CLUSTAL format seed alignment for MF_00978

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

B7JH22_BACC0          ------------------------MQSTIRKQLLQVFSEADGEFVSGQTISDKLGCSRTA
Q813S9_BACCR          ---------------------------------MQVFSEADGEFVSGQTISDKLGCSRTA
BIRA_BACSU            ------------------------MRSTLRKDLIELFSQAGNEFISGQKISDALGCSRTA
Q8Y5Z9_LISMO          -------------------------MKNNREKLLALFTESDGTYLSGQEIADSLGCSRTA
Q2G258_STAA8          -------------------------MSKYSQDVLQLLYKNKPNYISGQSIAESLNISRTA
Q8TSW9_METAC          -------------------------MGDKRSRIIKALKDAQKTPVSGEDLGLKLGISRTM
A5I0V9_CLOBH          ----------------------------MKEAIVNILKNSSHTFISGQYISDKLGVSRTA
Q2FUL7_METHJ          -------------------------MYTQAFKVLEILERS-DKPVETSEIAEALSLSKSA
A9A3E8_NITMS          -------------------MIYNSFDNPGLVKVLTFLQTHNTEYLSGQDLSDVLRISRVA
A0RX93_CENSY          -------------------MICTARSR-GFVRVLDILKRAGGRYVSGPSMAAELGISRVA
Q8KGB5_CHLTE          -------------------------MNPVTATILQRLAGD-GGFVSGGDLCNELQISRSA
Q728P6_DESVH          --------------------MDDRGRNGTRRRVLERLFEA-DGWCSGEELSRELGVSRAA
A1S0A5_THEPD          -----------------------MDGKELRRRVLEVLARR-GGYVRGGELAEKLGVSKVA
Q74BU1_GEOSL          ------------MSGERPRPAEATERDMD-RKILELFRSRSGGVVSGEALSTLLGVSRTA
Q1IVG0_KORVE          MTDFPTDNAGIARSGQNRDAMEGTLTDERLGHLVRLLGDHPTVVMSGTKIADELGVSRSE
D1B9U2_THEAS          --------------------MGEHVRLDNRVMALKMLFDNLGKLTPSSAIAGELGVTRQG
D4GTB0_HALVD          ----------------------------MSDTRRTLLDALAAGPVSGPDLADRLGVSRAA
Q5SLR8_THET8          --------------------------------MPGLLDLLTESWQSGEALAERLGVSRAA
Q82Z38_ENTFA          --------------------------MSTKSQVLTLLMKQTPAFLSGEEMAQRLSLSRTA
Q8DNH7_STRR6          --------------------------MKSYQAVYQILSKET-DYISGEKIAEKLSLSRTS
F9UTT9_LACPL          --------------------------MTTKEQVLTILLRHHGEWQSGDQLAQSVGCSRES
Q9CEQ6_LACLA          -------------------------MRTTKQFVLLKLLQQKGNWVSGDELAEELKLSRES
F9UM67_LACPL          --------------------------MANQVAVLRLLIQAAPAYCSGDWLAQRLAISRTA
Q32AE9_SHIDS          ------------------------MKDNTV-PLKLIALLANGEFHSGEQLGETLGMSRAA
BIRA_ECOLI            ------------------------MKDNTV-PLKLIALLANGEFHSGEQLGETLGMSRAA
BIRA_SALTY            ------------------------MKDTTV-PLTLISLLADGEFHSGEQLGERLGMSRAA
