CLUSTAL format seed alignment for MF_00974

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DNAG_HELPY        ------MILKSSIDRLLQTI--DIVEVISSYVNLRKSGSS-YMACCPFHEERSASFSVNQ
DNAG_HELPJ        ------MILKSSIDRLLQTI--DIVEVISSYVDLRKSGSN-YMACCPFHEERSASFSVNQ
DNAG_CAMJE        ------MITKESIENLSQRL--NIVDIIENYIEVKKQGSS-FVCICPFHADKNPSMHINP
DNAG_CHLMU        -----MYYTEESLETLKHSI--DIVSVLGEYVHLKRSGAD-YKACCPFHDEKTPSFIVYP
DNAG_CHLTR        -----MYYTEESLETLKHSI--DIVSVLGEYVHLKRSGAD-YKACCPFHDEKTPSFIVYP
DNAG_CHLPN        ------MYTEESLDNLRHSI--DIVDVLSEHIHLKRSGAT-YKACCPFHTEKTPSFIVNP
DNAG_ECOLI        ---MAGRIPRVFINDLLART--DIVDLIDARVKLKKQGKN-FHACCPFHNEKTPSFTVNG
DNAG_ECO57        ---MAGRIPRVFINDLLART--DIVDLIDARVKLKKQGKN-FHACCPFHNEKTPSFTVNG
DNAG_SHIFL        ---MAGRIPRVFINDLLART--DIVDLIDARVKLKKQGKN-FHACCPFHNEKTPSFTVNG
DNAG_ECOL6        ---MAGRIPRVFINDLLART--DIVDLIDARVKLKKQGKN-FHACCPFHNEKTPSFTVNG
DNAG_SALTY        ---MAGRIPRVFINDLLART--DIVDLIDVRVKLKKQGKN-YHACCPFHNEKTPSFTVNG
DNAG_HAEIN        ---MKGSIPRPFIDDLLTKS--DIVDVINTRVKLKKAGRD-YQACCPFHHEKTPSFTVSQ
DNAG_PASMU        ---MKGSIPRTFIDDLLAKT--DIVELVNSRVKLKKAGRD-YQACCPFHHEKTPSFTVSQ
DNAG_BUCAI        ---MSGKIPKYFITELLSRT--NIIELINTRLELKKYGKN-YQTNCPFHHDKTPSFTVSN
DNAG_BUCAP        ---MSGKIPKYFINELLFRT--NIVELIETRIKLKKNGKN-YQTHCPFHNDKTPSFTVSY
DNAG_BUCBP        ---MPSLIPKEFINELIFKT--NIIDIINTRLPLKKVGKN-YNTHCPFHQEKTPSFTVNF
DNAG_LEGPN        ---MSGLIPQPFIDDLLNRT--DLVELIDGYVPLKKRGNS-HIACCPFHNEKTPSFNVVA
DNAG_NEIMA        ------MIPSDFIDELLAKT--DIVDIIDEQVPLKKGGAN-YMACCPFHKEKTPSFSVSP
DNAG_NEIMB        ------MIPSDFIDELLAKT--DIVDIIDEQVPLKKGGAN-YMACCPFHKEKTPSFSVSP
DNAG_PSEPK        ---MAGLIPQSFIDDLINRL--DIVDVVSSRVQLKKTGKN-YSACCPFHKEKTPSFTVSP
DNAG_PSEPU        ---MAGLIPQSFIDDLINRL--DIVDVVSSRVQLKKTGKN-YSACCPFHKEKTPSFTVSP
DNAG_PSEAE        ---MAGLIPQSFIDDLLNRT--DIVEVVSSRIQLKKTGKN-YSACCPFHKEKTPSFTVSP
A4JW69_BURVG      -MAKYIRFSDEFLERIRGET--DLPALIERDVKLKRAGQD-FVACCPFHEEKTPSFRVSA
DNAG_MYXXA        ---MGVVIPEHKIQEVLERV--DLVGLISRHVDLKKAGRE-WKACCPFHQEKTPSFYVVP
Q2IEJ9_ANADE      ------MIPGAVIEELRARI--DPVEVIGRRLELRKTGSS-FSASCPFHADKTPSFRVYP
DNAG_SYNE7        --MDTPRLHPETIAAVKERA--DIVDIVSEQVVLKKRGKD-FVGLCPFHDDKSPSFTVSP
DNAG_SYNY3        --MDNLRLHPDTIQEIKQRI--DIVEIIGDYVVLKKRGRD-HLGLCPFHDEKSPSFSVSP
DNAG_MYCTU        ---MSGRISDRDIAAIREGA--RIEDVVGDYVQLRRAGADSLKGLCPFHNEKSPSFHVRP
DNAG_MYCBO        ---MSGRISDRDIAAIREGA--RIEDVVGDYVQLRRAGADSLKGLCPFHNEKSPSFHVRP
DNAG_MYCLE        ---MVGRIPDRDIAAIRERV--CIEEVVGDYVQLRRAGADSLKGLCPFHNEKSPSFHVRP
DNAG_MYCS2        MPVAGGRIPDRDIAAIREKV--RIEDVVGDYVQLRRAGADSLKGLCPFHDEKTPSFHVRP
DNAG_STRCO        ---MAGRINDEDVKAVRDAV--PIDAVVSEYLQLRNAGGGNLKGLCPFHDEKSPSFQVSP
DNAG_GEOSE        ---MGHRIPEETIEAIRRGV--DIVDVIGEYVQLKRQGRN-YFGLCPFHGEKTPSFSVSP
DNAG_BACSU        ---MGNRIPDEIVDQVQKSA--DIVEVIGDYVQLKKQGRN-YFGLCPFHGESTPSFSVSP
DNAG_BACHD        ---MNQRIPQETIEEIRRSV--DILDVIGEYVQLKKQGRN-YIGLCPFHGENTPSFSVSP
DNAG_LISIN        ----MARIPEEVIDQVRNQA--DIVDIIGNYVQLKKQGRN-YSGLCPFHGEKTPSFSVSP
DNAG_LISMO        ----MARIPEEVIDQVRNQA--DIVDIIGNYVQLKKQGRN-YSGLCPFHGEKTPSFSVSP
DNAG_ENTFA        ---MAQRIPQEVIEEVRHRT--NIVDIIGQYVQLKKSGKN-YMGLCPFHEERSPSFSVAE
DNAG_STAAM        -----MRIDQSIINEIKDKT--DILDLVSEYVKLEKRGRN-YIGLCPFHDEKTPSFTVSE
DNAG_STAAN        -----MRIDQSIINEIKDKT--DILDLVSEYVKLEKRGRN-YIGLCPFHDEKTPSFTVSE
DNAG_STAAU        -----MRIDQSIINEIKDKT--DILDLVSEYVKLEKRGRN-YIGLCPFHDEKTPSFTVSE
DNAG_STAAS        -----MRIDQSIINEIKDKT--DILDLVSEYVKLEKRGRN-YIGLCPFHDEKTPSFTVSE
DNAG_STAAW        -----MRIDQSIINEIKDKT--DILDLVSEYVKLEKRGRN-YIGLCPFHDEKTPSFTVSE
DNAG_STAAC        -----MRIDQSIINEIKDKT--DILDLVSEYVKLEKRGRN-YIGLCPFHDEKTPSFTVSE
DNAG_STAAR        -----MRIDQSIINEIKDKT--DILDLVSEYVKLEKRGRN-YIGLCPFHDEKTPSFTVSE
DNAG_STAES        -----MRIDQSVIDEIKNKT--DILDLVSEYVKLEKRGRN-YIGLCPFHDEKTPSFTVSE
DNAG_STAEQ        -----MRIDQSVIDEIKNKT--DILDLVSEYVKLEKRGRN-YIGLCPFHDEKTPSFTVSE
DNAG_RICCN        -----MRVAPEFYEFLRNRI--NISDVVRQKVALTRKSGN-YVGLCPFHQEKTPSFTVSN
DNAG_RICFE        -----MRVAPEFYELLRNRI--NISDVVRQKVALTRKSGN-YVGLCPFHQEKTPSFTVSD
DNAG_RICPR        -----MRVTQEFYEFLRNRI--NISDVVRQKLALTRKSSN-YVGLCPFHQEKTPSFTVSD
DNAG_RICTY        -----MRVTQEFYELLRNRI--NISDVVRQKLALTRKSSN-YVGLCPFHQEKTPSFTVSD
DNAG_RICBR        -----MKLAPEFYEVLRNRI--NISDVVRQKVVLTRKSGN-YVGLCPFHQEKTPSFTVSD
DNAG_MYCGE        -----MVNKSNSLDELLKQI--KITEIIQHYGVKIQTKGNSLLALCPFHDDKNPSMSISS
DNAG_MYCPN        ------MTSPTSLDQLKQQI--KIAPIVEHYAIKLKKKGKDFVALCPFHADQNPSMTVSV
DNAG_AQUAE        --------MSSDIDELRREI--DIVDVISEYLNLEKVGSN-YRTNCPFHPDDTPSFYVSP
DNAG_DEIRA        --------------------------MVGEYVRLTPAGKGRLKGLCPFHKEKTPSFQVDT
DNAG_LACLA        ----MVSLDTEVVNDLKSKV--NIADLISQYVALSRTGKN-YIGLCPFHGEKTPSFNVNA
DNAG_THEMA        ------MIPREVIEEIKEKV--DIVEVISEYVNLTRVGSS-YRALCPFHSETNPSFYVHP
DNAG_CLOAB        --MECLIIAEDIIQKVKDLN--DIVDIVSEKVKLKRTGRN-YSGLCPFHHEKTPSFSVSQ
A0R7W2_PELPD      -----MRIPDDIKKEILDRAGQNIVQLIGEVIPLTKAGTT-YKACCPFHNEKTPSFTVNP
DNAG_BORBU        ------MKYLQTVASMKSKF--DIVAIVEQYIKLVKSGSA-YKGLCPFHAEKTPSFFVNP
DNAG_TREPA        ----MARISAHVIDAIADRV--DLVSLVGNYTHLERRGDD-WWGRCPFHHERTPSFHVVP
M3MLR4_HELPX      -------MKITNLEPLKERI--QIVEVLERYMDLYKAGAN-FKACCPFHEERSASFIISP
E0TIT3_ZINIC      -------MFKKYIKLINKKY--NILNIIKKYVFLKKIGNN-YFGLCPFHKEKTPSFCVNL
B3QZV5_PHYMT      -MGTDKLKFKEFINKINTEV--PIYDLVQENNVILKKVGKNFMGLCPFHSEKNASFSVSP
A6LBI6_PARD8      ------MITHDTLLRVRETA--RIDEVAAGYLTLRRSGKG-LVALCPFHDERHPSFRISP
E1X3Y2_HALMS      ------MSLKDLKERIVNEI--PISAIVGNYITVTKKGNT-ALSICPFHDDHKPSMNVTD
DNAG_MYCPU        -----MNNLWEIEKKILEKT--TLSNLIGKLISIKPKGKS-FWALCPFHDDKNASLSISD
DNAG_UREPA        ----MSKITNNVFLTIRNAI--NISDVIQNYIKVIKKGNN-YWAICPFHNDTNESLSIND
H6N6X3_MYCHN      -------------MDIKSPSSFSILKVIQNYIKTSQRGAN-YWSVCPFHQDKSPSLSISP
I7CGI8_MYCHA      -----------MSQERFSRPKYSVKKVIESYLSLEKRGRN-FWALCPFHDDNKASLSVSE
                                            :                  **** :   *: :  

DNAG_HELPY        IKGFYHCFG-CGASGDSIKFVMAFEKLSFVEALEKLAHRFNIVLEYDKG----------V
DNAG_HELPJ        VKGFYYCFG-CGASGDSIKFVMAFEKLSFVEALEKLAHRFNIALEYDKG----------V
DNAG_CAMJE        IKGFYHCFA-CKAGGDAFKFVMDYEKLSFADAVEKVASLSNFTLSYTKE----------K
DNAG_CHLMU        TRGHYHCYG-CGEHGDAINFLMKQQGYSFSEAVLFLAKKFHVDLVIKTKT----K-ESSG
DNAG_CHLTR        TRGHYHCYG-CGEHGDAINFLMKQQGYSFSEAVLFLAKKFHVDLVVRTK-------ETSG
DNAG_CHLPN        AGAHYHCFG-CGAHGDAIGFLMQHLGYSFTEAILVLSKKFQVDLVLQPKD----SGYTPP
DNAG_ECOLI        EKQFYHCFG-CGAHGNAIDFLMNYDKLEFVETVEELAAMHNLEVPFEAG---SGPSQIER
DNAG_ECO57        EKQFYHCFG-CGAHGNAIDFLMNYDKLEFVETVEELAAMHNLEVPFEAG---SGPSQIER
DNAG_SHIFL        EKQFYHCFG-CGAHGNAIDFLMNYDKLEFVETVEELAAMHNLEVPFEAG---SGPSQIER
DNAG_ECOL6        EKQFYHCFG-CGAHGNAIDFLMNYDKLEFVETVEELAAMHNLEVPFEAG---SGPSQIER
DNAG_SALTY        EKQFYHCFG-CGAHGNAIDFLMNYDKLEFVETVEELAAMHNLEIPYEAG---TGLSQIER
DNAG_HAEIN        KKQFYHCFG-CGAHGNAISFLMDYDKLEFIEAIEELAAMAGLEIPYEKRVNHSGKPQANY
DNAG_PASMU        KKQFYHCFG-CGAHGNAISFLMEYDKLEFVEAIEELAGMLGLEIPRENKPHFHGK-QINL
DNAG_BUCAI        EKQFYYCFG-CNAHGNAIDFLIQYEHLSFIESIEELALIHGVKIPFEN-----TVQNSIY
DNAG_BUCAP        EKQFYYCFG-CSAHGNAIDFLINYDNLNFVESIEELATIHSIEIPFDKK---GTIEKKIY
DNAG_BUCBP        EKQFYFCFG-CNTHGNIIDFLMNYEQLTFVESIKELAKIHGLTIPCKNI---NKEKLFNY
DNAG_LEGPN        KKQFYHCFG-CGASGNAISFVMNYLNQGFTDAVETLRRAW-VKCPRDGT-------GEKH
DNAG_NEIMA        TKQFYHCFS-CGAHGSAIGFVMEHQGLSFPEAVQFLADRVGMVVPKVHGQNDNPEVRAER
DNAG_NEIMB        TKQFYHCFS-CGAHGSAIGFVMEHQGLSFPEAVQFLADRVGMVVPKVHGQNDNPEVRAER
DNAG_PSEPK        DKQFYYCFG-CGAGGNALGFVMDHDNLDFPQAVEELARAAGMEVPREQ-GRRDQ---KPR
DNAG_PSEPU        DKQFYYCFG-CGAGGNALGFVMDHDNLDFPQAVEELARAAGMEVPREQ-GRRDQ---KPR
DNAG_PSEAE        DKQFYYCFG-CGAGGNALGFVMDHDQLEFPQAVEELAKRAGMDVPREERGGRGH---TPR
A4JW69_BURVG      DKNTYRCWG-CGARGDAIEWMRNKHHLSFQDAVVHLAGVSGIPLPVEER---DSDEDKAQ
DNAG_MYXXA        EKRFYFCHG-CRASGDAVSFVQRYLGKTFLDAVRDLARELGVDLEAE----QDPSMRERQ
Q2IEJ9_ANADE      DSRRFKCFG-CGARGDAFEFLQRFEGKDFKTVVRELAAEAGVAVEDGAR--RGVAAPTTG
DNAG_SYNE7        AKQFYYCFS-CGAGGNPIKFLMELGKQSFSEVVLDLAKRYQVPVRTLEV--QQHQELQRQ
DNAG_SYNY3        AKQMYYCFG-CGAGGNAFNFLMELGKRSFTDVALDLARRYQIQIQTLEP--AQKQELQRQ
DNAG_MYCTU        NHGHFHCFG-CGEGGDVYAFIQKIEHVSFVEAVELLADRIGHTISYTGA---ATS-VQRD
DNAG_MYCBO        NHGHFHCFG-CGEGGDVYAFIQKIEHVSFVEAVELLADRIGHTISYTGA---ATS-VQRD
DNAG_MYCLE        NHGHFHCFG-CSEGGDVYAFIQKIEHVSFVEAVEMLADRIGHTINYFGT---ATS-VQRD
DNAG_MYCS2        NHGHFHCFG-CGEGGDVYAFIQKIEHVSFVEAVELLADKVGYTVTYTGS---STTNVQRD
DNAG_STRCO        SKGFFHCFG-CQEGGDTITFVMKIDHLTFSEAVERLAGQAGITLRYEEG---GYN-PSHQ
DNAG_GEOSE        EKQIFHCFG-CGAGGNAFTFLMDIEGIPFVEAAKRLAAKAGVDLSVYELDVRGRDD--GQ
DNAG_BACSU        DKQIFHCFG-CGAGGNVFSFLRQMEGYSFAESVSHLADKYQIDFP-DDITVHSGAR--PE
DNAG_BACHD        DKQLYHCFG-CGAGGNAFTFLEQIEGFTFVEAVETLAKRANVVLP----ERVSPSV--KQ
