
B0UM39_METS4          ------------------
Q1YKV9_AURMS          ------------------
E8TPS0_MESCW          ------------------
C6B9D3_RHILS          ------------------
A4YQE5_BRASO          ------------------
A5EAY9_BRASB          ------------------
D1B5L3_THEAS          ------------------
Q9RU62_DEIRA          ------------------
Q5SJW3_THET8          ------------------
I0IIW6_PHYMF          ------------------