A0A384LBS3_YERPE      ------------------------MKDIRV-PLRLVSILSDGFFHSGEQLGETLGMSRAA
Q9KV39_VIBCH          ------------------------MKEHSA-KLAILKQLADGDFHSGEVLGAQLGISRAA
Q5E226_ALIF1          ------------------------MKEHTK-KLEILRLLSDGHFHSGEELGEQLNISRAA
Q8EK84_SHEON          ------------------------MSDNWVRKRQILGLLSNEHFVSGEELATQLGISRAA
Q9HWC0_PSEAE          -------------------------------MQTLLKLLQDGRFHSGEELGAVLGISRSA
Q8P3Y0_XANCP          -----------------------------MDDRALLAKLATGRL-SGDTLAREAGLTRAA
Q83CV0_COXBU          ------------------------MKNSQNHLAQIVALLNDRRFHPGTAIGQALNISRTA
BIRA_HAEIN            ---------------------------------MMNFTLLTYLADCQPKVRSELEKFSKN
O30162_ARCFU          ------------------------MRISRESTDYRVYRILSENPLSGEKLAKKLGISRTA
                                                                       :          

B7JH22_BACC0          VWKHMEDLRNE-GYELEAVRRLGYRIASKPD-KVTANEIQLGLQTKHIGR-TVYFEESVE
Q813S9_BACCR          VWKHMEDLRSE-GYELEAVRRLGYRIASKPD-KVTANEIQLGLQTKRIGR-TVYFEETVE
BIRA_BACSU            VWKHIEELRKE-GYEVEAVRRKGYRLIKKPG-KLSESEIRFGLKTEVMGQ-HLIYHDVLS
Q8Y5Z9_LISMO          VWKQMEALRKE-GFEIEAVRNRGYRLSATAE-QYTKDALLLGLETKFIGQ-HLEVHESVN
Q2G258_STAA8          VKKVIDQLKLE-GCKIDSVNHKGHLLQQLPD-IWYQGIIDQYTKSSALFD-FSEVYDSID
Q8TSW9_METAC          VWKYIKSLQAD-GYEIESSPKRGYVLKSVPQ-LLYPDEIQMGLKTTLLGQ-KIHYFEEVS
A5I0V9_CLOBH          IWKYINGLKKE-GYNIESASKKGYRLISCPD-ILTFEEIISLLKTKVIGQ-NIIHFDSIN
Q2FUL7_METHJ          VWKHINELRQL-GYDITASGEEGYVLHDKNQ-DYRPHIIYKHLKTKFIGR-KMRFFESIP
A9A3E8_NITMS          VWKHIKKIQEL-GYTVESKQKLGYKLTKNSD-ALLPWEITSGLKTKTLGQ-HAFYFDSTD
A0RX93_CENSY          VWKHVRKIRSF-GYEVESGRRLGYRLAGGAA-GPLPWEILDGLSTRKMGK-RIHYFESLD
Q8KGB5_CHLTE          VWKHIVALRKA-GYAIEATSGKGYRLESLTG-SPVAEEVAPLLATESFGR-NFIYLESID
Q728P6_DESVH          VGKHVRALRAA-GYVIEAVTRRGYRLDRTTA-PFEAAEVLRGLATEVFGKVGLHWHESTD
A1S0A5_THEPD          IHRAIVGLRKM-GYVVESHPRRGYRLVSSDN-LADANAVVAGAGRTLRYT--AYYVKTCG
Q74BU1_GEOSL          VWKHIKNLKNL-GYRIESVPSRGYRLVASPD-ILIPAEVSAGISVRRIGT-HVVCFRETV
Q1IVG0_KORVE          VWRLIEHLREL-GVQIEGHPATGYQLGAIPD-LLLPEALEPQIKGTLFAH-NVHHYFRIG
D1B9U2_THEAS          ISKMVGILRDE-GIPISSVPHKGYVLEGPPGEDRFSPSWAEMLLWDCPLGHPILHFERIE
D4GTB0_HALVD          VWKHVEALRDE-GFGVESA-GDGYVVTDVPE------YGAPAIEYGLDADYDVEFHETLD
Q5SLR8_THET8          VSKEARRLRAE-GYPVEVS-RRGYRILPGTP------LPHLFHPRG-RLGRPYRYLGRVG