DNAG_LISIN        EKQIFHCFG-CGKGGNVFSFLMEHDGLTFVESVKKVADMSHLDVDIELPEERDTSNLPKE
DNAG_LISMO        EKQIFHCFG-CGKGGNVFSFLMEHDGLTFVESVKKVADMSHLDVAIELPEERDTSNLPKE
DNAG_ENTFA        DKQIFHCFG-CGKGGTVFNFLQEIEGISFPESVKRVADLEHLSVDFDWSEPREVAD-TPE
DNAG_STAAM        DKQICHCFG-CKKGGNVFQFTQEIKDISFVEAVKELGDRVNVAVDIEATQSNSNVQ---I
DNAG_STAAN        DKQICHCFG-CKKGGNVFQFTQEIKDISFVEAVKELGDRVNVAVDIEATQSNSNVQ---I
DNAG_STAAU        DKQICHCFG-CKKGGNVFQFTQEIKDISFVEAVKELGDRVNVAVDIEATQSNSNVQ---I
DNAG_STAAS        DKQICHCFG-CKKGGNVFQFTQEIKDISFVEAVKELGDRVNVAVDIEATQFNSNIQ---I
DNAG_STAAW        DKQICHCFG-CKKGGNVFQFTQEIKDISFVEAVKELGDRVNVAVDIEATQFNSNVQ---I
DNAG_STAAC        DKQICHCFG-CKKGGNVFQFTQEIKDISFVEAVKELGDRVNVAVDIEATQSNSNVQ---I
DNAG_STAAR        DKQICHCFG-CKKGGNVFQFTQEIKDISFVEAVKELGDRVNVAVDIEATQSNSNVQ---I
DNAG_STAES        DKQICHCFG-CKKGGNVFQFTQEIKDVSFVEAVKDLGERVNIQVDIGQNQTNSSTK---I
DNAG_STAEQ        DKQICHCFG-CKKGGNVFQFTQEIKDVSFVEAVKDLGERVNIQVDIGQNQTNSSTK---I
DNAG_RICCN        SKRFFYCFG-CKAAGDVIKFTSNISGLSYNESAIKLAIDYGIEIPKLTA------KQKEF
DNAG_RICFE        SKRFFYCFG-CKAAGDVIKFTSNISGLSYNESAIKLATDYGIEIPKLTA------KQKEF
DNAG_RICPR        SKRFFYCFG-CKASGDVIKFTSNISGLSYNESAIKLANDYGIEIPKLTV------KQKEF
DNAG_RICTY        SKRFFYCFG-CKASGDVIKFTSNISGLSYNESAIKLANDYGIEIPKLTV------KQKEF
DNAG_RICBR        SKRFFYCFG-CKAAGDVIKFTSNISGLSYNDSAIKLATDYGVEIPKLTQ------KQKEF
DNAG_MYCGE        SKNIFKCWA-CNAAGNGIAFIQKHDQLDWKTALKKAIEICGIKLENWNS-----NLLTKV
DNAG_MYCPN        AKNIFKCFS-CQVGGDGIAFIQKIDQVDWKTALNKALSILNLDSQYAVN-----FYLKEV
DNAG_AQUAE        SKQIFKCFG-CGVGGDAIKFVSLYEDISYFEAALELAKRYGKKLDLEKIS----------
DNAG_DEIRA        EKGYYHCFG-CKASGDVFGFVQQMEHLSFGDALRKLADRAGIQIDAKYG-----------
DNAG_LACLA        EKGFYHCFG-CGRSGDAIEFLKEYNQVGFVDAVKELADFAGVTLNISDD-------REEK
DNAG_THEMA        GLKIYHCFG-CGASGDVIKFLQEMEGISFQEALERLAKRAGIDLSLYRT---------EG
DNAG_CLOAB        DKQIYKCFG-CGEAGNVITFVMKTKNFSFVEAVKYLADKVNITIDDNKD-----KYYAKN
A0R7W2_PELPD      SRGTWHCFGQCNDGGDVAKFFMLRDGIKFPDALALLARRVGITIPQGETK---------E
DNAG_BORBU        LQGYFYCFG-CKKGGDVIGFLMDMEKINYNDALKILCEKSGIHYDDLKIS-RGSENKNEN
DNAG_TREPA        DKKMYYCFG-CGVGGSTIKFFMEIEKIDFHEAAVRLAKRAGIEMSFEDG----VHAPSAH
M3MLR4_HELPX      EKNIYHCFG-CGVSGDALKFLQEYQKISFIEAVEEIAKIYHYPLEYETN---------AK
E0TIT3_ZINIC      FKKYFYCFG-CNFGGDMISFLMKYKKEKFINIINILLKKNIFFKKNSDE-----------
B3QZV5_PHYMT      EKNIAVCMS-CKKGGRPISFYKEIKKVSFQYAVSELAQRLNIVDLSKKIF---------L
A6LBI6_PARD8      ALNIGKCFS-CGEAADPIRLVRHMEGCGFEEAVRLLARKYGIEVEEERG-----TEEAGR
E1X3Y2_HALMS      SRGRYKCFA-CEAGGNAIDFVINYKNLDFIEALKEICSNHGINFDDYNK--------QKA
DNAG_MYCPU        QKAMFSCFS-CNVRGGLFVFYSKFLNKSYVEVANMLAKEFDLDFHFDQQ------EKEKY
DNAG_UREPA        KKQIFKCFA-CNHAGDVIKFVAEYKKISYALAAQEIVQLMNLDLNLLNHL----QKISPQ
H6N6X3_MYCHN      EKNIFKCFS-CGVSGDAVAFVMKIEKCNYVQSIYKISEILGLDPNQYLT---------AK
I7CGI8_MYCHA      EKNIFKCFS-CGVSGDAISFVMRKESLPFPEALLKIHQLLNLPLEGIRGL----EAKASE
                        * . *   .             :                               

DNAG_HELPY        YYDHKEDYHLLEMVSSLYQEELF---NAPFFLNYLQKRG-LSLESIKAFKLGLCTNRID-
DNAG_HELPJ        YYDHKEDYHLLEMVSSLYQEELF---NAPFFLNYLQKRG-LSMESIKAFKLGLCTNKID-
DNAG_CAMJE        QENKKELKSILPSLNAYFKDNLK---HHKEVLTYLYQRA-LNDKDIAKFELGFAGASEDS
DNAG_CHLMU        QDSKECLRRINKEAERFFQYCLLCLPEGGEALSYLYKRG-FSLDTIDRFQIGYAPE-QRV
DNAG_CHLTR        QDSKDSLRRINREAERFFQYCLLHLPEGEEALAYLYKRG-FSPDTIDRFQIGYAPE-QRL
DNAG_CHLPN        QGLKEELRHINSEAETFFRYCLYHLPEARHALQYLYHRG-FSPDTIDRFHLGYGPE-QSL
DNAG_ECOLI        HQR-QTLYQLMDGLNTFYQQSLQ-QPVATSARQYLEKRG-LSHEVIARFAIGFAPPGWDN
DNAG_ECO57        HQR-QTLYQLMDGLNTFYQQSLQ-QPVATSARQYLEKRG-LSHEVIARFAIGFAPPGWDN
DNAG_SHIFL        HQR-QTLYQLMDGLNTFYQQSLQ-QPVATSARQYLEKRG-LSHEVIARFAIGFAPPGWDN
DNAG_ECOL6        HQR-QTLYQLMDGLNTFYQQSLQ-QPVATSARQYLEKRG-LSHEVIARFAIGFAPPGWDN
DNAG_SALTY        HQR-QNLYQLMNGLNDFYQQSLT-HPAAKPARDYLQKRG-LSAEIIQRFAIGFAPPGWDN
DNAG_HAEIN        QTK-RNLYELMQEIATFYQNQL---PLNTQAQEYLQQRG-LSPEIIERFQIGFVPNAMDT
DNAG_PASMU        QTK-RNLYELMQEIAQFYQQQL---AQHIPAQSYLQQRG-LSPEVISRFQIGFVPNSFDA
DNAG_BUCAI        VKK-QKLYLLMEKICKLYKKNI---NVTHLANKYLARRG-INQNMIDFFLIGFSSLKWNE
DNAG_BUCAP        LKK-QKLYFLMDKMSKLYQKNI---IFTNSANKYLTERG-INKNMIDFFCIGFSSNKWDL
DNAG_BUCBP        EKI-TNLYLLTKNIADLYHRNI---FKTEYAYQYILNRG-IDKSMIKYFNLGFSPKNWYD
DNAG_LEGPN        KSS-LNLYNLMSEVSQYYQKKL--KYNGQVAIDYLRNRG-LSGEIAKRYHLGYAPEGWHN
DNAG_NEIMA        KKKQQTLEETTAAAADFYAQQLKFNPAAKA---YLDKRG-LSAEVIAHYGLGYAPDGWQP
DNAG_NEIMB        KKKQQTLEETTAAAADFYAQQLKFNPAAKA---YLDKRG-LSAEVIAHYGLGYAPDGWQP
DNAG_PSEPK        QPTDSPLYPLLDAASEFYRQALRSHPSRKAAVDYLKGRG-LSGEIARDFGLGFAPPGWDN
DNAG_PSEPU        QPTDSPLYPLLDAASEFYRQALRSHPSRKAAVDYLKGRG-LSGEIARDFGLGFAPPGWDN
DNAG_PSEAE        QPTDSPLYPLLSAAAEFYKQALKSHPARKAAVNYLKGRG-LTGEIARDFGLGFAPPGWDN
A4JW69_BURVG      RKRLAGLYQALKEAARVFSRGLA--KSPAARAYLEQKRG-LSAETIERFGLGVVAKGVVE
DNAG_MYXXA        Q-----IKEATDQAAEHFRAMLWQQDEGRSARAYIASRG-VSDETAMAFGLGWAPLEWAS
Q2IEJ9_ANADE      A-----IERACEAALAHWTGRLWGP-EGEPARKYLASRG-VDEPTAKRFRLGYAAREWHD
DNAG_SYNE7        LSRRERLYEVLAVATQFYEQSLRRPEGAAALDYLRRSRQ-LQESTIQKFQLGYAPAQWAS
DNAG_SYNY3        LSLREQLYEIMAVAAGFYHHTLFQPQGQEALTYLDQKRC-LSSATIQEFQLGYAPAGWET
DNAG_MYCTU        RGSRSRLLAANAAAAAFYAQALQSD-EAAPARQYLTERS-FDAAAARKFGCGFAPSGWDS
DNAG_MYCBO        RGSRSRLLAANAAAAAFYAQALQSD-EAAPARQYLTERS-FDAAAARKFGCGFAPSGWDS
DNAG_MYCLE        RGSRSRLIAANAAAAAFYAAALESD-EAAPARQYLMERN-FDANAARHFGCGFAPSGWDS
DNAG_MYCS2        RGSRSRLLAANAAAAEFYAEALQSE-EAAPARQYLTERN-FDAAAAAKFGCGYAPSGWDK
DNAG_STRCO        RGERIRLVEAHKIAAQWYAEQLATGPEADTGRAFLADRG-FDQAAAEHFGVGYSPQGWDH
DNAG_GEOSE        TDEAKAMTEAHALLKRFYHHLLVHTKEGQAALDYLQARG-WTKETIDRFEIGYAPDAPDA
DNAG_BACSU        SSGEQKMAEAHELLKKFYHHLLINTKEGQEALDYLLSRG-FTKELINEFQIGYALDSWDF
DNAG_BACHD        NRDEELLISIQEFAAKFFHHVLMLTEEGKAGRTYLERRG-FTKEQIEHFQIGFAPPHWDA
DNAG_LISIN        TSETAKMVEMHQLTAKLYHYILMETEEGAAALTYLKERG-MSEQMMASFQIGFAPNHHAT
DNAG_LISMO        TSETAKMVEMHQLTAKLYHYILMETEEGTAALTYLKERG-MSEQMMTTFQIGFAPNHHAT
DNAG_ENTFA        NQQRRSLLQLHSKAAELYHHILVNTKIGEPALNYLLERG-LTQELIETFQIGFAPQKRDF
DNAG_STAAM        ASDDLQMIEMHELIQEFYYYALTKTVEGEQALTYLQERG-FTDALIKERGIGFAPDSSHF
DNAG_STAAN        ASDDLQMIEMHELIQEFYYYALTKTVEGEQALTYLQERG-FTDALIKERGIGFAPDSSHF
DNAG_STAAU        ASDDLQMIEMHELIQEFYYYALTKTVEGEQALTYLQERG-FTDALIKERGIGFAPDSSHF
DNAG_STAAS        ASDDLQMIEMHELIQEFYYYALTKTVEGEQALTYLQERG-FTDALIKERGIGFAPDSSHF
DNAG_STAAW        ASDDLQMIEMHELIQEFYYYALTKTVEGEQALTYLQERG-FTDALIKERGIGFAPDSSHF
DNAG_STAAC        ASDDLQMIEMHELIQEFYYYALTKTVEGEQALTYLQERG-FTDALIKERGIGFAPDSSHF
DNAG_STAAR        ASDDLQMIEMHELIQEFYYYALTKTVEGEQALTYLQERG-FTDALIKERGIGFAPDSSHF
DNAG_STAES        ASDELKMIEMHELIKDYYHYALMKTVEGEEALNYLHERG-FTDDLIKEREIGYAPDNSHF
DNAG_STAEQ        ASDELKMIEMHELIKDYYHYALMKTVEGEEALNYLHERG-FTDDLIKEREIGYAPDNSHF
DNAG_RICCN        YEESDEILNILELANKFFRTQL-----TPEILHYLHERG-ITEETVKEFSIGFAPK-NNK
DNAG_RICFE        YEESDEILNILELANKFFRTQL-----TPEILNYLHERG-ITEETVKEFSIGFAPK-NNK
DNAG_RICPR        YEESDNILNILELANKFFRTQL-----TPEILNYLYKRN-ITETTIKEFSIGFAPR-NNK
DNAG_RICTY        YEESDNILNILELANKFFRTQL-----TPEILNYLNQRN-ITETTIKEFSIGFSPR-NNK
DNAG_RICBR        YEESDEILNILELANKFFKSQL-----TPEILNYLNERN-ITNETIKEFSIGFAPR-GNK
DNAG_MYCGE        DPKQKRYWEINNALITYYQTRLKRETNPNGMNYLVEKRK-LNKTLIEQFQLGLAFHNEDK
DNAG_MYCPN        DPKLKRYWDLHSALVDYYQTRLKLEPKEQGLTYLTETRK-LSPQVIERFQLGLAFTLEDQ
DNAG_AQUAE        --KDEKVYVALDRVCDFYRESLLK---NREASEYVKSRG-IDPKVARKFDLGYAPS-SEA
DNAG_DEIRA        EKVSRDLYEVNAFALDYFRSHL-----PGPALDYLRGRG-LSDETIAAFELGYAPDGWDG
DNAG_LACLA        NNPNAPLFEINNQAARLYNILLMSTELGERARKYLEERG-ITDDVIKRFNIGLAPEENDF
DNAG_THEMA        TSEYGKYIRLYEETWKRYVKELE---KSKEAKDYLKSRG-FSEEDIAKFGFGYVPKRSSI
DNAG_CLOAB        KEKYDKLYSMNVEAARYFFRNLD---SNSKAKKYFLDRG-INQKTMRRFGLGYAKDDWRQ
A0R7W2_PELPD      EKERKAMLHALAKAQYFFQQGLS---ENRNGGRAYADSR-LTPYEVERHGIGYAPKGGRA
DNAG_BORBU        KDMVSKIYSLNSRLINTIKFFLS--KNKKALDYVLKSRA-ISKEIVDLFELGYLPFNFKN
DNAG_TREPA        ASFTMQLCEVYQRIAETFHHVLMHTAQGARARAYLASRK-VTDDSIRTFKLGYAPPDPVW
M3MLR4_HELPX      TERNAHLKELLLYANNLFKERLK--NEPKVLNYLTNTRA-ISLEMIEAYDLGYCLHGDLE
E0TIT3_ZINIC      ----EKIFLIYEKINLIYKKELK---KNYKAKKYIKLRN-INKKIIKKFNLGYSKNINKK
B3QZV5_PHYMT      SNSNNHLYRIIEETMIFFQSNLYDRTFGKKAFKYLEEERKIKDETIKYFKLGYALSHLEE
A6LBI6_PARD8      HEARQAILRGNEDFARSLLPYDPAEGITGKDENGEEDRR-ALREAFSHFGVGICPPDAPE
E1X3Y2_HALMS      KPPKVLMAEKILTKSSQLYQRIAESGHYEEYTKFIKNRG-LSKDIAKTYNLGYAPKDSKL
DNAG_MYCPU        NENEQLFIDVTSIANHYFKVSLKSQVHSNSKLVDFLKSRGISRETASEFEIGYDDGNFWK
DNAG_UREPA        EIKKNKVFDLNKQIQKWFINFLN-NKNNIHVIDYLTKRN-LNKNDLAYFKIGYAPNNDEL
H6N6X3_MYCHN      ESSNNKLFKINEVVALAYHKFLFNKVNKHHLEYLTNERG-LSKEIIQKYQLGYAPEEDIL
I7CGI8_MYCHA      QAFREKLSKFNKFVLEFFQRTLYSEQGADALKYLMEERK-LTEKEISTYRLGYAPSGNEL
