CLUSTAL format seed alignment for MF_00972

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

A5HXS5_CLOBH      ---------------------MNDYIEYAIIEAKKALA-IGEVPVGAIIVKENK--IIAK
Q97MR8_CLOAB      --------------------MKNEFLNEAIKEAKLAKK-EGEVPVGAVIVKDNK--IIAT
TADA_AQUAE        -------------------MGKEYFLKVALREAKRAFE-KGEVPVGAIIVKEGE--IISK
Q8DME2_THEEB      ---------MPEILPLSETDPHDFWMQQAIALAEQAGA-ADEVPVGAVIVSAEN-ELIAT
P73717_SYNY3      ---------MDQPLP-----THEDWMQMAIALAEEAGN-VGEIPVGAVVVNAMG-EVLAT
Q7NLR8_GLOVI      ------------------MKSHSEWMGMALELAREAGR-VGEVPVGALVVDASG-VLLAT
A0R5V6_MYCS2      -------------------MTPESQIRAALEAARTAGP--RDVPIGAVVYAADG-TELAR
L7N4M6_MYCTO      ------------------MTTDEDLIRAALAVAATAGP--RDVPVGAVVVGADG-TELAR
Q8NTS4_CORGL      -----------------------------MDIARQTPE--GDVPVGAVIYAPTG-EILAT
Q8G473_BIFLO      ----------MRKRHTLVGMEYDEAMRRALELAGQAAA-AGDVPVGAVVLDAAG-QIVGR
Q9AK79_STRCO      -------------------------MRLALAEAGRAAA-GGDVPVGAVVLAPDGRTVLSA
D1B9L8_THEAS      ----------------------MSFMREALREAELAME-AGDVPVGAVVVMNGL--VVGR
Q72BV6_DESVH      ---------MGPVPYAPEGWTWERLMDEALAEARLAQA-EGEVPVGAVVVDKAG-RIIGR
Q8KFE6_CHLTE      ---------MSDLNHC---------MELAFREAIKAYE-SKEVPVGAVVLDPNG-LIIGR
TADA_RICCN        -------------------------MEQALKQAKIAFD-KNEVPVGAVVVDRLHQKIIAS
TADA_RICFE        -------------------------MEQALKQAGIAFD-KNEVPVGAVIVDRLNQKIIVS
TADA_RICTY        -------------------------MEQALKQARLAFD-KNEVPVGVVIVYRLNQKIIVS
TADA_RICPR        -------------------------MEQALKQARLAFD-KNEVPVGVVIVCRLNQKIIVS
TADA_RICBR        -------------------------MREALKQAEIAFS-KNEVPVGAVIVDRENQKIISK
Q2RWP1_RHORT      ---------MSATRPPDPALVLADPMGLALDLARAAAA-TGEVPVGAVITDA-GGRPLAA
Q3J463_RHOS4      -------------------MEFRSHMQAALAEARAAGA-RGEVPVGAVVVAP-GGQVVAR
Q89DE3_BRADU      ---------------MIRGLKAPSFMDLALKTAENAGK-AGEVPIGCVVVR--NYEVIAT
TADA_AGRFC        ------------------MAERTHFMELALVEARSAGE-RDEVPIGAVLVL--DGRVIAR
Q9ABJ6_CAUVC      ------------MRTDESEDQDHRMMRLALDAARAAAE-AGETPVGAVILDPSTGEVIAT
Q8P8S0_XANCP      -----MSVSPDHHAQDAHLQIDQQWMTHALRLAERAERDYDEIPVGAVLVDPTG-ALLGE
Q7VXP7_BORPE      -------------------------MALALEQAQEAAR-LGEVPVGAVVVDAQG-EVLGT