Q82Z38_ENTFA          IWKAINELKKD-GYQITSVQNKGYRLEKSDV---LSAEGIQLALWPQTPPLTITVLETSE
Q8DNH7_STRR6          IWKAIKRLEQE-GIEINSIKNRGYKLMNGDL---ILPE-----ILEENLPIKVSFKPETK
F9UTT9_LACPL          IWKAINALRKQ-GHQIESRKNRGYCYLGSRN---LDAKAIQIYGQRQFTGPLEVVAQTPS
Q9CEQ6_LACLA          IWKAINTLKRK-GNQIESRKNLGYKYVGNES---LDEDTINFYSGMKFEDKIFVFDEVTS
F9UM67_LACPL          IWKLVQGLQAA-GHTIESRHGRGYRYVANNQ---LSAPVIEYALTALPPFDLTVLPTVDS
Q32AE9_SHIDS          INKHIQTLRDW-GVDVFTVPGKGYSLPEPIQLLNAEQILGQLDGG------SVTVLPVID
BIRA_ECOLI            INKHIQTLRDW-GVDVFTVPGKGYSLPEPIQLLNAKQILGQLDGG------SVAVLPVID
BIRA_SALTY            INKHIQTLRDW-GVDVFTVPGKGYSLPEPIQLLDADRIHSQLDSG------NVAVLPVID
A0A384LBS3_YERPE      INKHMQTIRDW-GLDVFTVPGKGYSLPTSIQLLDEQKILSYLPTG------HVTVLPVVD
Q9KV39_VIBCH          ISKHIQGIRDW-GVDVFRVQGKGYQLAQAMTLLDQSVIQSQVNN-------PVELHPIIG
Q5E226_ALIF1          ISKHINVIQSW-GLEIYKVKGKGYSLSTPIELLQQE-LVSHNKLP------KPEVLGVVD
Q8EK84_SHEON          VSKHVDTLEDY-GVAIFSVKGRGYKLANPISLIDSSRLIQAIDN-------RCFYFDEIP
Q9HWC0_PSEAE          VWKRLQHLEAEHGLQFHKVRGRGYRLASPLSLLDPRKIDS---------LWPVEIMPTVD
Q8P3Y0_XANCP          VWKRIQNLRAA-GVAIDGQAGEGYQLAAPLDLLDAQRIRAALQADAAAGLAALELAWTVD
Q83CV0_COXBU          VWKTVQKLKKY-EIPITADKSKGYRLERPFLLLDPQKIKNAVQAEPV----RIDLFEQIN
BIRA_HAEIN            LEEDIQQLREI-GLDILVD-GQDYRLVPMLPLLNPQQISTALFPY------SIHYQPIIS
O30162_ARCFU          VWKAVQKLKEC--GVYVESNASGYTIAGEEE----LNPYEVARLAFESGFKEVHFYDVTD
                      : .    :.             .:                                    

B7JH22_BACC0          STQHIAAKLAYEGA---EEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILR-PSIPV
Q813S9_BACCR          STQHIAAKLAYEGA---EEGTVVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILR-PSIPV
BIRA_BACSU            STQKTAHELANNNA---PEGTLVVADKQTAGRGRMSRVWHSQEGNGVWMSLILR-PDIPL
Q8Y5Z9_LISMO          STQIIAHQ-QIETS---PEGTVIVADEQTAGKGRLLRPWSSKKGEGIWMSVILK-PQIPI
Q2G258_STAA8          STQLAAKKSLVGN----QSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLR-PNVAF
Q8TSW9_METAC          STNSVAKEIAA----SEEEGSLVIAEVQKVGRGRMGREWISPH-GGIWMSVILK-PGIPL
A5I0V9_CLOBH          STNDKAKKIAS----SENDGTIIISEEQTLGKGRLGRTWFSSKFKGIYMSIILK-PDINT
Q2FUL7_METHJ          STIWYGKDLAEQGGIDEMNGMVIIAEEQTGGIGRMGRAWVSPA-GGIWVTIILQ-PQIPI
A9A3E8_NITMS          STQNQALKMAIEPE---NNGAIIVAEKQTGGRGRSGRKWVSPK-GGIWFSIILH-PRFDI