                                                                     *        

DNAG_HELPY        -------------------YGIENKGLNKDKLIELGVLGKSDNDQ---------K-TYLR
DNAG_HELPJ        -------------------YGIENKGLNKDKLIELGVLGKSDKED---------K-TYLR
DNAG_CAMJE        -----------------I-RLLQNQKIPLEDAMSVGALKK-DENN---------E-FYAS
DNAG_CHLMU        -----------------FVRAMEERGISVKQLEWAGYLS----------------KDWFL
DNAG_CHLTR        -----------------FIQAMEERNISVKQLEWAGYLA----------------KDWFL
DNAG_CHLPN        -----------------FLQAMEERKISQEQLHTAGFFG----------------NKWFL
DNAG_ECOLI        -----------------VLKRFGGNPENRQSLIDAGMLV-TNDQ----------GRSYDR
DNAG_ECO57        -----------------VLKRFGGNPENRQSLIDAGMLV-TNDQ----------GRSYDR
DNAG_SHIFL        -----------------VLKRFGGNPENRQSLIDAGMLV-TNDQ----------GRSYDR
DNAG_ECOL6        -----------------VLKRFGGNPENRQSLVDAGMLV-TNDQ----------GRSYDR
DNAG_SALTY        -----------------ALKRFGNNSDNKALLLDAGMLV-NNEQ----------GSTYDR
DNAG_HAEIN        -----------------VLRKFGVNREEQQKLIELGMLS-RNDR----------GNIYDK
DNAG_PASMU        -----------------VLQRFGQQKEDQQKLFDLGMLS-RSEQ----------GKIYDR
DNAG_BUCAI        -----------------FYKKINISKEFEQELLINNIIA-TDKN----------GYIYDR
DNAG_BUCAP        -----------------FSKQFNIKKDFEKDLLHYKIIS-TNKN----------GYIYDT
DNAG_BUCBP        -----------------LEKKNKKQCYNQKELQEIGILK-TTIL----------GYTYDR
DNAG_LEGPN        -----------------LEKAFP---NNQRELLSTGMLI-KSDE----------GKIYDR
DNAG_NEIMA        -----------------LTQVF--QPYPNTALVDTGMVI-DNE-----------GRHYDR
DNAG_NEIMB        -----------------LTQVF--QPYPNTALVDTGMVI-DNE-----------GRHYDR
DNAG_PSEPK        -----------------LLKHLGADTLQQKVMIDAGLLI-ENAES---------GKRYDR
DNAG_PSEPU        -----------------LLKHLGADTLQQKVMIDAGLLI-ENAES---------GKRYDR
DNAG_PSEAE        -----------------LLKHLGGDNLQLKAMLDAGLLV-ENSDT---------GKRYDR
A4JW69_BURVG      -----------------L----LGGSTSREALLGSGLAA-QRDD----------GEIYDR
DNAG_MYXXA        -----------------LTERFQKLGMLEWAAKAGLVLKRNSGDG-----------YYDF
Q2IEJ9_ANADE      -----------------LHSALVAQGIPEDDLLRAGLLRESTSKG---------PLAHDR
DNAG_SYNE7        -----------------LATHLIEQKRFPADLVEEAGLVVARRNG---------QGYYDR
DNAG_SYNY3        -----------------LYRYLVEQKRYPVAAVEQAGLIKARQSG---------TGYYDQ
DNAG_MYCTU        -----------------LTKHLQRKGFEFEELEAAGLSRQGRHG------------PMDR
DNAG_MYCBO        -----------------LTKHLQRKGFEFEELEAAGLSRQGRHG------------PMDR
DNAG_MYCLE        -----------------LTKYLISKGFEFTELEAAGLSRQGRRG------------PMDR
DNAG_MYCS2        -----------------LTKHLLRKGFEFKELEAAGLSREGKRG------------PMDR
DNAG_STRCO        -----------------LTRFLRGKGFSDKELLLSGLSQEGRRG------------PIDR
DNAG_GEOSE        -----------------AAKLLESHSFSLPVMEKAGLLT-KKEDG---------R-YVGR
DNAG_BACSU        -----------------ITKFLVKRGFSEAQMEKAGLLI-RREDG---------SGYFDR
DNAG_BACHD        -----------------LTNVLAKRDVDLKKAGESGLLV-ERESD---------GKRYDR
DNAG_LISIN        -----------------ITSFLEKRGMDLQLAGTAGLLS-ERDDG---------Q-MVDR
DNAG_LISMO        -----------------ITSFLEKRGMDLQLAGAAGLLS-ERDDG---------Q-MVDR
DNAG_ENTFA        -----------------LSQVFKNEQLDETLFEPSGLFV-QRDNG---------T-FLDR
DNAG_STAAM        -----------------CHDFLQKKGYDIELAYEAGLLS-RNEEN---------FSYYDR
DNAG_STAAN        -----------------CHDFLQKKGYDIELAYEAGLLS-RNEEN---------FSYYDR
DNAG_STAAU        -----------------CHDFLQKKGYDIELAYEAGLLS-RNEEN---------FSYYDR
DNAG_STAAS        -----------------CHDFLQKRGYDIELAYEAGLLS-RNEEN---------FSYYDR
DNAG_STAAW        -----------------CHDFLQKKGYDIELAYEAGLLS-RNEEN---------FSYYDR
DNAG_STAAC        -----------------CHDFLQKKGYDIELAYEAGLLS-RNEEN---------FSYYDR
DNAG_STAAR        -----------------CHDFLQKKGYDIELAYEAGLLS-RNEEN---------FSYYDR
DNAG_STAES        -----------------CHDFLEKKGYDIELAFEAGLLS-RNEEN---------FTYFDR
DNAG_STAEQ        -----------------CHDFLEKKGYDIELAFEAGLLS-RNEEN---------FTYFDR
DNAG_RICCN        -----------------FEKFFHDKNIDIIKLGKAGLIG--KREN---------GEIYNL
DNAG_RICFE        -----------------FEKFFHDKNIDIIKLGKAGLIG--KREN---------GEIYNL
DNAG_RICPR        -----------------FEKFFLDKKIDITKLGQAGLIG--KCKN---------GKIYNL
DNAG_RICTY        -----------------FAKFFLDKKIDITTLGQAGLIG--KRKN---------GEIYNL
DNAG_RICBR        -----------------FEKFFHDKNITNVQLGKAGLIG--KRED---------GEIYSL
DNAG_MYCGE        -----------------YLCESMERYPFINPKIKPSELYLFSKTNQQGLGFFDFNTKKAT
DNAG_MYCPN        -----------------YFLPSLLNYPWISPAIEKAELCFATEKFPEALGFFNQQTHYAT
DNAG_AQUAE        -----------------LVKVLKENDLLEAYLETKNLLSPTKGVY------------RDL
DNAG_DEIRA        -----------------LLKLARTKGVSEKQLLEAGLLTENPENG----------RVYDR
DNAG_LACLA        -----------------IFKNLSNK-FDEEIMAKSGLFHFSNNN------------VFDA
DNAG_THEMA        -----------------SIEVAEGMNITLEELVRYGIALKKGDR------------FVDR
DNAG_CLOAB        -----------------LLSFMKSKGYTELELIEAGLIVQKNKAV------------YDR
A0R7W2_PELPD      -----------------LVDYLDKSGVPFWAAEKAGLIRREENGP-----------YKDC
DNAG_BORBU        GLE--------------LHDFLVSKGYSSEVLRKSGLFSKTNPKV-------------SI
DNAG_TREPA        -----------------LFQFLRHKGYSPEFLARSGLFAKKSER-------------IAV
M3MLR4_HELPX      ---------------------VLNERFSKEDLIACGLFSDKNQEK----------ELKSF
E0TIT3_ZINIC      ------------------FKFIKKKYNFIYKNI-------------------------NI
B3QZV5_PHYMT      NIFNNKIKNKKEFNNFSSLVDYLKKNFSINDLIDLGIIKENEKTG----------DYYNF
A6LBI6_PARD8      --------------------------------------------------------GFRR
E1X3Y2_HALMS      TTYLS------------SIPDEKERDFALSVAKELGLIRVDKNDS---------KSHYDT
DNAG_MYCPU        --------------------IPNKEKKNFSFFLSNNLIVKKETNQ-----------YYDF
DNAG_UREPA        LNLIKS---------NYNNLIQENDEFELNKLIENSFLVIDKNGN-----------YHDF
H6N6X3_MYCHN      KDVFRS-----------YLSANEKESFGDEEYEKLGIFNYGRGTP------------DPF
I7CGI8_MYCHA      LLTLENI----------QKADPELSFLNRSFLLKTGIIYESTQGE-----------LQPL
                                                                              

DNAG_HELPY        FLDRIMFPIYSPSAQVVGFGGRTLKEKA--------AKYINSPQSKLFDKSSLLYGYHLA
DNAG_HELPJ        FLDRIMFPIYSPSAQVVGFGGRTLKEKA--------AKYINSPQNKLFDKSSLLYGYHLA
DNAG_CAMJE        FIWRITFPIYDHKDLLVGFGGRTLNPNVP-------AKYVNSPQNILFDKSRIFYAFNIA
DNAG_CHLMU        FAQRIMFPIQDSLGYTIGFSSRRFKEGGKGG------KYINSPETLLFKKSRVLYGLQFS
DNAG_CHLTR        FAQRIMFPIQDALGYTIGFSSRRFKEGGRGG------KYINSPETILFKKSRVLYGLQFS
DNAG_CHLPN        FARRIIFPVHDALGHTIGFSARKFLENSQGG------KYVNTPETPIFKKSRILFGLNFS
DNAG_ECOLI        FRERVMFPIRDKRGRVIGFGGRV---LGNDT-----PKYLNSPETDIFHKGRQLYGLYEA
DNAG_ECO57        FRERVMFPIRDKRGRVIGFGGRV---LGNDT-----PKYLNSPETDIFHKGRQLYGLYEA
DNAG_SHIFL        FRERVMFPIRDKRGRVIGFGGRV---LGNDT-----PKYLNSPETDIFHKGRQLYGLYEA
DNAG_ECOL6        FRERVMFPIRDKRGRVIGFGGRV---LGNDT-----PKYLNSPETDIFHKGRQLYGLYEA
DNAG_SALTY        FRNRVMFPIRDKRGRVIGFGGRV---LGNDT-----PKYLNSPETDIFHKGRQLYGLYEA
DNAG_HAEIN        FRNRIMFPIRDKRGRTVAFGGRV---LTDEK-----PKYLNSPETITYHKGKELYGLYEA
DNAG_PASMU        FRHRIMFPIRDRRGKTIAFGGRV---LGDEK-----PKYLNSPESATYHKGNELYGLYEA
DNAG_BUCAI        FQGRIIFPIQDNHGRIIGFGGRS---LNDMS-----PKYLNSPETDIFYKRKQIYGLYQV
DNAG_BUCAP        FQGRIVFPIHDQHGRIISFGGRSI--TNNIL-----PKYLNSHENDIFHKGKQIYGLYQV
DNAG_BUCBP        FKNRIIFPIRNKNGNIVGFGGRT---LNNHI-----PKYINSPETQIFHKGFQLYGLYEM
DNAG_LEGPN        YRNRIMFPIHDRNGRVIGFGGRVL--DKDQK-----PKYLNSPETVLFQKSRELYGLHQV
DNAG_NEIMA        FRHRIMFPIRNPRGQVIGFGGRV---LDDSK-----PKYLNSPDTPLFDKGKNLYGLYEG
DNAG_NEIMB        FRHRIMFPIRNPRGQVIGFGGRV---LDDSK-----PKYLNSPDTPLFDKGKNLYGLYEG
DNAG_PSEPK        FRDRVMFPIRDSRGRIIAFGGRV---LGDDK-----PKYLNSPETPVFHKGQELYGLYEA
DNAG_PSEPU        FRDRVMFPIRDSRGRIIAFGGRV---LGDDK-----PKYLNSPETPVFHKGQELYGLYEA
DNAG_PSEAE        FRDRVMFPIRDSRGRIIAFGGRV---LGDDK-----PKYLNSPETPVFHKGQELYGLYEA
A4JW69_BURVG      FRHRIMFPIHNESGNLVGFAGRSMIEKPDKT-----PKYVNCPETEIFHKGRELYALHLA
DNAG_MYXXA        FRSRVMVPIRAPEGRPIAFGGRL---IGAD----EGPKYLNSRESRLYNKSETLFGMDQS
Q2IEJ9_ANADE      FRGRVMFPFLDGRRRAVGFAGRI---IPATGDGAQAPKYLNGPETPLFRKGHLVFGLAEA
DNAG_SYNE7        FRDRLMIPIHDLQGRVVGFGGRT---LTGE-----EPKYLNSPETTLFEKGKLLFGLDKA
DNAG_SYNY3        FRHRLMIPIRDVQGKTIAFGSRT---LGND-----EPKYLNSPETPLFHKSKTLFGLDQA
DNAG_MYCTU        FHRRLLWPIRTSAGEVVGFGARRL--FDDDA---MEAKYVNTPETLLYKKSSVMFGIDLA
DNAG_MYCBO        FHRRLLWPIRTSAGEVVGFGARRL--FDDDA---MEAKYVNTPETLLYKKSSVMFGIDLA
DNAG_MYCLE        FHRRLLWPILTLAGEVIGFGARRL--FDDDP---MEAKYVNTPETLLYKKSSVMFGIDLA
DNAG_MYCS2        FHRRLLWPIRVSSGETIGFGARRL--FDDDP---NQAKYVNTPETVLYKKSQVLFGLDLA
DNAG_STRCO        FRGRLMWPIRDIGGDVVGFGARKL--YEAD----NGPKYLNTPDTAIYKKSQVLYGIDLA
DNAG_GEOSE        FRNRIMFPIHDHRGETVGFSGRLLG--------EGHPKYVNSPETPVFRKGAILYHFHAA
DNAG_BACSU        FRNRVMFPIHDHHGAVVAFSGRALG--------SQQPKYMNSPETPLFHKSKLLYNFYKA
DNAG_BACHD        FRNRVIFPIRNGKGKIVAFGGRTLG--------DDKPKYLNSPESPIFQKGKLLYGFYQA
DNAG_LISIN        FRNRIMFPITNDRGQINAFSGRLFDR-------DDGPKYLNSPETPIFNKRRTLFHFSEA