Q63T46_BURPS      -------------MLSAAAERDRRYMRLALAAAEEARA-AGEVPVGAVIVRGD--EVIAR
Q9JZR1_NEIMB      ---------<PPVAAFPPQEEMEHFMCEALRQAEQSSA-DGEIPVGAVIVSDG--KIIAS
Q5F851_NEIG1      ---------<PPVAAFPPQEEMGYFMREALRQAEQSAA-DGEIPVGAVIVSDG--KIITS
Q7UIP0_RHOBA      -------------MSLDPLDIDRHWMQRAIEMAQSAAL-EDEVPVGAIIVRSGT--AIAA
TADA_ECOLI        --------------MSEVEFSHEYWMRHALTLAKRAWD-EREVPVGAVLVHNNR--VIGE
TADA_SHIFL        --------------MSEVEFSHEYWMRHALTLAKRAWD-EREVPVGAVLVHNNR--VIGE
TADA_ECO57        --------------MSEVEFSHEYWMRHAMTLAKRAWD-EREVPVGAVLVHNNR--VIGE
TADA_ECOL6        --------------MSEVEFSHEYWMRHAMTLAKRAWD-EREVPVGAVLVHNNR--VIGE
TADA_SALTI        --------------MSDVELDHEYWMRHALTLAKRAWD-EREVPVGAVLVHNHR--VIGE
TADA_SALTY        --------------MSDVELDHEYWMRHALTLAKRAWD-EREVPVGAVLVHNHR--VIGE
TADA_BUCAI        ----------------MKYEKDKNWMKIALKYAYYAKE-KGEIPIGAILVFKER--IIGI
TADA_BUCAP        ----------------MKSNRDSYWMKIALKYAYYAEE-NGEVPIGAILVFQEK--IIGT
TADA_BUCBP        -----------------MHDSDKYFMKCAIFLAKISEM-IGEVPVGAVLVFNNT--IIGK
TADA_HAEIN        -----------MDAAKVRSEFDEKMMRYALELADKAEA-LGEIPVGAVLVDDARN-IIGE
Q5NI97_FRATT      --------------MSNYSDQDIFFMQKAYQQALLAYQ-AGEVPIGAVLVRDDQ--IIVQ
Q2RMH4_MOOTA      -------------------MDHHFYMGEALDEARKAFD-LGEVPIGAVIVAGGE--IIAR
O84851_CHLTR      ----------------MCIEKDLFFMKKALDEARKAYE-QDEVPVGCIIVHGDK--IIAR
TADA_STRP3        --------------MPYSLEEQTYFMQEALKEAEKSLQ-KAEIPIGCVIVKDGE--IIGR
TADA_STRPQ        --------------MPYSLEEQTYFMQEALKEAEKSLQ-KAEIPIGCVIVKDGE--IIGR
TADA_STRP6        --------------MPYSLEEQTYFMQEALKEAEKSLQ-KAEIPIGCVIVKDGE--IIGR
TADA_STRP1        --------------MPYSLEEQTYFMQEALKEAEKSLQ-KAEIPIGCVIVKDGE--IIGR
TADA_STRP8        --------------MPYSLEEQTYFMQEALKEAEKSLQ-KAEIPIGCVIVKDGE--IIGR
TADA_BACSU        ------------------MTQDELYMKEAIKEAKKAEE-KGEVPIGAVLVINGE--IIAR
A6GWB8_FLAPJ      ---------------MENIFTDEYFMRKALQEAYVAFD-KEEIPVGAIVVINNR--IIAK
Q8A5K5_BACTN      ----------------MMTLDDTYFMKQALIEAGKAAE-RGEVPVGAVVVCKER--IIAR
B8E307_DICTD      -------------MDKKFSSIDEYFMHEAIKEAKKALR-KGEVPVGAVIVYNGQ--IVGR
ADAT2_HUMAN       MEAKAAPKPAASGACSVSAEETEKWMEEAMHMAKEALE-NTEVPVGCLMVYNNE--VVGK
ADAT2_MOUSE       MEEKVESTTTPDGPCVVSVQETEKWMEEAMRMAKEALE-NIEVPVGCLMVYNNE--VVGK