A0RX93_CENSY          STQAYALRIAGEKR---EDGAVVIARRQTAGRGRMGRRWISPH-GGVWLSVITR-PARG-
Q8KGB5_CHLTE          STNLRARASAREGA---VEGTVVVADSQTEGRGRMRRAWVSPAGVNLYCSIVLR-PPVPS
Q728P6_DESVH          STNRDAVALAVGGA---CEGTVVMAAQQLAGRGRTGRPWVSPQG-GVYVSLVLR-PRLSP
A1S0A5_THEPD          STQDVADALASQGA---EEGTVVVAESMTSGRGRLGRRWFAGPG-GLWFTVILR-PQ-QM
Q74BU1_GEOSL          STNTVASHLAAEGA---AEGTVVLADAQTGGKGRLGRRWESPPGVNVYCSIILR-PPISP
Q1IVG0_KORVE          STNVAAMQAGAAGA---PEGTVFVAEEQTAGKGRGGHSWHSVESAGIYCSVLLR-PRVAP
D1B9U2_THEAS          STQNPVKDLAQKGH---PEGVTAVADRQTMGRGRRDRRWESPEG-GLYASVLLR-PPILP
D4GTB0_HALVD          SSNDRARDLAAEGA---SDVVVVAREQTAS-RGRKNREWSAPDGG-VWLSLLVR-PDEPP
Q5SLR8_THET8          STQDVLRAWAEEGA---PEGALVLAEVQERGRGRRGRPWESRPGGSLTFSLLLR-PGLPL
Q82Z38_ENTFA          STMTDAKRAILDQT---PDNTLIVADMQEMPRGRFGRPFFATPGKGIYMSMVLQ-PNQNF
Q8DNH7_STRR6          STQLDAKEAIDLGH---EANTLYLASYQTAGRGRFQRSFYSPQG-GIYMTLHLK-PNLPY
F9UTT9_LACPL          TQILAKSFLSHHQ----PQFAAFFADEQTAGYGRLGRDFYSPAKTGLYFSLVVPNPTNAL
Q9CEQ6_LACLA          TQELAKQYLSSHEV---KQPFIFVANNQTEGHGRRGRNFYSPSDTGLYFSLILPNPSHDI
F9UM67_LACPL          TNAYLRRLVTQTPL---ALPKIVVADTQTAGYGRSGRAFYSPAQTGIYMSIGLPLSDQKA
Q32AE9_SHIDS          STNQYLLDRIGELK---SGD-ACVAEYQQAGRGRRGRKWFSPFGANLYLSMFWR-LEQGP
BIRA_ECOLI            STNQYLLDRIGELK---SGD-ACIAEYQQAGRGRRGRKWFSPFGANLYLSMFWR-LEQGP
BIRA_SALTY            STNQYLLDRIGELR---SGD-ACVAEYQQAGRGRRGRKWFSPFGANLYLSMYWR-LEQGP
A0A384LBS3_YERPE      STNQYLLDRITELK---SGD-ACVAEYQQAGRGRRGRQWVSPFGANLYLSMYWR-LEQGP
Q9KV39_VIBCH          STNQYLLDHVETLV---SGT-VCLAEYQASGRGRRGRHWVSPFGANLYLSIYWR-LDAGM
Q5E226_ALIF1          STNQYLLNNMTSLE---CGQ-SCIAEYQSAGRGRRGRSWVSPFGGNIYLSLYWR-LDDGL
Q8EK84_SHEON          STNGFMLGHTSELK---SGD-LCVAEYQSAGRGRRGRTWVSPYGHHLYFSQFWS-FPQGM
Q9HWC0_PSEAE          STNSEAMRRLAAGA---STPFVIVAEQQTAGRGRRGRAWVSPYGENLYYSLAIT-VRGGA
Q8P3Y0_XANCP          STNTSLLARPAPEQ---GVA-VLLAERQTGGRGRRGRQWASPLGAHLYLSASRR-FSGGL
Q83CV0_COXBU          STNEYLKRVNHPQQ-----LNICLAEMQTQGKGRFQRAWHSPFGQNIYLSLKYP-FHKDV
BIRA_HAEIN            STNEWILQNILSLK----KGDLCVAEYQTAGRGRRGRQWLSPFAGQIMFSFYWA--FDPK
O30162_ARCFU          STNSRAKEYGKPDA-------LFFANRQTAGRGRHGRKWLSEEG-GLYFSVTLS-PPLDY
                      :                               **  : : :     :  :          