DNAG_LISMO        FRNRIMFPITNDRGQIIAFSGRLFDR-------DDGPKYLNSPETPVFNKRRILFHFSEA
DNAG_ENTFA        FYQRIMFPINDPQGNVIAFSGRLLKTADFPG--DEMPKYLNSPETTLFNKRETLFNFDRA
DNAG_STAAM        FRNRIMFPLKNAQGRIVGYSGRTYTG--------QEPKYLNSPETPIFQKRKLLYNLDKA
DNAG_STAAN        FRNRIMFPLKNAQGRIVGYSGRTYTG--------QEPKYLNSPETPIFQKRKLLYNLDKA
DNAG_STAAU        FRNRIMFPLKNAQGRIVGYSGRTYTG--------QEPKYLNSPETPIFQKRKLLYNLDKA
DNAG_STAAS        FRNRIMFPLKNAQGRIVGYSGRTYTG--------QEPKYLNSPETPIFQKRKLLYNLDKA
DNAG_STAAW        FRNRIMFPLKNAQGRIVGYSGRTYTG--------QEPKYLNSPETPIFQKRKLLYNLDKA
DNAG_STAAC        FRNRIMFPLKNAQGRIVGYSGRTYTG--------QEPKYLNSPETPIFQKRKLLYNLDKA
DNAG_STAAR        FRNRIMFPLKNAQGRIVGYSGRTYTG--------QEPKYLNSPETPIFQKRKLLYNLDKA
DNAG_STAES        FRNRIMFPLKNGQGRIVGYSGRTYTD--------QEPKYLNSPETPIFQKRRILYNLNKA
DNAG_STAEQ        FRNRIMFPLKNGQGRIVGYSGRTYTD--------QEPKYLNSPETPIFQKRRILYNLNKA
DNAG_RICCN        FSNRITIPIRNIYNKIVGFGGRVLG--------EGLPKYLNSPETTVFQKSETLYGEHKA
DNAG_RICFE        FSNRITIPIRNIYNKIVGFGGRVLG--------EGLPKYLNSPETTVFQKSETLYGEHKA
DNAG_RICPR        FSNRITIPIRNIYNKIVGFGGRVLG--------NELPKYLNSFETIVFQKSDILYGEHKA
DNAG_RICTY        FSNRITIPIRNIYNKIVGFGARVLG--------NGLPKYLNSYETIVFQKNDTLYGEHKA
DNAG_RICBR        FSNRITIPIRNIYNKIVGFGGRVIG--------QGLPKYLNSPETVVFQKSETLYGEHKA
DNAG_MYCGE        FQNQIMIPIHDFNGNPVGFSARSVDNINK-------LKYKNSADHEFFKKGELLFNFHRL
DNAG_MYCPN        FKSRIMIPIHDLKGNPVGFSGRALQKTEK-------IKYKNSAEHQWFKKSELLFNFHRI
DNAG_AQUAE        FLRRVVIPIKDPRGRVIGFGGRRIVEDKS-------PKYINSPDSRVFKKGENLFGLYEA
DNAG_DEIRA        FRGRVMFPIRDHLGRLVGFGGRVLD--------DSKPKYLNTPETAAFKKGELLYGLDKA
DNAG_LACLA        FTNRIMFPITNEYGHTIGFSGRKWQENDDSK-----AKYINTSATTIFDKSYELWNLDKA
DNAG_THEMA        FEGRIVVPIKNDSGHIVAFGGRALG--------NEEPKYLNSPETRYFSKKKTLFLFDEA
DNAG_CLOAB        FRNRVIFPVFDYKGKVIGFGGRVLD--------DSKPKYLNSPETKIFKKGTNLYGLNFA
A0R7W2_PELPD      FWGRVMFPIRDDRGRVIAFAGRRTDKIKT-------LKYVNSPESPLYKKEATLYGIDTA
DNAG_BORBU        LFQRLIFPIKDFKGNVVGFGGRDLDGKG--------SKYINLGETEVFKKRELLYGFYEG
DNAG_TREPA        FSDRIMYPIADRYGQVIAFGARALGTAP--------AKYLNTADMPQYKKGEHLFAFHCA
M3MLR4_HELPX      CNYRITIPLKDSKGKIRSFSARLCIPRLLKT--NKAPKYINGRETSLFNKTFFLYNYHRA
E0TIT3_ZINIC      LKNRIIFPIRNLNGKIIAFGGRSINNNYK-------NKYINTYENFIFKKKKEFYGLYEN
B3QZV5_PHYMT      FNERLIFPITDHYGKFVGFAGRNLNNNEP-------IKYLFNTNTKLFNKQELLYQFYEN
A6LBI6_PARD8      FRRRLVFPVRTTGGQIAGFAGRYRGTEGAGT-----AKYVNSDNSEAYNKGRILYGLYEA
E1X3Y2_HALMS      FRDRIIFPIWDQYGQVVGYTSRAVFDYQK-------AKYMNSLESFIFKKKHILYGLHLA
DNAG_MYCPU        FYKRVVFPIHNSFGDVVGFSGRALDENN--------IKYLNSPESLVFKKHKILYNWAKA
DNAG_UREPA        FNDRIIFSIYDHLNNVVGFSGRIITNEKT-------PKYLNTKTTAVFKKDEVLYNFH-N
H6N6X3_MYCHN      FKDRIIFPIFNRHGQIVGFSGRAIKNVE--------PKYLNTKSNIIFNKKNCIYNIQNL
I7CGI8_MYCHA      FRNRIVFPLFSTKGDILSFSSRALPPYQKEV------KYVHSRETVLFKKSTLFYNLQ-S
                     ::  ..        .: .*               **        : *   .:     

DNAG_HELPY        KEHIYKQKQVIVTEGYLDVIL-LHQAGFKNAIATLGTALTPSHLPLLKKG-------DPE
DNAG_HELPJ        KEHIYKQKQVIVTEGYLDVIL-LHQAGFKNAIATLGTALTPSHLPLLKKG-------DPE
DNAG_CAMJE        KENIAKKKEIIVCEGYMDAIA-FHKAGFNNAVAVLGTALTEHHLPLIRRY-------DAK
DNAG_CHLMU        RKRIAKEKRVILVEGQADCLQ-MIDFGFNCTLAAQGTSFTETHVKELVKLG------VSK
DNAG_CHLTR        RKRIAKERRVILVEGQADCLQ-MIDFGFNCTLAAQGTSFTETHVHELVKLG------VSK
DNAG_CHLPN        RRRIAKEKKVILVEGQADCLQ-MIDSGFNCTVAAQGTAFTEEHVKELSKLG------VLK
DNAG_ECOLI        QQDNAEPNRLLVVEGYMDVVA-LAQYGINYAVASLGTSTTADHIQLLFRA-------TNN
DNAG_ECO57        QQDNAEPNRLLVVEGYMDVVA-LAQYGINYAVASLGTSTTADHIQLLFRA-------TNN
DNAG_SHIFL        QQDNAEPNRLLVVEGYMDVVA-LAQYGINYAVASLGTSTTADHIQLLFRA-------TNN
DNAG_ECOL6        QQDNAEPNRLLVVEGYMDVVA-LAQYGINYAVASLGTSTTADHIQLLFRA-------TNN
DNAG_SALTY        QQYSAEPQRLLVVEGYMDVVA-LAQYDINYAVASLGTSTTADHMHMLFRA-------TNN
DNAG_HAEIN        LQTNDEPKQLLVVEGYMDVVA-LAQFGVDYAVASLGTSTTSEQIQLILRS-------TEQ
DNAG_PASMU        LQANESPEMLLVVEGYMDVVA-LAQFGVDYAVASLGTATTAEQIQLLFRS-------TEQ
DNAG_BUCAI        IKKCSKPVYLLVVEGYIDVIT-LTQYNIDYAVSILGTSTTTEHIQLLFKN-------TDI
DNAG_BUCAP        KKKHSKPKYLLVVEGYIDVIM-LTQYNIEYVVSSLGTSITKEHIQILFRH-------TNT
DNAG_BUCBP        LKTNPKPKQILIVEGYVDVIA-LVQFKINYTISTLGTIISNEQIKLLFRT-------SNT
DNAG_LEGPN        LSQQKNPDSIIVVEGYMDVIA-LAQHGIFNVVATLGTATSTFHIQLLAKH-------TKH
DNAG_NEIMA        RAAVKEAGRILVVEGYMDVVA-LAQFGVGYGVAALGTATTAEHVKILMRQ-------ADS
DNAG_NEIMB        RAAVKEAGRILVVEGYMDVVA-LAQFGVGYGVAALGTATTAEHVKILMRQ-------ADS
DNAG_PSEPK        RKHNRNLDEIIVVEGYMDVIA-LAQQGLRNAVATLGTATSEEHLKRLFRV-------VPS
DNAG_PSEPU        RKHNRNLDEIIVVEGYMDVIA-LAQQGLRNAVATLGTATSEEHLKRLFRV-------VPS
DNAG_PSEAE        RQKNRDLDEIMVVEGYMDVIA-LAQQGIRNAVATLGTATSEEHIKRLFRL-------VPS
A4JW69_BURVG      KPAIRSGRVAVIVEGYFDVIS-LHQAGDERAVAPMGTALTNLQVRRLLVH-------ADT
DNAG_MYXXA        RDEIRKRKAAVLVEGYFDALG-LHQVGVRHAVALCSTNLTAGHMQVLKRA------EARE
Q2IEJ9_ANADE      AAAIRSTRRAIVVEGYLDAIA-LAQAGRQETVAAGGTAVTEHQLSLVQRS------GAEE
DNAG_SYNE7        RAAIAKQDQAVVVEGYFDVIA-LHAAGIDHAVASLGTALSRQQVKLLSRYS-----ESNQ
DNAG_SYNY3        KTAIQKVDEAILVEGYFDVIA-LHESGIKQTVAALGIALSRDQVQSLMRFS-----QSKQ
DNAG_MYCTU        KRDIAKGHQAVVVEGYTDVMA-MHLAGVTTAVASCGTAFGGEHLAMLRRLMMDDSFFRGE
DNAG_MYCBO        KRDIAKGHQAVVVEGYTDVMA-MHLAGVTTAVASCGTAFGGEHLAMLRRLMMDDSFFRGE
DNAG_MYCLE        KRDIVKGHQAVVVEGYTDVMA-MHLAGVTTAVASCGTAFGDEHLAMLRRLIMDDNWYRGE
DNAG_MYCS2        KRDIAKGHQAVVVEGYTDVMA-MHLAGVTTAVASCGTAFGEQHLSMLRRLMMDDNFFRGE
DNAG_STRCO        KKDIAKASRAVVVEGYTDVMA-CHLAGVTTAIATCGTAFGGDHIKILRRLLMDNG--SAR
DNAG_GEOSE        RVPIRKRQEALLVEGFADVIS-AAQAGIDYAIATMGTSLTEEQARILRP--------CDT
DNAG_BACSU        RLHIRKQERAVLFEGFADVIS-AVSSDVKESIATMGTSLTDDHVKILRRN-------VEE
DNAG_BACHD        RPAIRKENEAVLFEGYVDVIA-AWKAGVTNGVATLGTSLTEEQARMIRRN-------AET
DNAG_LISIN        RQAIRKQEEITLMEGFMDVIS-AEEAGVQNAVASMGTSLTEEHADLIKRL-------TNR
DNAG_LISMO        RQAIRKQEEITLMEGFMDVIS-AEEAGVQNAVASMGTSLTEEHADLIKRL-------TNR
DNAG_ENTFA        RKEIRKENTVLLFEGFMDVIA-AWQSGVKSGVASMGTSLTNEQIRRLERV-------AKE
DNAG_STAAM        RKSIRKLDEIVLLEGFMDVIK-SDTAGLKNVVATMGTQLSDEHITFIRKL-------TSN
DNAG_STAAN        RKSIRKLDEIVLLEGFMDVIK-SDTAGLKNVVATMGTQLSDEHITFIRKL-------TSN
DNAG_STAAU        RKSIRKLDEIVLLEGFMDVIK-SDTAGLKNVVATMGTQLSDEHITFIRKL-------TSN
DNAG_STAAS        RKSIRKLDEIVLLEGFMDVIK-SDTAGLKNVVATMGTQLSDEHITFIRKL-------TLN
DNAG_STAAW        RKSIRKLDEIVLLEGFMDVIK-SDTAGLKNVVATMGTQLSDEHITFIRKL-------TLN
DNAG_STAAC        RKSIRKLDEIVLLEGFMDVIK-SDTAGLKNVVATMGTQLSDEHITFIRKL-------TSN
DNAG_STAAR        RKSIRKLDEIVLLEGFMDVIK-SDTAGLKNVVATMGTQLSDEHITFIRKL-------TSN
DNAG_STAES        RKFIRKQDEIILLEGFMDVIK-SDYAGLKQVVASMGTQLSQEHITFLQKL-------TQN
DNAG_STAEQ        RKFIRKQDEIILLEGFMDVIK-SDYAGLKQVVASMGTQLSQEHITFLQKL-------TQN
DNAG_RICCN        ISSSYKKNHSILVEGYFDVIA-LHQAGFSETVASLGTSVTENHLHKLWRA-------GDE
DNAG_RICFE        ISSSYKKNHSILVEGYFDVIA-LHQAGFSEAVASLGTSVTENHLHKLWRA-------GDE
DNAG_RICPR        ISSSYKKNRSILVEGYFDVIA-LHQAGFNEVVASLGTSVTESHLHKLWRA-------GDE
DNAG_RICTY        ISSSYKKNRSILVEGYFDVIA-LHQAGFSEVVASLGTSVTENHLHKLWRA-------CDE
DNAG_RICBR        ISSSYKKNYSILVEGYFDVIS-LHQAGFSEVVASLGTSVTENHLHKLWRA-------GDE
DNAG_MYCGE        NKNLNQ---LFIVEGYFDVFT-LTNSKF-EAVALMGLALNDVQIKAIKAHFK----ELQT
DNAG_MYCPN        DKNTLK---LYLVEGYFDVFA-LTSAGIGDVVGLMGLALSESHIIAFQQQLK----ALET
DNAG_AQUAE        KEYIKEEGFAILVEGYFDLLR-LFSEGIRNVVAPLGTALTQNQANLLSKF-------TKK
DNAG_DEIRA        RSGLGGGAELVVVEGYMDVIS-MHQHGFTGAVASLGTALTAEHAQLLERLG------AQS
DNAG_LACLA        KPTISKQHEVYLMEGFMDVIA-AYKAGINNVVASMGTALTEKHIRRLKQM-------AKK
DNAG_THEMA        KKVAKEVGFFVITEGYFDALA-FRKDGIPTAVAVLGASLSREAILKLSAY-------SKN
DNAG_CLOAB        VK-NNIGDTIIIVEGYMDCIS-LHQYGINNVVASLGTALTKDQAKLLKRY-------ASK
A0R7W2_PELPD      IQAIQETGEVYVVEGYFDAIA-MISAGILNTVATCGTAFTKEHAAVLRRY-------CTR
DNAG_BORBU        FEEIKSTKSVILVEGYIDVLA-FFTSGIKRAVSTLGTAFSKEHLALIQRY-------ADE
DNAG_TREPA        LSQMRKTRAAIICEGYMDVIA-FHQAQLTYAVAPLGALLTKSQARLMRSF-------VDR
M3MLR4_HELPX      LDCIKQKKQVIICEGFFDVMA-YEHFDYKNAICTSGTAFTKEHLAFLNKL-------NVE
E0TIT3_ZINIC      LKHIKKKKYVIIVEGYIDLLT-LFQFGFLNTISILGTNFTKYHFKKITKI-------TNK
B3QZV5_PHYMT      KSEIIKKNQVIIYEGFFEVIV-SFQCGIKNTVATMGTNLSIKQIKILSEL-------TKE
A6LBI6_PARD8      VRAVRTEGDVLLCEGYKDVIA-FHAAGIRHAAGLCGTALTEDHVRMIRRL-------TGH
E1X3Y2_HALMS      KSSIRSKDAVILVEGNMDQIA-LFNKGFTNSVGIQGIAMGDSSLVKLKAL-------TKN
DNAG_MYCPU        KEKAIQEKKLYITEGFMDTIA-LYKIGIKNAIAIMGTNLSNEQLELIPKD--------IE
DNAG_UREPA        VITIENNHQLFIVEGFMDVIT-IHKSNKPNVVATMGVELTNKHLELIKSYG------IKD
H6N6X3_MYCHN      QE----GSPVYLYEGFFDVLS-SEKVGIKNGVAVMGASLDSSILDVIKNY-------SKK
I7CGI8_MYCHA      LGGVTKDTYIYLFEGFFDLFASVSLKEGIRSLAILGSEISDEGYSLLSSLG------TKK
                             : **  : .               .          .             