ADAT2_BOVIN       MEAKAGPTAATDGAYSVSAEETEKWMEQAMQMAKDALD-NTEVPVGCLMVYNNE--VVGK
ADAT2_XENTR       -----------------MTEEIQNWMHKAFQMAQDALN-NGEVPVGCLMVYDNQ--VVGK
ADAT2_XENLA       ------------MEPLQITEEIQNWMHKAFQMAQDALN-NGEVPVGCLMVYGNQ--VVGK
ADAT2_DANRE       -MQEVGVDPEKNDFLQPSDSEVQTWMAKAFDMAVEALE-NGEVPVGCLMVYNNE--IIGK
                                                  *  :     : *:* ::        :  

A5HXS5_CLOBH      SHNLKESLKDPTAHAEILAIKEACNTIH------NWRLKGCKMYVTLEPCAMCASAIIQS
Q97MR8_CLOAB      SHNLKESLKNPSAHAEIIAIERAAKYLN------NWRLNGCEMYVTLEPCPMCAACICQS
TADA_AQUAE        AHNSVEELKDPTAHAEMLAIKEACRRLN------TKYLEGCELYVTLEPCIMCSYALVLS
Q8DME2_THEEB      GENRRQRDHDPTAHAEIIALRRAGQRLG------TWYLTGCRLYVTLEPCPMCAGAIVQA
P73717_SYNY3      GQNRKQRDQNPIAHAEMLAIQTACRRLG------HWRLNECTLYVTLEPCPMCTGAIIQA
Q7NLR8_GLOVI      GANRRERDYDPTAHAEIVAMRAACAKLR------DWRLTDCTLYVTLEPCAMCAGAILQS
A0R5V6_MYCS2      AVNVREAYGDPAGHAEIVAMRAAAKVLGD-----GWRLEGATLAVTVEPCTMCAGALVLA
L7N4M6_MYCTO      AVNAREALGDPTAHAEILAMRLAAGVLGD-----GWRLEGTTLAVTVEPCTMCAGALVLA
Q8NTS4_CORGL      ATNRREADRDPTAHAEIIALRRAARRFSD-----GWRLSDCTAVVTLEPCSMCAGALVGA
Q8G473_BIFLO      GYNTREADGDPLAHAEIIAMRQAAQALG------AWNLADCTLAVTLEPCPMCAGACIQT
Q9AK79_STRCO      GHNEREATGDPTAHAEVLAIRRAAGELG------EWRLSGCTLVVTLEPCTMCAGALVQS
D1B9L8_THEAS      GRNVRELTGDPLGHAEMVAIRDACSALG------TWRLDGASLYVTLEPCVMCAGAILQC
Q72BV6_DESVH      GHNRCLRDNDPSAHAEMVALRMAATTTA------NYRLGGTFLVVTLEPCLMCAGAIVHA
Q8KFE6_CHLTE      GYNQVETLSDATAHAEMIALTSAMATIG------SKYLEGCTLAVTLEPCPMCAGAIVLS
TADA_RICCN        THNNTEEKNNALYHAEIIAINEACNLIS------SKNLNDYDIYVTLEPCAMCAAAIAHS
TADA_RICFE        SHNNTEEKNNALYHAEIIAINEACNLIS------SKNLNDYDIYVTLEPCAMCAAAIAHS
TADA_RICTY        SHNNIEEKNNALCHAEIIAINEACNLIS------SKNLNDYDIYVTLEPCAMCASAISHS
TADA_RICPR        SHNNIEEKKNPLCHAEIIAINTACNLIS------SKNLNDYDIYVTLEPCAMCASAISHS
TADA_RICBR        SYNNTEEKNNALYHAEIIAINEACRIIS------SKNLSDYDIYVTLEPCAMCAAAIAHS
Q2RWP1_RHORT      CANRTETDHDPTAHAEILAIRAACARRG------DARLPDCTLWVTLEPCPMCASAIVHA
Q3J463_RHOS4      AGNRCRELSDPTAHAEMLAIRAACATLG-------ERLTGCDLYVTLEPCPMCAAAISAA
Q89DE3_BRADU      AANRTLTDYDPTAHAEIVALREAAKKIG------SERLVDCDLYVTLEPCTMCAGAISFA
TADA_AGRFC        SGNRTRELNDVTAHAEIAVIRMACEALG------QERLPGADLYVTLEPCTMCAAAISFA
Q9ABJ6_CAUVC      AGNGPIAAHDPTAHAEIAAMRAAAAKLG------NYRLTDLTLVVTLEPCAMCAGAISHA
Q8P8S0_XANCP      GWNFNIASHDPSAHAEIMAMREGGRRLA------NHRLIGCTLYVTLEPCAMCAMAMIHA
Q7VXP7_BORPE      GYNRTIIDRDPTAHAEIVALRAAARRLD------NYRLPGVSLYVTLEPCVMCIGAMLHA
Q63T46_BURPS      GFNHPIGGHDPSAHAEMAALRAAARALR------NYRMPGCELYVTLEPCLMCSGAIMHA
Q9JZR1_NEIMB      AHNTCIADCNVSRHAEINALAQAGREIQ------NYRLDGCDIYITLEPCAMCASALIQA
Q5F851_NEIG1      AHNTCIADCNVSRHAEINALAQAGSEMQ------NYRLDGCDIYITLEPCAMCASALIQA
Q7UIP0_RHOBA      AANQREALHDPTAHAEMIAITQAAASIE------NWRLEQTTLYVTLEPCLMCAGAILQA
TADA_ECOLI        GWNRPIGRHDPTAHAEIMALRQGGLVMQ------NYRLIDATLYVTLEPCVMCAGAMIHS
TADA_SHIFL        GWNRPIGRHDPTAHAEIMALRQGGLVMQ------NYRLIDATLYVTLEPCVMCAGAMIHS
TADA_ECO57        GWNRPIGRHDPTAHAEIMALRQGGLVMQ------NYRLIDATLYVTLEPCVMCAGAMIHS
TADA_ECOL6        GWNRPIGRHDPTAHAEIMALRQGGLVMQ------NYRLIDATLYVTLEPCVMCAGAMIHS
TADA_SALTI        GWNRPIGRHDPTAHAEIMALRQGGLVLQ------NYRLLDTTLYVTLEPCVMCAGAMVHS
TADA_SALTY        GWNRPIGRHDPTAHAEIMALRQGGLVLQ------NYRLLDTTLYVTLEPCVMCAGAMVHS
TADA_BUCAI        GWNSSISKNDPTAHAEIIALRGAGKKIK------NYRLLNTTLYVTLQPCIMCCGAIIQS
TADA_BUCAP        GWNSVISQNDSTAHAEIIALREAGRNIK------NYRLVNTTLYVTLQPCMMCCGAIINS
TADA_BUCBP        GLNSSILNHDPTAHAEIKALRNGAKFLK------NYRLLHTTLYVTLEPCIMCYGAIIHS
TADA_HAEIN        GWNLSIVQSDPTAHAEIIALRNGAKNIQ------NYRLLNSTLYVTLEPCTMCAGAILHS
Q5NI97_FRATT      NFNQTIGLNDPTAHAEILVLRSAALKLG------NYRLVNTKLYVTLEPCIMCLGGLIQA
Q2RMH4_MOOTA      AGNRRETLADPTAHAEIIALRAAARVRG------DWRLTGATLYVTLEPCPMCAGALVQA
O84851_CHLTR      GHNSVEQLKDPTVHAEMICISAAAEYLE------NWRLKDTILYCTLEPCLMCAGAIQLA
TADA_STRP3        GHNAREESNQAIMHAEMMAINEANAHEG------NWRLLDTTLFVTIEPCVMCSGAIGLA
TADA_STRPQ        GHNAREESNQAIMHAEMMAINEANAHEG------NWRLLDTTLFVTIEPCVMCSGAIGLA
TADA_STRP6        GHNAREESNQAIMHAEMMAINEANAHEG------NWRLLDTTLFVTIEPCVMCSGAIGLA
TADA_STRP1        GHNAREESNQAIMHAEMMAINEANAHEG------NWRLLDTTLFVTIEPCVMCSGAIGLA
TADA_STRP8        GHNAREESNQAIMHAEMMAINEANAHEG------NWRLLDTTLFVTIEPCVMCSGAIGLA
TADA_BACSU        AHNLRETEQRSIAHAEMLVIDEACKALG------TWRLEGATLYVTLEPCPMCAGAVVLS
A6GWB8_FLAPJ      SHNLTELLNDVTAHAEMQAITASANFLG------GKYLTNCILYVTLEPCQMCAGALYWS