DNAG_HELPY        ILLSYDGDKAGRNAAYKASLMLAKEQRRGG----VILFENNLDPADMIANG---QIET--
DNAG_HELPJ        ILLSYDGDKAGRNAAYKASLMLAKEQRKGG----VILFENNLDPADMIANH---QIET--
DNAG_CAMJE        VILCFDNDEAGLKAATRSAFLLSTNKIDGK----VAILQGGKDPAELVAKN---ESTK--
DNAG_CHLMU        AYLLFDGDAAGEKASLRVGDLCQVAGIAVI----VCRLPSGQDPDSFLMQR---GPEE--
DNAG_CHLTR        AYLLFDGDAAGEKASLRVGDLCQAAGITAI----VCRLPSGQDPDSFLMQR---GPEE--
DNAG_CHLPN        VFLLFDSDEAGNKAALRVGDLCQTAQMSVF----VCKLPQGHDPDSFLMQR---GSSG--
DNAG_ECOLI        VICCYDGDRAGRDAAWRALETALPYMTDGR-QLRFMFLPDGEDPDTLVRKE---GKEA-F
DNAG_ECO57        VICCYDGDRAGRDAAWRALETALPYMTDGR-QLRFMFLPDGEDPDTLVRKE---GKEA-F
DNAG_SHIFL        VICCYDGDRAGRDAAWRALETALPYMTDGR-QLRFMFLPDGEDPDTLVRKE---GKEA-F
DNAG_ECOL6        VICCYDGDRAGRDAAWRALETALPYMTDGR-QLRFMFLPDGEDPDTLVRKE---GKEA-F
DNAG_SALTY        VICCYDGDRAGRDAAWRALETAMPYMTDGR-QVRFMFLPDGEDPDTLVRKE---GKAA-F
DNAG_HAEIN        VVCCYDGDRAGRDAAWRALENALPYLEDGR-QLKFIFLPDGEEPDTYIRQY---GKEK-F
DNAG_PASMU        AICCYDGDRAGREAAWRAFENALPYLEDGR-QLKFVFLPDGEDPDSFIRQH---GKAS-F
DNAG_BUCAI        IICCYDGDDAGKNAAWKTLKKALPYISDKK-TLKFILLPNQEDPDTIIRKE---GREK-F
DNAG_BUCAP        VIYCYDGDDAGRNASWRTLKIALPYISDKK-NIKFIILPNNEDPDTIIKKE---GQKK-F
DNAG_BUCBP        IIFCYDGDVSGQKAAWRTLNISLSHIHDGK-NVKFIFLPNNEDPDSIIRKE---GHDN-F
DNAG_LEGPN        LIFCFDGDAAGKQAAWRALESSLPHLNAGL-DAGFIFLPNEHDPDSLVRNE---GKNG-F
DNAG_NEIMA        IYFCFDGDSAGRKAAWRALENALPQLKDDK-SLHFLFLPEEHDPDSYIRAY---GKAQ-F
DNAG_NEIMB        IYFCFDGDSAGRKAAWRALENALPQLKDDK-SLHFLFLPEEHDPDSYIRAY---GKAQ-F
DNAG_PSEPK        VLFCFDGDQAGRKAAWRALESTLSNLQDGR-RARFLFLPEGEDPDSLVRAE---GTDA-F
DNAG_PSEPU        VLFCFDGDQAGRKAAWRALESTLSNLQDGR-RARFLFLPEGEDPDSLVRAE---GTDA-F
DNAG_PSEAE        ILFCFDGDQAGRKAAWRALESVLPNLQDGK-RVRFLFLPEGEDPDSLVRAE---GEDA-F
A4JW69_BURVG      IVFAFDGDAAGRKAALGAAAVLLDEMKDGK-TARFLFLPEGEDPDSFVRAH---GLEA-W
DNAG_MYXXA        LILLLDGDSAGLAAVERLSGPL--LAAGATARVALLP--QGDDPDTFARRE---GQEG--
Q2IEJ9_ANADE      LVLLFDTDAPGLEAPAQVAPAL--LKAGLSTRIARLPGAAAADPDSFLRSH---GLRA--
DNAG_SYNE7        IVLNFDADRAGAKAAERAIGEVEDLAYQGQVQLRVLNLPGGKDADEYLQRH---SVAD--
DNAG_SYNY3        IIFNFDADKAGINATQRAIQEIEPLVYSGQVNLRILNLPAGKDADEFIHSS---AENKEI
DNAG_MYCTU        LIYVFDGDEAGRAAALKAFDGEQKLAGQSF----VAVAPDGMDPCDLRLKC---GDAA--
DNAG_MYCBO        LIYVFDGDEAGRAAALKAFDGEQKLAGQSF----VAVAPDGMDPCDLRLKC---GDAA--
DNAG_MYCLE        LIFVFDGDAAGQAAALKAFDGDQQVAGKSF----VAVAADGMDPCDLRLSS---GDQA--
DNAG_MYCS2        LIYVFDGDDAGRAAAVKAFEGEQNLSGQSF----VAVAADGMDPCDLRLRS---GDGA--
DNAG_STRCO        VIFTFDGDAAGQKAALRAFEDDQKFAAETY----IAIAPDGMDPCDLRLAK---GDDA--
DNAG_GEOSE        ITICYDGDRAGIEAAWAAAEQLS---ALG-CRVKVASLPNGLDPDEYIRVY---GGER-F
DNAG_BACSU        IILCYDSDKAGYEATLKASELLQ---KKG-CKVRVAMIPDGLDPDDYIKKF---GGEK-F
DNAG_BACHD        VIICNDGDAAGAEATFRSADLLQ---QEG-CHVKVAMIPDGLDPDDYIQKY---GAER-F
DNAG_LISIN        AIICYDGDRAGIEAAYKAGTLLV---ERNRLDVFVLQLPAGKDPDDFIRAS---GADK-F
DNAG_LISMO        AIICYDGDRAGIEAAYKAGTLLV---ERNRLDVFVLQLPAGKDPDDFIRAS---GPEK-F
DNAG_ENTFA        VVICYDGDNAGVQATNRAIQLLQ---ENSHFDLSIVSIPEKLDPDEYVRKY---GAEA-F
DNAG_STAAM        ITLMFDGDFAGSEATLKTGQHLL---QQG-LNVFVIQLPSGMDPDEYIGKY---GNDA-F
DNAG_STAAN        ITLMFDGDFAGSEATLKTGQHLL---QQG-LNVFVIQLPSGMDPDEYIGKY---GNDA-F
DNAG_STAAU        ITLMFDGDFAGSEATLKTGQHLL---QQG-LNVFVIQLPSGMDPDEYIGKY---GNDA-F
DNAG_STAAS        ITLMFDGDFAGSEATLKTGQHLL---QQG-LNVFVIQLPSGMDPDEYIGKY---GNDA-F
DNAG_STAAW        ITLMFDGDFAGSEATLKTGQHLL---QQG-LNVFVIQLPSGMDPDEYIGKY---GNDA-F
DNAG_STAAC        ITLMFDGDFAGSEATLKTGQNLL---QQG-LNVFVIQLPSGMDPDEYIGKY---GNDA-F
DNAG_STAAR        ITLMFDGDFAGSEATLKTGQHLL---QQG-LNVFVIQLPSGMDPDEYIGKY---GNDA-F
DNAG_STAES        VTLMFDGDYAGKEATLKTGQALL---NQG-LNVYVVQLPSGMDPDDYIRKY---DNEQ-F
DNAG_STAEQ        VTLMFDGDYAGKEATLKTGQALL---NQG-LNVYVVQLPSGMDPDDYIRKY---DNEQ-F
DNAG_RICCN        IILCLDGDNAGIKASIRTINLALPLINSEK-KISFIRLPSGLDPDDAVNKN---GADF--
DNAG_RICFE        IILCLDGDNAGIKASIRTINLALPLINSEK-KISFIRLPNGLDPDDAVNKN---GADF--
DNAG_RICPR        IILCLDGDNAGIKASIRTINLALPLVNSEK-KISFIRLPSGLDPDDAVNKN---GADF--
DNAG_RICTY        IILCLDGDNAGIKASIRTINLALPLVNSEK-KISFIRLPSGLDPDDVVNKN---GADF--
DNAG_RICBR        IILCLDGDSAGIKASVRTINLALPLINSEK-KISFIRLPTGLDPDDAVNKN---GVDF--
DNAG_MYCGE        LVLALDNDASGQNAVFSLIEKLN--NNNFIVEIVQWEHN-YKDWDELYLNK---GSEQ--
DNAG_MYCPN        VVLALDNDTAGHDATFKLLQELN--AHGIIVEVVDWNQAAYKDWDELFLAE---GSDA--
DNAG_AQUAE        VYILYDGDDAGRKAMKSAIPLLLSAGVEVY----PVYLPEGYDPDEFIKEF---GKEE--
DNAG_DEIRA        IVLMFDQDGAGLKATLAGLDQVI----GAKFRVRATSVPSGKDPADALLAG---DDAG--
DNAG_LACLA        FVLVYDGDSAGQNAIYKAIDLI------GESAVQIVKVPEGLDPDEYSKNY---GLKG-L
DNAG_THEMA        VILCFDNDKAGFRATLKSLEDLLDYEFNVL----VATPSPYKDPDELFQKE---GEGS--
DNAG_CLOAB        VVISYDADTAGQAATLRGFDILR----EAGFDIKIIKIPDGKDPDEFVRKN---GKEA--
A0R7W2_PELPD      VNFMFDGDAAGKKALQKATLLAL----KEEFTVTAYLLTEDQDPDSFFKSG---ESFNEI
DNAG_BORBU        IIFSFDGDDAGLSATLKAYQICLPFNINVS----VVRMDFGTDPADVLKSE---GVDS--
DNAG_TREPA        IYMCFDADGAGRAATYKAILLCRSLGFEVR----IVELNGGTDPAECACIE---GEDA--
M3MLR4_HELPX      LCFSFDNDHAGLEATIRALEMCL--------KHHIINMSVIKIKDSAMKDL---SDYQKA
E0TIT3_ZINIC      IIFIFDGDIAGNLAINKVLNLCLSLSLKNK-IISFVILPYKYDPDNYLRKY---GILK--
B3QZV5_PHYMT      FIFAYDNDFAGQESFFKLGNYLTKEGFRVK----RILFPNGQDPDEYYRQK---GTIQ-F
A6LBI6_PARD8      VTLALDPDPAGQAATLRSARLLLAQGCEVG----LLPLPGGMDPDEMFRRQ---GAEA--
E1X3Y2_HALMS      IYLALDNDNPGWNAATRINTQCLESGITAK----FIDLAPHKDPDDFLQAE---GSIE--
DNAG_MYCPU        LIFFLDGDQAGKNAVYNILKKIIKMRSKIS----VIENDSKQDPDELLKQK---GANF-L
DNAG_UREPA        LILCFDNDQAGFLATKKQIMKLINSPFNIFIVNHKDNDCKDMDEYANKHGY---SATSKL
H6N6X3_MYCHN      IVCCFDNDNTGRNFTIKVFENLVLNGFSIY--VLDLLDTKSKDIDEYLRKS---ESDS--
I7CGI8_MYCHA      YVLVMDNDLPGMKASLKIFKKSLRFNLEIY--SLDLEFGDSKDLAELKAREPNLQLPEPT
                       * * .*                                                 

DNAG_HELPY        LKNWLSHPMAFIEFVLRRMADSYLLDDP--LEKDKALKEMLGFLKNFS---------LLL
DNAG_HELPJ        LKNWLSRPIAFIEFVLRHMAGSYLLDDP--LEKDKALKEMLGFLKNFS---------LLL
DNAG_CAMJE        LHNILDEGIELGEFYIRRLISTHSIISA--LDKQKALETIQKFTFNLE---------PLV
DNAG_CHLMU        LRELLDRGEDYLSFLVWHKIRSYEQFTP--REKARVVEEVIQQVQHWG--------SPIM
DNAG_CHLTR        LRELLDRGEDYLSFLVWHKIHSYEQFTP--REKARVIEEVIQQVRCWG--------SPIT
DNAG_CHLPN        LIALLEQSQDYLTFLISEKMSSYPKFGP--REKALLVEEAIRQIKHWG--------SPIL
DNAG_ECOLI        EARMEQ-AMPLSAFLFNSLMPQVDLSTP--DGRARLSTLALPLISQVP--------GETL
DNAG_ECO57        EARMEQ-AMPLSAFLFNSLMPQVDLSTP--DGRARLSTLALPLISQVP--------GETL
DNAG_SHIFL        EARMEQ-AMPLSAFLFNSLMPQVDLSTP--DGRARLSTLALPLISQVP--------GETL
DNAG_ECOL6        EARMEQ-AMPLSAFLFNSLMPQVDLSTP--DGRARLSTLALPLISQVP--------GETL
DNAG_SALTY        EARMEQ-AQPLSTFLFNSLLPQVDLSSP--DGSTQLAALALPLINQVP--------GDAH
DNAG_HAEIN        EEYIES-AQSLSEFMFAHLSPQVDFSTK--EGRGKLVALAAPLIHQIP--------GEML
DNAG_PASMU        EQYMQK-ALSLSEFLFTSLAPQVDFSSK--EGKTKLAALAVPLIKKIP--------GDML
DNAG_BUCAI        QKRIDN-AITMSKFFFKNILKNINLSSD--DDKFHLSVHALPLINTIS--------SDTI
DNAG_BUCAP        QLRIDN-ALTMSKFFFKNILKNVDLSSD--DDKFHLSVRALPLINCIS--------SDTI
DNAG_BUCBP        KIRIKK-SIDFSKFLLQTLFKKTDLNSI--SEKSHTSTIAISLIRKIP--------GKIT
DNAG_LEGPN        LELLQQ-ATPLHRFFFDTLSKDINLSNP--AGKTQLINAVKPYLQKMV--------EGSY
DNAG_NEIMA        EDALLNQSKPLSEYFWEHLSDGIHLNTQ--EGKAELVKTSSPLLAQIT--------APAL
DNAG_NEIMB        EDALLNQSKPLSEYFWEHLSDGIHLNTQ--EGKAELVKTSSPLLAQIT--------APAL
DNAG_PSEPK        MARINQHSQPLADYFFEQLGVEADPRSL--EGKAHMATLAAPLIEKIP--------GANL
DNAG_PSEPU        MARINQHSQPLADYFFEQLGVEADPRSL--EGKAHMATLAAPLIEKIP--------GANL
DNAG_PSEAE        RARITQQAQPLAEYFFQQLMLEADPATL--EGKAHLATLAAPLLEKIP--------GNNL
A4JW69_BURVG      HAATEQ-AAPLSAFLADYVAHGLDRDVP--ESQVKAAEKAKAILARIQH-------AELF
DNAG_MYXXA        VERLLEGAHPLTSHLFASLLPEG--------KAASFEEKMAALERLKP--VVGQVPVGLV
Q2IEJ9_ANADE      LEAAIDAAVPLTEWLLERAIASRTAKAP--TKAISVEQKLLIVRDLRP--FVAAAPAGLP
DNAG_SYNE7        YRELLARSPLWLDWQIDQLLRDRNLDQA--DQFQAVVQAIVQLLGKLPNTPLRTHYVHQV
DNAG_SYNY3        YQTLVKQAPLWVDWQIQQLLKQKNLKDP--LDFEQVARGMVDILKRLTDQNKRAYYLQLC
DNAG_MYCTU        LRDLVARRTPLFEFAIRAAIAE-MDLDS-AEGRVAALRRCVPMVGQIK--------DPTL
DNAG_MYCBO        LRDLVARRTPLFEFAIRAAIAE-MDLDS-AEGRVAALRRCVPMVGQIK--------DPTL
DNAG_MYCLE        LRDLVACRKPMFEFAIRSLIPDGMVLDDDPQAKVDALRRSVPLVARIR--------DYAL
DNAG_MYCS2        LRDLVARRTPLFEFVIRSALAE-HDLDS-AEGRVAALRRCVPMLARIK--------DPTL
DNAG_STRCO        VADLVEPRTPLFEFALRQIVAR-YDLDT-PAGRAAALDEAAPVVARIK--------NSGA
DNAG_GEOSE        AGEA-GCRRPLVAFKMAYLRRGKNLQHE--GERLRYIDEALREIGKLS--------SPVE
DNAG_BACSU        KNDIIDASVTVMAFKMQYFRKGKNLSDE--GDRLAYIKDVLKEISTLS--------GSLE
DNAG_BACHD        KKDVIGESLTLMKFKMKYFRMGRNLQNE--GERILYIEEIIKEIAKLS--------KAVE
DNAG_LISIN        KEIYKQQRMTWTAFKINYLRKERNLQNE--TDKIAYIDDCLREIAKLD--------QAVE
DNAG_LISMO        KEVYKQQRMTWTAFKIHYLRKERNLQNE--TEQIGYIDDCLREIAKLD--------QAVE
DNAG_ENTFA        QNLANHGRETVFSFKMNYHRLTRNMNNE--KEQLDYVNELLRELTNVQ--------SPLE
DNAG_STAAM        TTFVKNDKKSFAHYKVSILK-DEIAHND--LSYERYLKELSHDISLMK--------SSIL
DNAG_STAAN        TTFVKNDKKSFAHYKVSILK-DEIAHND--LSYERYLKELSHDISLMK--------SSIL
DNAG_STAAU        TTFVKNDKKSFAHYKVSILK-DEIAHND--LSYERYLKELSHDISLMK--------SSIL
DNAG_STAAS        TAFVKNDKKSFAHYKVSILK-DEIAHND--LSYERYLKELSHDISLMK--------SSIL
DNAG_STAAW        TAFVKNDKKSFAHYKVSILK-DEIAHND--LSYERYLKELSHDISLMK--------SSIL
DNAG_STAAC        TAFVKNDKKSFAHYKVSILK-DEIAHND--LSYERYLKELSHDISLMK--------SSIL
DNAG_STAAR        TAFVKNDKKSFAHYKVSILK-DEIAHND--LSYERYLKELSHDISLMK--------SSIL
DNAG_STAES        LKFVQQDKQSFVLFKVKMYQ-NEINHND--LAYEKHFKETVRDLSLVN--------SGII
DNAG_STAEQ        LKFVQQDKQSFVLFKVKMYQ-NEINHND--LAYEKHFKETVRDLSLVN--------SGII
DNAG_RICCN        FAKLIDKRISLSEMIWHIEYSGKSFKTA--EEKANLEKNLKNYCSKIS--------DSDL
DNAG_RICFE        FAKLIDKRISLSEMIWHIEYSGKSFKTA--EEKANLEKNLKDYCSKIS--------DSNL
DNAG_RICPR        FAKLIDKRISLSEMIWHIEYSGKNFRTA--EEKANLEKNLKDYCNKIS--------DSNL
DNAG_RICTY        FAKLIDKRISLSEMIWYIEYSGKNFKTA--EEKANLEKNLKDYCNKIS--------DSNL
DNAG_RICBR        FTKLIDTRISLSEMIWQIEYAGKNFKTA--EDKANLEKNLKDYCSKIS--------DSNL
DNAG_MYCGE        VILQANKRQNLIEYLVSFFKKQQLDQRVITNKIIAFLTKNQTILNDHS-----------F
DNAG_MYCPN        VKAKTHRVLNLVEYLVAYFKTKGFDERITVNKVIDIIAQNQKVTADTS-----------F
DNAG_AQUAE        LRRLINSSGELFETLIKTARENLEEKTREFRYYLGFISDGVRRFALAS------------
DNAG_DEIRA        IREALAGGLDEVKYRVQAATEKYGVDTN--EGKRRVLMELLPRMQNLDP-------LDAI
DNAG_LACLA        SALMETGRIQPIEFLIDYLRPENLANLQ---TQLDFIEQISPMIAKLP--------SITA
DNAG_THEMA        LKKMLKNSRSFEYFLVTAGEVFFDRNSP--AGVRSYLSFLKGWVQKMRR-----KGYLKH
DNAG_CLOAB        FMRLVENAVSIIDYRINRAFENVNLKDS--ESVIKYVKDISEIIEELD---------PVE
A0R7W2_PELPD      RSMTGLDYLKESGAEMSPIHKKLHRLERLERGLFYMAEKIPEVRGMIAK-----------
DNAG_BORBU        LQKILNNRCDAFEYLLDVYSNKYNLNKT--VDLNAMINLFLNLINLSK--------VDTQ
DNAG_TREPA        LRKSVERSTTDAQYLIRCARHEHSHLGA--DDTSRAVSFLFPYLSVLD--------SAIQ
M3MLR4_HELPX      NKRPNLSKINGFKFYCAYLLRAGLPTPQ----KDFNYKNILKILENFE---------PFT
E0TIT3_ZINIC      FKKKIENSISLFNLLINKIINNNNIRTL--QGRINILYNFKNIVNNIN--------EDFI
B3QZV5_PHYMT      QKFIIDNTEDFLDIKCEELSKKINYFSLDTVEKEKIKSELFSLFYKQN---------EKI
A6LBI6_PARD8      --LRRLVRTEAVDYLSHRIRKAAGRKGG---PDAGGIREVLGEIRLVG--------SPLA
E1X3Y2_HALMS      LQKRIDNAKAFIDVQIERAIPTKVPELL--DAQLQILNKVFAILSPLK--------DALA
DNAG_MYCPU        KELIEKNKKPAIDYLYEFLLTSKYNINN-SEHLISFVNDFAPLLSSQN--------NIVI
DNAG_UREPA        LDQQLHISEFLLLEISNTNKSTPSLKHSYKQECFTIIKKYGDIFYVDKYVDFMKQTFSIE
H6N6X3_MYCHN      -WKRLKEPSHFFEWYRKLYIQEKDISNPLVLQPLIEESLGFLFVSNASSPIMKGGVDREY
I7CGI8_MYCHA      PYIDWLKKNYSKVFSISEIQLDLLIVNQWVNDLISNLFESDKLVSSVNAKFALSAIEEIF
                                                                              