Q8A5K5_BACTN      AHNLTETLNDVTAHAEMQAITAAANVLG------GKYLNECTLYVTVEPCVMCAGAIAWA
B8E307_DICTD      GYNLRESKKNPISHAEMIAIEKAAKKLK------GWRLCNCTLYVTLEPCIMCFGAILNS
ADAT2_HUMAN       GRNEVNQTKNATRHAEMVAIDQVLDWCRQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLM
ADAT2_MOUSE       GRNEVNQTKNATRHAEMVAIDQVLDWCHQHGQSPSTVFEHTVLYVTVEPCIMCAAALRLM
ADAT2_BOVIN       GRNEVNQTKNATRHAEMVAIDQALDWCRRRGRSPSEVFEHTVLYVTVEPCIMCAAALRLM
ADAT2_XENTR       GRNEVNETKNATRHAEMVAIDQVLDWCEKNSKKSRDVFENIVLYVTVEPCIMCAGALRLL
ADAT2_XENLA       GRNEVNETKNATQHAEMVAIDQVLDWCEMNSKKSTDVFENIVLYVTVEPCIMCAGALRLL
ADAT2_DANRE       GRNEVNETKNATRHAEMVALDQVLDWCRLREKDCKEVCEQTVLYVTVEPCIMCAAALRLL
                    *          ***:  :                         *::** **       

A5HXS5_CLOBH      RISELHIGTFDPVGGACGSVVNITNN--SYLKNNLNI-KWLYDDECSRIITNFFKNIR--
Q97MR8_CLOAB      RISKVYVGTFDPISGACGSVVNITEN--DYLRYHTEV-EWLYSNECSDILKGFFKARRV-
TADA_AQUAE        RIEKVIFSALDKKHGGVVSVFNILDE--PTLNHRVKW-EYYPLEEASELLSEFFKKLRNN
Q8DME2_THEEB      RIHTLIYGTTDPKSGAIDSVLQLPQS--PAVFHRIQVIRGVQAVACRQQLQRWFRQHR--
P73717_SYNY3      RLGLLVYGTPDPKTGTIDSVFDLAAS--AASNHHLQSLGGVCQEQCREQLQDWFAQHR--
Q7NLR8_GLOVI      RLGLLVYGADDPKAGAVGSVLNLPAS--AVSFHRLPVVAGIEERACRDLLCRWFEEQR--
A0R5V6_MYCS2      RVSRLVFGAWEPKTGAVGSLWDVVRD--RRLNHRPEVIGGVLADECAALLEEFFARQR--
L7N4M6_MYCTO      RVARLVFGAWEPKTGAVGSLWDVVRD--RRLNHRPEVRGGVLARECAAPLEAFFARQR--
Q8NTS4_CORGL      RIGRIVFGAFEPRTGACGSVFDVVRD--PAVLHKVEVSGGILEPECAALMTEFFELHR--
Q8G473_BIFLO      HIGTIAFGAWDPKLGACGSIWDIPRD--PHIGHSPEVHGGVLEGECQSILTDFFAQRR--
Q9AK79_STRCO      RVDRVVYGARDDKAGAAGSLWDVVRD--RRLNHRPEVIEGVLADDCARLLTDFFRDR---
D1B9L8_THEAS      RISEVHFALRDPKAGAVGSLYDVLRD--PRQPFRCRVHQGEMRDRSAALLRGFFEGLR--
Q72BV6_DESVH      RVEGVVYGAEDPKAGAVTSCLEAFEQ--PFLNHRPWHMGGLRRRACTAILKDFFNGRR--
Q8KFE6_CHLTE      KISRVVFGAWDPKMGAAGTVLNITAC--NALNHQPEVYGGIMERKAESLLQDFFRGLR--
TADA_RICCN        RLKRLFYGASDSKHGVVESNLRYFNS--SACFHRPEIYSGILAEDSGLLMKEFFKRIR--
TADA_RICFE        RLKRLFYGASDSKHGAVESNLRYFNS--SVCFYRPEIYSGILAEDSRLLMKEFFKRIR--
TADA_RICTY        RLKRLFYGASDSKQGAVESNLRYFNS--SACFHRPEIYSGILSEHSRFLMKEFFQKMR--
TADA_RICPR        RLKRLFYGASDSKHGAVESNLRYFNS--NSCFYRPEIYSGILSEHSRFLMQEFFQRIR--