DNAG_HELPY        QSEYKPLIATLLQAPLHVLGIRE--RVSFQPFYPKTEKPN--------------------
DNAG_HELPJ        QNEYKPLIATLLQAPLHVLGIRE--PVSFQPFYPKTEKPN--------------------
DNAG_CAMJE        ANSYTSLVSNLLKVDEKFIVLSQNSKKTIQTPLISQNKYN--------------------
DNAG_CHLMU        IHEYLRQLASLVKVPEAAVLSYLSSIKSATEDKGKKADAKEVCPDPEATAVAY-------
DNAG_CHLTR        IHEYLRQLASLVKVPEPAVLSYLSSITSAAEDKGKKVSAKEPSSESKQTSTE--------
DNAG_CHLPN        VYEHLKQLASLMMVPEDMVLSLANPQVTAEP---QNIPIKQKVP----------------
DNAG_ECOLI        RIYLRQELGNKLGILDDSQLERLMPKAAESGVSRPV------------------------
DNAG_ECO57        RIYLRQELGNKLGILDDSQLERLMPKAAESGVSRPV------------------------
DNAG_SHIFL        RIYLRQELGNKLGILDDSQLERLMPKAAESGVSRPV------------------------
DNAG_ECOL6        RIYLRQELGNKLGILDDSQLERLMPKAAESGVSRPV------------------------
DNAG_SALTY        RIQLRQTLGLKLGIFDDSQLDRLVPKQAESGVSRPA------------------------
DNAG_HAEIN        RLSLRNMLAQKLGIFDQTQLENLIPKKLEQANTQQKVTH---------------------
DNAG_PASMU        RLSLRNTLAQKLGILDQAQLESLIPSYSEMKITASP------------------------
DNAG_BUCAI        RIYLRQILARMIGILDDNQFEKFLYEKETKNTQKTYF-----------------------
DNAG_BUCAP        RIYLRQILARTIGIVDDYQFEKFLYEKERKK-KSLQF-----------------------
DNAG_BUCBP        QTYLFQTLSKKIGILDYHVLINNNINNINTK-IYTKK-----------------------
DNAG_LEGPN        KQLLIDDLSRLTHI-ESHRLTNLITDKSESKPEVQA------------------------
DNAG_NEIMA        AYLLKQRLSELVGIDPDNLAQLLGQEAPKRHVKQ------------------------KN
DNAG_NEIMB        AYLLKQRLSELVGIDPDNLAQLLGQEAPKRHVKQ------------------------KN
DNAG_PSEPK        RQLMRNRLKEITGLDPQQVEQLAQQAPATSSMPDYDPGY----DYDAMASYTPDYGDMPQ
DNAG_PSEPU        RQLMRNRLKEITGLDPQQVEQLAQQAPATSSMPDYDPGY----DYDAMASYTPDYGDMPQ
DNAG_PSEAE        RLLMRQRLSEITGLSGENIGQLAHHSPPPSSMDHGASGVLDGDDYFAASAYYENEPSHAP
A4JW69_BURVG      GRAMKAKFEEVVGVALD-------------------------------------------
DNAG_MYXXA        RATLFSAVAEHFGWRPADVEAALRSKVPLPKPAGGDAPP---------------------
Q2IEJ9_ANADE      RALFEQRIARRLELYIIALRAELARGRG--RPAGGESWP---------------------
DNAG_SYNE7        AERLSQGEARTAVQLASDLRAQVR-GQR--WHGQASRWE---------------------
DNAG_SYNY3        GEILSQGDSRLISLQVNNLSSQLTYGDRPGKNGSRHWQA---------------------
DNAG_MYCTU        RDEYARQLAGWVGWADVAQVIGRVRGEAKRTKHPRLGRLGSTTIARA-AQRPTAGPPTEL
DNAG_MYCBO        RDEYARQLAGWVGWADVAQVIGRVRGEAKRTKHPRLGRLGSTTIARA-AQRPTAGPPTEL
DNAG_MYCLE        RDEYARRLAGWTGWSDEGQVLARVREEANRRSVPERTRRRSVSVEQSPFMQPPGAPADQL
DNAG_MYCS2        RDEYARQLAGWVGWDNVAQVIGRVREEAKGGGRKDNNRRGQETAARP---KPP------P
DNAG_STRCO        QHEVAVQLAGMLGILDTQFVVKRIAQLARWARDRGGKGPAPDQRQRGGGPQQQAGPMTAT
DNAG_GEOSE        QDYYLRQLAEEFSLSLSALHEQLSRSQRERTKPREAPDGE--------------------
DNAG_BACSU        QEVYVKQLASEFSLSQESLTEQLSVFSKQNKPADNSGETK--------------------
DNAG_BACHD        RDHYLRQLAEEFSLSLDALKQEQYRIYREMKRQNQVSQGK--------------------
DNAG_LISIN        RELYLKQLADEFELTIETLKQQLQQSLKNTHKERQNHSYNEPPIDDS-------------
DNAG_LISMO        RELYLKQLADEFELTIETLKQQLQQSLKNSQKSRQMASYNEPPIDDS-------------
DNAG_ENTFA        RDRYLNQIAQEFQLSVHSLEEQFNQLKQEQRSVQRQERQQ---FYQD-------------
DNAG_STAAM        QQKAINDVAPFFNVSPEQLANEIQFNQAPANYYPEDEYGG--------------------
DNAG_STAAN        QQKAINDVAPFFNVSPEQLANEIQFNQAPANYYPEDEYGG--------------------
DNAG_STAAU        QQKAINDVAPFFNVSPEQLANEIQFNQAPANYYPEDEYGG--------------------
DNAG_STAAS        QQKALNDVAPFFNVSPEQLANEIQFNQAPANYYPDDEYGG--------------------
DNAG_STAAW        QQKALNDVAPFFNVSPEQLANEIQFNQAPANYYPDDEYGG--------------------
DNAG_STAAC        QQKALNDVAPFFNVSPEQLANEIQFNQAPANYYPED------------------------
DNAG_STAAR        QQKALNDVAPFFNVSPEQLANEIQFNQAPANYYPED------------------------
DNAG_STAES        RNKLIQNIADIFKVNPE----TIQYELDATYQHQMSS-----------------------
DNAG_STAEQ        RNKLIQNIADIFKVNPE----TIQYELDATYQHQMSS-----------------------
DNAG_RICCN        KVSYYRFFKDQIWQNLVTTQKKATTKNSNLAPIISSH-----------------------
DNAG_RICFE        KASYYRFFKEQIWQNLVTKQKKATTKNSNLAPIISSH-----------------------
DNAG_RICPR        KASYYRFFKDQIWQNLVTKQKKIITPSSNSVLIASSH-----------------------
DNAG_RICTY        KASYYRFFKDQIWQNLVIKQKKIITQNFNSSLIASSH-----------------------
DNAG_RICBR        RASYYRFFKDQIWQNLVTKQQKTVAKNVNLLPLSS-------------------------
DNAG_MYCGE        LIFLIKNLVKLLEYSDEKTLYETV----LKHKEKLVSKFDN-------------------
DNAG_MYCPN        SRFLCQKLQQLLQYSDVETLFTQLQQQKLKVKVNKTTTFTQRAPIYE-------------
DNAG_AQUAE        ------EFHTKYKVPMEILLMKIEKNSQEKEIKLSFK-----------------------
DNAG_DEIRA        AQDMRGAACELLGIRPEALLDWITSKAKRRTLTDTHLAGMS-------------------
DNAG_LACLA        QDAYIRKLVEILPDFEYNQVEQAVNLRRENMTITDHPVSNLDASSLTESFTDEND-----
DNAG_THEMA        IENLVNEVSSSLQIPENQILNFFESDRSNTMPVHETK-----------------------
DNAG_CLOAB        KDVYIKKISDKTGIREQAIYDLISTDIQKSGNNIEKMNKNS-------------------
A0R7W2_PELPD      ----SGNLEELFSPDLLPAIHDVINTPPP-------------------------------
DNAG_BORBU        KKIFLDKLSNKLGIGVTTLLKDYYRIKERFVVDNNKR-----------------------
DNAG_TREPA        REQVMQDIAMAFGIRIQAVHADYLRYVSRTTQKGTTG-----------------------
M3MLR4_HELPX      QADLIKILNSFLVSKQVKPVKPKTTPGKLDLLEARVY-----------------------
E0TIT3_ZINIC      ILQIINLISKILNIKINYIIKFILKKKINYEKRKVYY-----------------------
B3QZV5_PHYMT      KIHYQSILNNKYNIKIKLFFDKNNNIQKSADIYKVKQLMT--------------------
A6LBI6_PARD8      VYQRVEELSKATGIPLDVLREELSASPGEPVRTGPAEVVT--------------------
E1X3Y2_HALMS      ATERAAQAAKTIGLKSEASQIISNYKDFLSGDQPPVQHFAPTPSEE--------------
DNAG_MYCPU        DKYENLLMKHSINIRKFLTYQNQKYDRINQYNSLQQRFYEE-------------------
DNAG_UREPA        ENLLKKVIEELLINKQCNSIQNKKNIQSYQKQTQLTNKLTTS------------------
H6N6X3_MYCHN      ALDSLKIIFDFYKLSSDFSNEKHSSIINKKYQSYKHAVTASL------------------
I7CGI8_MYCHA      KLYDLVDLSESEQKAIEEIKAEYLEKVKLGTISKKTKTGTVR------------------
                                                                              

DNAG_HELPY        ----------------------------------------------RPQRFAHVSSAPSL
DNAG_HELPJ        ----------------------------------------------RPQKFAHVSSMPSL
DNAG_CAMJE        ----------------------------------------------FPKEKIHIAELELI
DNAG_CHLMU        --------------------------------------------KGGKASKKISPRMILE
DNAG_CHLTR        ----------------------------------------------GKISKKISPRMILE
DNAG_CHLPN        ---------------------------------------------------KIHPHIVME
DNAG_ECOLI        ------------------------------------------------PQLKRTTMRILI
DNAG_ECO57        ------------------------------------------------PQLKRTTMRILI
DNAG_SHIFL        ------------------------------------------------PQLKRTTMRILI
DNAG_ECOL6        ------------------------------------------------PQLKRTTMRILI
DNAG_SALTY        ------------------------------------------------PQLKRTTMRILI
DNAG_HAEIN        ------------------------------------------------NKIKKTPMRMVI
DNAG_PASMU        ------------------------------------------------QPVKRTPMRVLI
DNAG_BUCAI        -------------------------------------------------QIKRTPMRTLI
DNAG_BUCAP        -------------------------------------------------QIKHTPMRTLI
DNAG_BUCBP        -------------------------------------------------PIKKTTIRIVI
DNAG_LEGPN        -------------------------------------------------AISRSPLRIAI
DNAG_NEIMA        YKLPPISVKQPVMPTL---------------------------VQRQIRSLLINPDWAAY
DNAG_NEIMB        YKLPPISVKQPVMLTL---------------------------VQRQIRSLLINPDWAAY
DNAG_PSEPK        HDYAPVHQEQAWKPNKGGSKKPWSDKPWDKNRKGGKPWQQRDEAPPRVPAPVEPPTLAAL
DNAG_PSEPU        HDYAPVHQEQAWKPNKGGSKKPWSDKPWDKNRKGGKPWQQRDEAPPRVPAPVEPPTLAAL
DNAG_PSEAE        FDAAPGYVEAQPRKSWNKDKKPWDGKKWDGKKKWDKGGRGDFKAPQRTPVSVESTTLNAL
A4JW69_BURVG      ------------------------------------------------------------
DNAG_MYXXA        --------------------------------------------SSP-NRPAPPLEKPPP
Q2IEJ9_ANADE      --------------------------------------------R---------------
DNAG_SYNE7        --------------------------------------------KPGDVSIREQAEAQIL
DNAG_SYNY3        --------------------------------------------KDPTSSLLEKAEALLL
DNAG_MYCTU        AVRP------------------------------------------DPRDPTLWPQREAL
DNAG_MYCBO        AVRP------------------------------------------DPRDPTLWPQREAL
DNAG_MYCLE        AARP------------------------------------------DPRDPTLWPQREAL
DNAG_MYCS2        VQRP------------------------------------------DPTDPTLWPQREAL
DNAG_STRCO        PRGPA----------------------------------------LNLRNPVFATERELL
DNAG_GEOSE        ----------------------------------------------TARPMLA------K
DNAG_BACSU        ----------------------------------------------TRRAHLTTKAR-QK
DNAG_BACHD        ----------------------------------------------TNTVRQKKHDFEQK
DNAG_LISIN        ----------------------------------------FMGMIPQEDSEMLFSFEQPT
DNAG_LISMO        ----------------------------------------FMGMMPQEGAEMLFSFEQPA
DNAG_ENTFA        ----------------------------------------EMMPPPMEEPVFEENHVQNK
DNAG_STAAM        ------------------------------------------YDEYGGYIEPEPIGMAQF
DNAG_STAAN        ------------------------------------------YDEYGGYIEPEPIGMAQF
DNAG_STAAU        ------------------------------------------YDEYGGYIEPEPIGMAQF
DNAG_STAAS        ------------------------------------------YDEYGGYIEPEPIGMAQF
DNAG_STAAW        ------------------------------------------YDEYGGYIEPEPIGMAQF
DNAG_STAAC        --------------------------------------------EYGGYIEPEPIGMAQF
DNAG_STAAR        --------------------------------------------EYGGYIEPEPIGMAQF
DNAG_STAES        -------------------------------------------NTYPTFQDEPSKQQLIL
DNAG_STAEQ        -------------------------------------------NTYPTFQDEPSKQQLIL
DNAG_RICCN        ---------------------------------------------GYSELEILEHAFCAL
DNAG_RICFE        ---------------------------------------------GYSELEMLEHAFCAL
DNAG_RICPR        ---------------------------------------------CYSELEMLEHAFCAL
DNAG_RICTY        ---------------------------------------------CYSELEMLEHAFCAL
DNAG_RICBR        ---------------------------------------------GYSELEILEHAFCAL
DNAG_MYCGE        ------------------------------------------NRFYINTSGHAQPPQELQ
DNAG_MYCPN        ------------------------------------------SVVGVVDNSFRNESQPVA
DNAG_AQUAE        -------------------------------------------------EKIFLKGLIEL
DNAG_DEIRA        -----------------------------------------------QSSGEEEHELALL
DNAG_LACLA        ------------------------YSSLESVMPVDFEEAYYENNVKTQQTYRRSESAQVV
DNAG_THEMA        ------------------------------------------------SSKVYDEGRGLA
DNAG_CLOAB        --------------------------------------------NYGQNLYVESAHVKSE
A0R7W2_PELPD      ------------------------------------------------------------
DNAG_BORBU        ------------------------------------------------------------
DNAG_TREPA        ------------------------------------------------NCVLSVQGTAIQ
M3MLR4_HELPX      ------------------------------------------------------------
E0TIT3_ZINIC      -------------------------------------------------VKNINKEIILL
B3QZV5_PHYMT      ------------------------------------------------TNFLLDVIFDRH
A6LBI6_PARD8      ----------------------------------------------GLPPARLRERALLR
E1X3Y2_HALMS      -----------------------------------TEGLITESFHEEIPYEELQYLSGEM
DNAG_MYCPU        ---------------------------------------------PKQKKKANSREEILK
DNAG_UREPA        ------------------------------------------NPKVILTKIDKHFNHLVV
H6N6X3_MYCHN      -----------------------------------------IRTLPTRHIPKQIRSIDKF
I7CGI8_MYCHA      -----------------------------------------KPKPISKTPKKDSIEAKYS
                                                                              

DNAG_HELPY        EFLEK---------------LVIRYLLEDRSLLDLAVGYIHSGVFLHKKQEFDALCQEKL
DNAG_HELPJ        EFLEK---------------LVIRYLLEDRSLLDLAVGYIHSGVFLHKKQEFDALCQEKL
DNAG_CAMJE        AFLKQHPDICNDFKQISDSVCFKHKILLDKILEKKGYEDSDIREFESKNIRKNLNYSEFL
DNAG_CHLMU        ADVIRCLLF--AKPEEEFVPATVRHYLSPEEFHCIEYRSIFVMAMNHYNEKHMLPSMDDM
DNAG_CHLTR        ADVIRCLLF--AKPEDEFVPATVKQYLSPEEFHCAEYRAIFVMAMNHYNDRQTLPSMDEM
DNAG_CHLPN        TDILRCMLF--CGS-NTKILYTAQFYFVPEDFKHPECRKLFAFMISYYEKYRKNVPFDEA
DNAG_ECOLI        GLLVQNPEL--ATLVPPLENLDENKLPGLGLFRELVNTCLSQPGLTTGQLLEHYRGTNNA
DNAG_ECO57        GLLVQNPEL--ATLVPPLENLDENKLPGLGLFRELVNTCLSQPGLTTGQLLEHYRGTNNA
DNAG_SHIFL        GLLVQNPEL--ATLVPPLENLDENKLPGLGLFRELVNTCLSQPGLTTGQLLEHYRGTNNA
DNAG_ECOL6        GLLVQNPEL--ATLVPPLENLDENKLPGLGLFRELVNTCLSQPGLTTGQLLEHYRGTNNA
DNAG_SALTY        GLLVQNPDL--APLVPPLDALDQNKLPGLGLFKELVKTCLAQPGLTTGQLLELYRGTNDA
DNAG_HAEIN        SLLMQNPEL--VKRMSESGVQALRAEAGFEILEKLTALCRQREGITTGQILEYFRNTSYS
DNAG_PASMU        GLLLQNPEL--AQLVPDLSPLRTLNEPGLDLLEKLTALCQEKVGITTGQILEYWRDTEHS
DNAG_BUCAI        GLLVQNPSL--AKLVPVTMKFKNLQIKGLSIFLEILQTCRDNPNIHTGQLLELYRNTTII
DNAG_BUCAP        GLLIQNPNL--ARLVPSTKKFENEKIQGLPIFLEILKTCSDNPNFNTGQLLEFYRYSKII
DNAG_BUCBP        ALLIQNPWL--ALTLPSLKHLQNYKIIGLSCFLDLVEKCISMPNSNTGQILEKYRNKNIF
DNAG_LEGPN        ALLLQNPEI--YSIAIQQINPALLHEQEHHILLKLLQQLKDKPNANTATLIEFWRNSSYF
DNAG_NEIMA        IDLPDYLAL--DGDFACLANLAETIKNHPSVPATAQVLEHMRGSPYEETINRIFRSALQS
DNAG_NEIMB        IDLPDYLAL--DGDFACLANLAESIKNHAAVPETAQVLEYMRGSPYEETITRIFHSTHQS
DNAG_PSEPK        RTLLHHPLL--AGKVEDASHFADEEHLYSQLLVALIEAAQKNPGLSSMQLIARWHGTEQG
DNAG_PSEPU        RTLLHHPLL--AGKVEDASHFADEEHLYSQLLVALIEAAQKNPGLSSMQLIARWHGTEQG
DNAG_PSEAE        RTLLHHPQL--ALKVDDAGTLAREQDTYAQLLVSLLEALQKNPRQSSMQLIARWHGTPQG
A4JW69_BURVG      ------------------------------------------------------------
DNAG_MYXXA        ALECFYVGA--VLKEPRLMARDTFRVCDELSHMGLRMALAHATSGHGANDALFESSEAVK
Q2IEJ9_ANADE      ------------------------------------------------------------
DNAG_SYNE7        KVYLHCPRL--RLAVRKTLHDREIQGFSLQPHRLLWQAIAEIEEAHLGFAAMYQVERGEG
DNAG_SYNY3        KIYLHCPQE--RPTIDQILTENDLL-FSFAHHRLLWQKIDQVRE-------YFNLDSDPD
DNAG_MYCTU        KSALQYPAL--AGPVFDALTVEGFTHPEYAAVRAAIDTAGGTSAGLSGAQ-WLDMVRQQT
DNAG_MYCBO        KSALQYPAL--AGPVFDALTVEGFTHPEYAAVRAAIDTAGGTSAGLSGAQ-WLDMVRQQT
DNAG_MYCLE        KSVLQYPVL--AGPVFDTLTVESFTHPGYGAVRAAIDAAGGASAGITGAQ-WIDVVRQQT
DNAG_MYCS2        KAGLQYPAL--AGPVFDTLTVESFTHPGYGAVRTAMEAAGGTSAGITGAQ-WIETVREQT
DNAG_STRCO        KLALQRPEL--VSPAFDAYGVDEFTAPPYAAVREAIMEAGGAEFGVQDPQDYLVRVREAA
DNAG_GEOSE        KLLPAFQNA--ERLLLAHMMRSRDVALVVQERIGG-RFNIEEHRALAAYIYAFYEEGHEA
DNAG_BACSU        RLRPAYENA--ERLLLAHMLRDRSVIKKVIDRVGF-QFNIDEHRALAAYLYAFYEEGAEL
DNAG_BACHD        RLLPAYQNA--ERILLAHMMRNVSVAETVQERLGG-RFNVDHYQAIVAHLFAYYAEGFEP
DNAG_LISIN        KKLSAHTTA--EQQLMKAMMENRDSFLLIKQLLGDTEFYHDNYQALYTYLIGYFAEGNDA
DNAG_LISMO        QKLSAHTIS--EQQLMKAMMESRDNFLLIKQLLGDTTFYHDNYEALYTYLIGYFAEGNDA
DNAG_ENTFA        LPLTQVQKA--ERSLLFRLMNEQGVRQTIQQLPDF-SFAHDEYQELYFLLESYATLHQSF
DNAG_STAAM        DNLSRQEKA--ERAFLKHLMRDKDTFLNYYESVDKDNFTNQHFKYVFEVLHDFYAENDQY
DNAG_STAAN        DNLSRQEKA--ERAFLKHLMRDKDTFLNYYESVDKDNFTNQHFKYVFEVLHDFYAENDQY
DNAG_STAAU        DNLSRREKA--ERAFLKHLMRDKDTFLNYYESVDKDNFTNQHFKYVFEVLHDFYAENDQY
DNAG_STAAS        DNLSRQEKA--ERAFLKHLMRDKDTFLNYYESVDKDNFTNQHFKYVFEVLHDFYAENDQY
DNAG_STAAW        DNLSRQEKA--ERAFLKHLMRDKDTFLNYYESVDKDNFTNQHFKYVFEVLHDFYAENDQY
DNAG_STAAC        DNLSRQEKA--ERAFLKHLMRDKDTFLNYYESVDKDNFTNQHFKYVFEVLHDFYAENDQY
DNAG_STAAR        DNLSRQEKA--ERAFLKHLMRDKDTFLNYYESVDKDNFTNQHFKYVFEVLHDFYAENDQY
DNAG_STAES        GRLTKNEKA--ERALIKHLTKDKDTFLNYYQKIVPEDFTNSYLKRIFSYLYDYYSKNDYY
DNAG_STAEQ        GRLTKNEKA--ERALIKHLTKDKDTFLNYYQKIVPEDFTNSYLKRIFSYLYDYYSKNDYY
DNAG_RICCN        LVKFPIILE--EKDIRDFILNLNFNNKSLEEFRNWYLNEIIDNNVEASEITAIVEKTSFF
DNAG_RICFE        LVKFPIILE--EKDIRDFILNLNFNNKSLEEFRNWYLNEIIDNNVEASEITAIVEKTSFF
DNAG_RICPR        LIKFPIMFA--EKDIRDFILNLNFNNKSLEEFRNWYLNEIIDNKVKENEITAIVEKTSFF
DNAG_RICTY        LIKFPIMLA--EKDIRDFILNLNFNNKSLEEFRNWYLNEIIDNKVEESEITAIVEKTSFF
DNAG_RICBR        LIKFPQILQ--EFEIKEFILNLNFSNKLLEEFRNWYLSEVIDNAVEAGEIAAIVEKTSFF
DNAG_MYCGE        KTTAALVQTAFEEAVNELWKPEIFAFALIDKRFLVELKQSHLDEVFKECNFNLFDVELFI
DNAG_MYCPN        ITKEFLVENNWKETKERVFHAEIFAYVLLDKQFLVELKQSDLDELFASLQTPLFDVALFI
DNAG_AQUAE        KPKIDLEVLNLSPELKELAVNALNGEEHLLPKEVLEYQVDNLEKLFNNILRDLQKSGKKR
DNAG_DEIRA        RQLLVDPSLLAKLDGSLPWRNEAVRKVMLAAQGARSPDDILDIFRGQPEEQLLIRLMFEG
DNAG_LACLA        QPSVQVPKLSRSEKAEEMLLHRMIYHSSVLKKFSQDENFRFVHKRYQDLFDKILLEAMVY
DNAG_THEMA        YLFLNYEDL-----REKILELDLEVLEDKNAREFFKRVSLGEDLNKVIENFPKELKDWIF
DNAG_CLOAB        RYLLRLMIEHKDIRSYIESKISADDLIMESHKKIYNIILNFEDNLSSDLKSKFGFIESRC
A0R7W2_PELPD      ---------------PFSPRVQRMIETLVRVKASLELGNTAEPTVRSAMLLDVGEALSLI
DNAG_BORBU        -------------NLYAHNDDSYERYLIVALLKNFSYFSIVRRNIIDSDLINVDARKVFM
DNAG_TREPA        VKEPATGVRTAQLRLVLAVVANPELFELLRESVCADDFEDPMAKELFIILEECYRADTRA
M3MLR4_HELPX      ------------------ATMLESEEFRYIARRYLTPSDVTYPVFFKRLVSGDFRGLDFL
E0TIT3_ZINIC      YNIIKFPFLIKKINLNILYYIKNRNRIIYIILKKIKKIYYFVKFKNFLNIINFFRKKNNI
B3QZV5_PHYMT      YLYINWDRLS-KDEKFSNFQQKSPDVLSINDLIYYYYVFLFKEIKKYYDSHPQENSITIK
A6LBI6_PARD8      FCLANHDRMFYAGDGSGISLPAWVASELSAGGMPLTEPAHLDLLALLSGSGHPDGITDES
E1X3Y2_HALMS      ELVDSPSLSKIETTFLSEIIKHPECLTSDKIGELLDFVTSNEVQNYFTRLRELFYEIDES
DNAG_MYCPU        KQYQNLYVKLLLSLLNSNALLEYFLRHNIEERIIFEQTNNGQESKLKDILRKIIKIQKEK
DNAG_UREPA        IILMNRVFLNRLDTQVRNRLTKEQSLVINIIEDFYLYHFKINNILKNTDSFIEFINKNYS
H6N6X3_MYCHN      QSLLTKYSKIFKYIENNGESLGDANEWFFEIPEEYVSVSREAKLFFSLLSKRLFGGDSSQ
I7CGI8_MYCHA      RLRALIEKIKGDEVYLRVLQLSLPGWSCHYIASFLEKFQWTLTEEDKSFLVQIVSDIEEM
                                                                              

DNAG_HELPY        DDPKLVALLLDAN---------LPLKKGG----------FEKELRLLILRYFERQLKEIP
DNAG_HELPJ        DDPKLVALLLDAN---------LPLKKGG----------FEKELRLLILRYFERQLKEIP
DNAG_CAMJE        LGICKVNLAFLNN---------VKIKNSTLALKKQLFTLIDKNLNLLIKNLNTAELNNFL
DNAG_CHLMU        MALVWGTEAMTLL---------VDRRINTELM--------RDIVVQAIQKLLDKHWRDRK
DNAG_CHLTR        MSLVVGTEAMTLL---------VARRMNTELM--------RDIVVQSIQKLLDKHWRDKK
DNAG_CHLPN        CQVLSDSQILQLL---------TKRRLNTEAL--------DTIFVQSLQKMADRRWREQC
DNAG_ECOLI        ATLEKLSMWDDIA---------DKNIAEQTFT---------DSLNHMFDSLLELRQEELI
DNAG_ECO57        ATLEKLSMWDDIA---------DKNIAEQTFT---------DSLNHMFDSLLELRQEELI
DNAG_SHIFL        ATLEKLSMWDDIA---------DKNIAEQTFT---------DSLNHMFDSLLELRQEELI
DNAG_ECOL6        ATLEKLSMWDDIA---------DKNIAEQTFT---------DSLNHMFDSLLELRQEELI
DNAG_SALTY        ATLEKLSMWDDIA---------DKAIAEKTFT---------DSLNHMFDSLLQLRQEELI
DNAG_HAEIN        NPLEILATWDHLL---------DESDIINAFS---------QNYRRLNIQAIERDIEMLI
DNAG_PASMU        KALEILASWNHLV---------EDTQIEETFK---------STLRYLYFQLIEHEIDLLI
DNAG_BUCAI        NVLKILARWDHMI---------IQKETQNMFL---------DLLMNIHDKILEKRREYLI
DNAG_BUCAP        NILKILSKWDHMI---------IKEKIQNMFL---------DLLKNTYSKILEKRQEKLI
DNAG_BUCBP        KHLANLAKWDHMI---------HNEKIKDFFL---------DSLTKICDIILEDRQNKLI
DNAG_LEGPN        ELIVKLAAWDHQV---------PEQELTKEFI---------DVLLFLQKQNREILIRQYI
DNAG_NEIMA        EEMEGGGEED-----------------CENFQ---------IGIKKLLNELKYSQIEALK
DNAG_NEIMB        EEMNSSSEED-----------------CENFQ---------IGMKKLLNELKYSQIETLK
DNAG_PSEPK        RLLRALAEKEWLI---------VADNLEQQFF---------DTITSLSARQRERSLEQLL
DNAG_PSEPU        RLLRALAEKEWLI---------VADNLEQQFF---------DTITSLSARQRERSLEQLL
DNAG_PSEAE        RLLQALGEKEWLI---------VQENLEKQFF---------DTITKLSESQRFGEREERL
A4JW69_BURVG      ------------------------------------------------------------
DNAG_MYXXA        RGIESALRQLPSE---------PVPLEAAFLS---------ICREIMVRRIDERLVYIKR
Q2IEJ9_ANADE      ------------------------------------------------------------
DNAG_SYNE7        NGDDLAAIDLVPI---------LRDRLDQLTG---------VSLGGFLELSENDHADLTH
DNAG_SYNY3        N-----QLPLLVQ---------LAYLEQEGDF---------NSVESLFQLTETSAEDLFR
DNAG_MYCTU        TSTVTSALISELG---------VEAIQVDDD---KLPRYIAGVLARLQEVWLGRQIAEVK
DNAG_MYCBO        TSTVTSALISELG---------VEAIQVDDD---KLPRYIAGVLARLQEVWLGRQIAEVK
DNAG_MYCLE        TSALIAGLINELG---------VESIQVDDE---KLPRYIDGVLARLQEVWMGRQIAEVK
DNAG_MYCS2        TSPAAANLVNELS---------VETINVEDDE--KLPRYISSVLARLQEVWVGRQIAEVK
DNAG_STRCO        PDDTVRAMVTELA---------VEAIMLHRGVKGVDEVYAGAQLVTVRRRAVERRIRDIT
DNAG_GEOSE        DPGALISRIPGE----------LQPLASDVSLLLIADDVSEQELEDYIRHVLNRPKWLML
DNAG_BACSU        TPQHLMARVTDDH---------ISQLLSDILMLQVNQELSEAELSDYVKKVLNQRNWSMI
DNAG_BACHD        DPCTFIQRLEDQE---------LIRVATELAMLEINEEINDQELNDYIEKIEMYPKWLEL
DNAG_LISIN        DPHKFMDSVPDAG---------MKGLISSLEMVISPDEQGKTQFEDYIKSLKRFKLEQAK
DNAG_LISMO        DPTKFMDSVPDAA---------MKGLISSLEMVISPDEQGKPQFEDYIRSLKRYKLEQKK
DNAG_ENTFA        DIADFINFLQDNQ---------TKQLAIEIAYQNLSEESSEREVADLLHVIALSSIAEAI
DNAG_STAAM        NISDAVQYVNSNE---------LRETLISLEQYNLNDEPYENEIDDYVNVINEKGQE-TI
DNAG_STAAN        NISDAVQYVNSNE---------LRETLISLEQYNLNDEPYENEIDDYVNVINEKGQE-TI
DNAG_STAAU        NISDAVQYVNSNE---------LRETLISLEQYNLNGEPYENEIDDYVNVINEKGQE-TI
DNAG_STAAS        NISDAVQYVNSNE---------LRETLISLEQYNLNDEPYENEIDDYVNVINEKGQE-TI
DNAG_STAAW        NISDAVQYVNSNE---------LRETLISLEQYNLNDEPYENEIDDYVNVINEKGQE-TI
DNAG_STAAC        NISDAVQYVNSNE---------LRETLISLEQYNLNDEPYENEIDDYVNVINEKGQE-TI
DNAG_STAAR        NISDAVQYVNSNE---------LRETLISLEQYSLNDEPYENEIDDYVNVINENGQE-TI
DNAG_STAES        TISDMMQYIESNE---------LREVLIELDQYHLNDEPYENEIEDYIQIIKNNNNEDSL
DNAG_STAEQ        TISDMMQYIESNE---------LREVLIELDQYHLNDEPYENEIEDYIQIIKNNNNEDSL
DNAG_RICCN        DIFLLLSKTDNLF---------LDISFNKNNIRLDLLWQWLHKKYYLINLQQEYAITINS
DNAG_RICFE        DIFLLLSKTDNLF---------LDISFNKNNIRLDLLWQWLHKKYYLINLQQEYSITINS
DNAG_RICPR        DIFLLLSKADNLF---------LDISFNKNNIRLDLLWQWLYKKYYLINLQQEYAISINS
DNAG_RICTY        DIFLLLSKADNLF---------LDISFNKNNIRLDLLWQWLYKKYYLINLQQEYAISING
DNAG_RICBR        DIFLLLSEADNLF---------LDIAFNKDNVRLDLLWQWLYKRYYLLNLQQEYAHITKE
DNAG_MYCGE        EKARIYWSENQTA---------NWVGFESVLD----------QNYLLNNKARLLEIKDIF
DNAG_MYCPN        DKARLYWAKVQEP---------DWAVFNSILG----------EQQAMFPTTFLAQIKEFF
DNAG_AQUAE        KKRGLKNVNT--------------------------------------------------
DNAG_DEIRA        RDSGSLSRASSQE---------YEQKVTTYAA------HAVDDIQVTLNIDALKTEVDLL
DNAG_LACLA        EQIDESHLASELSD-------EERSLFYQIISLDLPDTASSQEIKDLVSIFSNEMEQIKF
DNAG_THEMA        ETIESIPPPKDPE----------------------------KFLGDLSEKLKIRRIERRI
DNAG_CLOAB        DDGESSSEIVKIE---------EQNIMLSENN-------VKDLVDDFITNIKKFRLEESK
A0R7W2_PELPD      G-----------------------------------------------------------
DNAG_BORBU        CFENLFENNKDFS-----------------------------LMDLKKNLKDTYKVSEFF
DNAG_TREPA        SPHVLSCCTTDELR-------KLVSEAIVCGEFSCNAPQIVRDGVALVRRNRLLKERESL
M3MLR4_HELPX      KKFKAIPESYQKN-----------------------------ALVELKTKGLKHSLALAL
E0TIT3_ZINIC      FNEFSYKKLKKNN----------------------------IDFNYLLNKIKLEIIKNKI
B3QZV5_PHYMT      NIDDFFKLYPQAS----------------------------CFIIDLKNKIKIKEINNSI
A6LBI6_PARD8      LSALILSLRSSYP----------EEGPPERLPDELLPDEAERQLFLYAEPFIHDRLQRTA
E1X3Y2_HALMS      EFVAIVSNFTNNGTFSSELKEVIASALKNYRAISHDDKAISKIIFDVRKKLELTKLDIEC
DNAG_MYCPU        KSETTIEDLPLEDQ-------EILRWYLQKDSWFKSDYAKEGDLDLLANQISESYLEYEK
DNAG_UREPA        KYTNVINQLTKMVQIIKYNPKFDNIVAFELAKNNFIYEWLNNQIKRLKLINLNLNMNNNQ
H6N6X3_MYCHN      EEIDNLANLIQEK---------DKDIPSIEEFFNCYFSLNEGIMEEIRNMWKKNELLDVT