TADA_RICBR        RLKRLFYGASDSKHGAVESNLRYFNS--KACFHRPEIYSGIFAEDSALLMKGFFKKIR--
Q2RWP1_RHORT      RLARVIFGAYDPKGGAVDHGVRLFAH--PGCLHRPEVIGGMAESAAATLLRGFFQALR--
Q3J463_RHOS4      RIARLYYGAADPKSGGVAQGARVFAH--PQCHHVPEVYDGIGEAEAAALLRGFFSARR--
Q89DE3_BRADU      RVRRLYYGAADPKGGAVESGVRFFAS--PTCHHAPDVYSGVGESEAARLLKEFFRERR--
TADA_AGRFC        RIRRLYYGAQDPKGGAVESGVRFFSQ--PTCHHAPDVYSGLAESESAEILRQFFREKR--
Q9ABJ6_CAUVC      RIGRVVFGADDPKGGAVVHGPKFFAQ--PTCHWRPEVTGGVLADESADLLRGFFRARR--
Q8P8S0_XANCP      RIARVVFAASDPKTGACGSVFDLLAD--PRHNHRVQVSGGVLAAEAGLRLTNYFRAKR--
Q7VXP7_BORPE      RLARVVYGARDPKTGACGSVLDVGAV--GQLNHHTTITGGVLAEPCGELLRGFFRARR--
Q63T46_BURPS      RIARVVFGAPDPKTGACGSVVDAFAD--ARLNHHTTVEGGVLADECGAVLKSFFAQRRQA
Q9JZR1_NEIMB      RIRRVIYGAAEPKTGAAGSIVNLFAD--KRLNTHTAIRGGILQEECRAVLSRFFQNKR--
Q5F851_NEIG1      RIRRVIYGAAEPKTGAAGSIVNLFAD--KRLNTHTAIRGGILQEECRAVLSRFFQNKR--
Q7UIP0_RHOBA      RVPRVVFGASDPKAGAVTSLYEVLTD--SRLNHRCEITHGVMAEQCGHLLTEFFSAKR--
TADA_ECOLI        RIGRVVFGARDAKTGAAGSLMDVLHH--PGMNHRVEITEGILADECAALLSDFFRMRRQE
TADA_SHIFL        RIGRVVFGARDAKTGAAGSLMDVLHH--PGMNHRVEITEGILADECAALLSDFFRMRRQE
TADA_ECO57        RIGRVVFGARDAKTGAAGSLMDVLHH--PGMNHRVEITEGILADECAALLSDFFRMRRQE
TADA_ECOL6        RIGRVVFGARDAKTGAAGSLMDVLHH--PGMNHRVEITEGILADECAALLSDFFRMRRQE
TADA_SALTI        RIGRVVFGARDAKTGAAGSLIDVLHH--PGMNHRVEIIEGVLRDECATLLSDFFRMRRQE
TADA_SALTY        RIGRVVFGARDAKTGAAGSLIDVLHH--PGMNHRVEIIEGVLRDECATLLSDFFRMRRQE
TADA_BUCAI        RIKRLVFGANCNSSDHRFSLKNLFCD--PQKDYKLDIKKNVMQRECSDILINFFQKKR--
TADA_BUCAP        RIKRLVFGASYKDLKKNPFLKKIFIN--LEK-NKLKIKKHIMRNECAKILSNFFKNKR--
TADA_BUCBP        RISRLVFGAKYKNLQKYICCKNHFFI--NKNFRKISITQEVLESECSNLLSSFFKRKR--
TADA_HAEIN        RIKRLVFGASDYKTGAIGSRFHFFDD--YKMNHTLEVTSGVLAEECSQKLSTFFQKRREE
Q5NI97_FRATT      RVPELVYACDDSRVGAF-SREKLHHN--KNINHNLGVTAGVMADECSKLLKDFFKQRRN-
Q2RMH4_MOOTA      RIRQLVYGAPDLRSGAVDSVVNLVEN--PHFDHQVEVIPGIREEECRELIKKFFQMRR--
O84851_CHLTR      RIPRIVWGAPDLRLGAGGSWLNVFLE--KHPFHQVECCSGVCYQESEQLMKNFFLEKRKA
TADA_STRP3        RIPHVIYGASNQKFGGADSLYQILTD--ERLNHRVQVERGLLAADCANIMQTFFRQGRER
TADA_STRPQ        RIPHVIYGASNQKFGGADSLYQILTD--ERLNHRVQVERGLLAADCANIMQTFFRQGRER
TADA_STRP6        RIPHVIYGASNQKFGGADSLYQILTD--ERLNHRVQVERGLLAADCANIMQTFFRQGRER