I7CGI8_MYCHA      SEGQEISYLSSEG---------MSTAKQLFEFLELYYSLTHQLMTQAEELVKSGPTVSFS
                                                                              

DNAG_HELPY        KSSLPFSEKMICLKKARQAIMKLK----QGELVAI-------------------------
DNAG_HELPJ        KSPLSFSEKMIFLKRARQAIMKLK----QGELVAI-------------------------
DNAG_CAMJE        KEYLSFLKYEKNEEILQQSFRNLNGIFGNKNFTAYDLGFSIQNNDEPF------------
DNAG_CHLMU        RNFC---HQMGKELDSLQEYVRLSEERIKVSLVS--------------------------
DNAG_CHLTR        RKLC---HQTGKGLDSLQEYVRLSGERVKVSLVS--------------------------
DNAG_CHLPN        KPLSLNQNIQDKKLEILEDYVQLRKDRTIITLLDPESELIP-------------------
DNAG_ECOLI        ARERT---HGLSNEERLELWTLNQELAKK-------------------------------
DNAG_ECO57        ARERT---HGLSNEERLELWTLNQELAKK-------------------------------
DNAG_SHIFL        ARERT---HGLSNEERLELWTLNQELAKK-------------------------------
DNAG_ECOL6        ARERT---HGLSNEERLELWTLNQELAKK-------------------------------
DNAG_SALTY        ARDRT---HGLSSEERRELWTLNQELARK-------------------------------
DNAG_HAEIN        AKERT---EGLTNEEKTVLVHLLAGKEQQKKQLVNPL-----------------------
DNAG_PASMU        AKDRS---EGLNMNERKKLTQLLVKKQQKA------------------------------
DNAG_BUCAI        AKERK---KGLQMNEKKEIWSINKKLSKR-------------------------------
DNAG_BUCAP        AKERI---QGLTIDEKKEIWSINKKLSKK-------------------------------
DNAG_BUCBP        SQERL---NGLNKQEKYELWSINKELAKK-------------------------------
DNAG_LEGPN        EKSRK---TGLTEAERLSLQNLLKERHGQAEIEK--------------------------
DNAG_NEIMA        QKSLQ---SGLNESEKKLLLSLLTAKQN--------------------------------
DNAG_NEIMB        QKSLQ---SGLNESEKKLLLSLLTAKQN--------------------------------
DNAG_PSEPK        RKSRQ---SELTSEEKTQLLALLSRNVPAQTPTSSGA-----------------------
DNAG_PSEPU        RKSRQ---SELTSEEKTQLLALLSRNVPAQTPTSSGA-----------------------
DNAG_PSEAE        RSVMQKSYSELTDEEKALLREHYS--VAASSPSQS-------------------------
A4JW69_BURVG      ------------------------------------------------------------
DNAG_MYXXA        ATEQTPGAFDLTEETRQLLVERVELLALKKRVLEE-------------------------
Q2IEJ9_ANADE      ------------------------------------------------------------
DNAG_SYNE7        PLPLLRGAVALVERLRCEKRCRHLLDSWARQSIHTFEHCIEQLLQAGIGEDVDAEAQITA
DNAG_SYNY3        ANLRIPEAIAIMEKVPWESYQKHCFGKLQQLDPRT-------------------------
DNAG_MYCTU        SKLQRMSPIEQGDEYHALFGDLVAMEAYRRSLLEQASGDDLTA-----------------
DNAG_MYCBO        SKLQRMSPIEQGDEYHALFGDLVAMEAYRRSLLEQASGDDLTA-----------------
DNAG_MYCLE        SKLQRMSPIDQGDEYHELFGDLVAMEAYRRSLLEQASGDDMTA-----------------
DNAG_MYCS2        SKLQRMSPVEQGDEYHALFGDLVAMESYRRSLLEQASGDDLTA-----------------
DNAG_STRCO        GRLTRLSGHGDPAELAAVQNELWILQQYDQNLREHGAAAL--------------------
DNAG_GEOSE        KVKEQEKTEAERRKDFLTAARIAKEMIEMKKMLSSS------------------------
DNAG_BACSU        KEKEAERAEAERQKDFLRAASLAQEIVTLNRSLK--------------------------
DNAG_BACHD        QQIE---SALKKETDPVLYATRKQELINMKKQLKL-------------------------
DNAG_LISIN        KELEQQLAAFNRENDKENEIRVMLEIVQLNRKLNSGQLD---------------------
DNAG_LISMO        KELEQELATYNRENDNENEIRVMLEIVQLNRQLNSGQLD---------------------
DNAG_ENTFA        EQKKIQQQEAKRVGNQQLEAELTMEIIQLARQLKAQRTFT--------------------
DNAG_STAAM        ESLNHKLREATRIGDVELQKYYLQQIVAKNKERM--------------------------
DNAG_STAAN        ESLNHKLREATRIGDVELQKYYLQQIVAKNKERM--------------------------
DNAG_STAAU        ESLNHKLREATRIGDVELQKYYLQQIVAKNKERM--------------------------
DNAG_STAAS        ESLNHKLREATRIGDVELQKYYLQQIVAKNKERM--------------------------
DNAG_STAAW        ESLNHKLREATRIGDVELQKYYLQQIVAKNKERM--------------------------
DNAG_STAAC        ESLNHKLREATRIGDVELQKYYLQQIVAKNKERM--------------------------
DNAG_STAAR        ESLNHKLREATRIGDVELQKYYLQQIVAKNKERM--------------------------
DNAG_STAES        ESLNYKLREASRIGDSELQKYYLQLIVNKNKNRM--------------------------
DNAG_STAEQ        ESLNYKLREASRIGDSELQKYYLQLIVNKNKNRM--------------------------
DNAG_RICCN        T---DNHDFEKVLLYKKEILKIANELQVLNESFINHTIT---------------------
DNAG_RICFE        T---DNHDFEKVLLYKKEILKIANELQVLNESFINHTIT---------------------
DNAG_RICPR        -----NHDFEKVLLYKKEIIKIVNELQVLNESFINQTIT---------------------
DNAG_RICTY        -----NHDFEKVLLYKKEILKIVNELQVLNESFINQTIT---------------------
DNAG_RICBR        YVITNIDDYEKVLFYKKEILKIASELQDLNESFINHIIDNSK------------------
DNAG_MYCGE        LDELTCYQANDFQNYLKTFQTLLKQQKQRLKNLKLTL-----------------------
DNAG_MYCPN        LNKSLSYDPEDYEEDLQFFRQLIVKQKELLKYFKSMVEH---------------------
DNAG_AQUAE        ------------------------------------------------------------
DNAG_DEIRA        KKQLLSTPPAEQLALLSQIQELQRAIEAEKRARRGS------------------------
DNAG_LACLA        EELIQQLATAEKAGNKERVLELTLQIINQKKKL---------------------------
DNAG_THEMA        AEIDDMIKKASNDEERRLLLSMKVDLLRKIKRR---------------------------
DNAG_CLOAB        KKIMSEIKGLEEKGLFDETIELIKRMEEIQNQLDNL------------------------
A0R7W2_PELPD      ------------------------------------------------------------
DNAG_BORBU        LKKF--------------------------------------------------------
DNAG_TREPA        VGRLRRFGDASSGEECGSMQELMMEKQRVDEELERLKGVRK-------------------
M3MLR4_HELPX      ESKDYALAEALNAKIKELQAQV--------------------------------------
E0TIT3_ZINIC      YKYYNNKIINKKKYKNLFKKWILLKKK---------------------------------
B3QZV5_PHYMT      YKYKLKMKNEKKENKKKEILNKVLKLQLQLNNFKLYKD----------------------
A6LBI6_PARD8      AHLRSATSTDERATCLKELRDCFALSDRIGRALGSQSVRRVEG-----------------
E1X3Y2_HALMS      DELSLKQKSCTTDEENNKLMSELLAKKQERAKVKALKYKTPGGK----------------
DNAG_MYCPU        SQKISKTLEMPSLDEEKQKILKRVILQRRSKND---------------------------
DNAG_UREPA        EQIINNEKLIKQYNDEKILLDNLINASLFHKNQ---------------------------
H6N6X3_MYCHN      ERWIKTEALKKLILDNKQKSSAFFRKFCLSKKNRN-------------------------
I7CGI8_MYCHA      ERMAQLDQLSRDREELNKQSANVFKQLVNFESNYANSK----------------------
                                                                              

DNAG_HELPY        ----------------------------------------------------------
DNAG_HELPJ        ----------------------------------------------------------
DNAG_CAMJE        ----------------------------------------------------------
DNAG_CHLMU        ----------------------------------------------------------
DNAG_CHLTR        ----------------------------------------------------------
DNAG_CHLPN        ----------------------------------------------------------
DNAG_ECOLI        ----------------------------------------------------------
DNAG_ECO57        ----------------------------------------------------------
DNAG_SHIFL        ----------------------------------------------------------
DNAG_ECOL6        ----------------------------------------------------------
DNAG_SALTY        ----------------------------------------------------------
DNAG_HAEIN        ----------------------------------------------------------
DNAG_PASMU        ----------------------------------------------------------
DNAG_BUCAI        ----------------------------------------------------------
DNAG_BUCAP        ----------------------------------------------------------
DNAG_BUCBP        ----------------------------------------------------------
DNAG_LEGPN        ----------------------------------------------------------
DNAG_NEIMA        ----------------------------------------------------------
DNAG_NEIMB        ----------------------------------------------------------
DNAG_PSEPK        ----------------------------------------------------------
DNAG_PSEPU        ----------------------------------------------------------
DNAG_PSEAE        ----------------------------------------------------------
A4JW69_BURVG      ----------------------------------------------------------
DNAG_MYXXA        -----------LKPASSGTKAPMQPV--------------------------------
Q2IEJ9_ANADE      ----------------------------------------------------------
DNAG_SYNE7        LHEQLNQEALHFQKLYYNERRYLQQLDQERCLNPQAFLGMTEHDATAIAPTTPQPISA
DNAG_SYNY3        ----QAEDFRYYQEQWQKAHQEIQRLESQRLNQPLN----------------------
DNAG_MYCTU        ----------------------------------------------------------
DNAG_MYCBO        ----------------------------------------------------------
DNAG_MYCLE        ----------------------------------------------------------
DNAG_MYCS2        ----------------------------------------------------------
DNAG_STRCO        ----------------------------------------------------------
DNAG_GEOSE        ----------------------------------------------------------
DNAG_BACSU        ----------------------------------------------------------
DNAG_BACHD        ----------------------------------------------------------
DNAG_LISIN        ----------------------------------------------------------
DNAG_LISMO        ----------------------------------------------------------
DNAG_ENTFA        ----------------------------------------------------------
DNAG_STAAM        ----------------------------------------------------------
DNAG_STAAN        ----------------------------------------------------------
DNAG_STAAU        ----------------------------------------------------------
DNAG_STAAS        ----------------------------------------------------------
DNAG_STAAW        ----------------------------------------------------------
DNAG_STAAC        ----------------------------------------------------------
DNAG_STAAR        ----------------------------------------------------------
DNAG_STAES        ----------------------------------------------------------
DNAG_STAEQ        ----------------------------------------------------------
DNAG_RICCN        ----------------------------------------------------------
DNAG_RICFE        ----------------------------------------------------------
DNAG_RICPR        ----------------------------------------------------------
DNAG_RICTY        ----------------------------------------------------------
DNAG_RICBR        ----------------------------------------------------------
DNAG_MYCGE        ----------------------------------------------------------
DNAG_MYCPN        ----------------------------------------------------------
DNAG_AQUAE        ----------------------------------------------------------
DNAG_DEIRA        ----------------------------------------------------------
DNAG_LACLA        ----------------------------------------------------------
DNAG_THEMA        ----------------------------------------------------------
DNAG_CLOAB        ----------------------------------------------------------
A0R7W2_PELPD      ----------------------------------------------------------
DNAG_BORBU        ----------------------------------------------------------
DNAG_TREPA        ----------------------------------------------------------
M3MLR4_HELPX      ----------------------------------------------------------
E0TIT3_ZINIC      ----------------------------------------------------------
B3QZV5_PHYMT      ----------------------------------------------------------
A6LBI6_PARD8      ----------------------------------------------------------
E1X3Y2_HALMS      ----------------------------------------------------------
DNAG_MYCPU        ----------------------------------------------------------
DNAG_UREPA        ----------------------------------------------------------
H6N6X3_MYCHN      ----------------------------------------------------------
I7CGI8_MYCHA      ----------------------------------------------------------