TADA_STRP1        RIPHVIYGASNQKFGGVDSLYQILTD--ERLNHRVQVERGLLAADCANIMQTFFRQGRER
TADA_STRP8        RIPHVIYGASNQKFGGADSLYQILTD--ERLNHRVQVERGLLAADCANIMQTFFRQGRER
TADA_BACSU        RVEKVVFGAFDPKGGCSGTLMNLLQE--ERFNHQAEVVSGVLEEECGGMLSAFFRELRKK
A6GWB8_FLAPJ      QISKIVFGASDPQRGFTKMGTQ--------LHPKTIVVNGILESECGELMKEFFRKKR--
Q8A5K5_BACTN      QTGKLVFGAEDDKRGYQRYAAQA-------LHPKTVVVKGILADECATLMKDFFASKRR-
B8E307_DICTD      RISRLVYGTENREEGFT--QFVNIRD--YKKWKDIEIISGIKKDVCESLLKEFFKDMR--
ADAT2_HUMAN       KIPLVVYGCQNERFGGCGSVLNIASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPN
ADAT2_MOUSE       KIPLVVYGCQNERFGGCGSVLNIASADLPNTGRPFQCIPGYRAEEAVELLKTFYKQENPN
ADAT2_BOVIN       RIPLVVYGCQNERFGGCGSVLDIASADLPSTGKPFQCTPGYRAEEAVEMLKTFYKQENPN
ADAT2_XENTR       KIPLVVYGCRNERFGGCGSVLNVAGDNIPDTGTEFKYIGGYQAEKAVELLKTFYKQENPN
ADAT2_XENLA       KIPLVVYGCRNERFGGCGSVLNVSGDDIPDTGTKFKCIGGYQAEKAIELLKTFYKQENPN
ADAT2_DANRE       RIPFVVYGCKNERFGGCGSVLDVSSDHLPHTGTSFKCIAGYRAEEAVEMLKTFYKQENPN
                  :   :  .                                     .   :  ::      

A5HXS5_CLOBH      --------------------------------------
Q97MR8_CLOAB      --------------------------------------
TADA_AQUAE        II------------------------------------
Q8DME2_THEEB      -------QKERQ--------------------------
P73717_SYNY3      -------ARKKQQSLVS---------------------
Q7NLR8_GLOVI      --------------------------------------
A0R5V6_MYCS2      --------------------------------------
L7N4M6_MYCTO      -------LG-----------------------------
Q8NTS4_CORGL      --------------------------------------
Q8G473_BIFLO      --------------------------------------
Q9AK79_STRCO      --------------------------------------
D1B9L8_THEAS      -------GAGQAVGV-----------------------
Q72BV6_DESVH      -------TD-----------------------------
Q8KFE6_CHLTE      -------GR-----------------------------
TADA_RICCN        -------TVISSHRMT----------------------
TADA_RICFE        --------------------------------------
TADA_RICTY        -------STID---------------------------
TADA_RICPR        -------SAID---------------------------
TADA_RICBR        -------D------------------------------
Q2RWP1_RHORT      --------------------------------------
Q3J463_RHOS4      -------PG-----------------------------
Q89DE3_BRADU      --------------------------------------
TADA_AGRFC        -------LDD----------------------------
Q9ABJ6_CAUVC      -------KAKI---------------------------
Q8P8S0_XANCP      -------GKPPLVP------------------------
Q7VXP7_BORPE      -------AKESPV-------------------------
Q63T46_BURPS      VREARRAQQAPGAPPRDE--------------------
Q9JZR1_NEIMB      --------KG----------------------------
Q5F851_NEIG1      --------KG----------------------------
Q7UIP0_RHOBA      -------ALGKK--------------------------
TADA_ECOLI        IKAQKKAQSSTD--------------------------
TADA_SHIFL        IKAQKKAQSSTD--------------------------
TADA_ECO57        IKAQKKAQSSTD--------------------------
TADA_ECOL6        IKAQKKAQSSTD--------------------------
TADA_SALTI        IKALKKADRAEGAGPAV---------------------
TADA_SALTY        IKALKKADRAEGAGPAV---------------------
TADA_BUCAI        -KNKIHICKKI---------------------------
TADA_BUCAP        -F------------------------------------
TADA_BUCBP        -KIATKYFNNNII-------------------------
TADA_HAEIN        KKIEKALLKSLSDK------------------------
Q5NI97_FRATT      --------------------------------------
Q2RMH4_MOOTA      --DG----------------------------------
O84851_CHLTR      KDEGRNSRAT----------------------------
TADA_STRP3        KKIAKHLIKEQSDPFD----------------------
TADA_STRPQ        KKIAKHLIKEQSDPFD----------------------
TADA_STRP6        KKIAKHLIKEQSDPFD----------------------
TADA_STRP1        KKIAKHLIKEQSDPFD----------------------
TADA_STRP8        KKNS----------------------------------
TADA_BACSU        KKAARKNLSE----------------------------
A6GWB8_FLAPJ      --------------------------------------
Q8A5K5_BACTN      --------------------------------------
B8E307_DICTD      -------SSRS---------------------------
ADAT2_HUMAN       APKSKVRKKECQKS------------------------
ADAT2_MOUSE       APKSKVRKKDCQKS------------------------
ADAT2_BOVIN       APKSKVRKKECHKS------------------------
ADAT2_XENTR       APRSKVRKKE----------------------------
ADAT2_XENLA       APKSKVRKKE----------------------------
ADAT2_DANRE       APKPKVRKDSINPQDGAAVIQVMRGPPDEETETIAHLS