B7JH22_BACC0          HHAPQLTLLAAVSVAQAI--EKCTGVNVGIKWPNDILIQGKK------------------
Q813S9_BACCR          HHAPQLTLLAAVSVAQAI--EKCTGVNVGIKWPNDILIQGKK------------------
BIRA_BACSU            QKTPQLTLLAAVAVVQGI--EEAAGIQTDIKWPNDILINGKK------------------
Q8Y5Z9_LISMO          QKVPQFTFIASLAITEAI--ENITKLEPKIKWPNDIYIGKRK------------------
Q2G258_STAA8          SMISKFNLFIALGIRDAI--QHFSQDEVKVKWPNDIFIDNGK------------------
Q8TSW9_METAC          RHASRLTLVAGLAVANVI--RDM-GLDARIKWPNDVRINGKK------------------
A5I0V9_CLOBH          MDVPKITQIAAAAVLTAL--LNN-NIKAYIKWPNDIIVNNKK------------------
Q2FUL7_METHJ          EQLFMLTLAASVSVARVL--RKMYDIGALIKWPNDIIIGDKK------------------
A9A3E8_NITMS          SITTLFPIASALALSIAL--EKTFKISPELKWPNDITIKGKK------------------
A0RX93_CENSY          GPNTVLPLAASVALAEAI--EAAAGVRPELKWPNDVLVNGGK------------------
Q8KGB5_CHLTE          IRVPEIPLVAAAAIHEAVT-QECPGLAAFIKWPNDIITGGRK------------------
Q728P6_DESVH          QAAPLVTLMTAVAAAEAV--EAVTGLMPEVKWPNDLLMAGLK------------------
A1S0A5_THEPD          KHLQLLSLAAGLSVAKSV--RGLYGIDARLKWPNDVVVGERK------------------
Q74BU1_GEOSL          LHSPQLTLLSAVATAEAI--ERTSGLVPAIKWPNDILVNGFK------------------
Q1IVG0_KORVE          ADALILALAAGVATADAI--ASVTGLAPDLRWPNDLLFGLKK------------------
D1B9U2_THEAS          GHVQMVNLACAMAMGDAI--EARCGIKVDIKWPNDLLVGGRK------------------
D4GTB0_HALVD          AYAPLYTLAMAVAVCDAA---REAGVDAKIKWPNDVIVSEASGGSPAHAGDRSTDADAPD
Q5SLR8_THET8          SALGLLPLLAGLALREAV---GVGG----LKWPNDLLAPDGG------------------
Q82Z38_ENTFA          EEIAQYTVIMAVAVARAMD-ALAG-VHTEIKWVNDLYLNGKK------------------
Q8DNH7_STRR6          DKLPSYTLLVAGAVYKAIK-NLTL-IDVDIKWVNDIYLNNHK------------------
F9UTT9_LACPL          VNVGLLTTGVAVSVLNVLQ-QFYPNKNFGLKWVNDIYLDQHK------------------
Q9CEQ6_LACLA          LKIGLLTTSTAVAVVKVLE-QFYKDKNFQLKWVNDIYLGTYK------------------
F9UM67_LACPL          LDAGLLTTSTAVVVAQTLQ-QLFA-VDVSLKWVNDVLVNHHK------------------
Q32AE9_SHIDS          AAAIGLSLVIGIVMAEVL--RKLGADKVRVKWPNDLYLQDRK------------------
BIRA_ECOLI            AAAIGLSLVIGIVMAEVL--RKLGADKVRVKWPNDLYLQDRK------------------
BIRA_SALTY            AAAIGLSLVIGIVMAEVL--RKLGADKVRVKWPNDLYLLDRK------------------
A0A384LBS3_YERPE      AAAMGLSLVVGIVMAEVL--QNLGAEKVRVKWPNDLYLNDKK------------------
Q9KV39_VIBCH          AAAMGLSLVVGVAIVEAL--EAMGVDGVKLKWPNDLYYQDKK------------------
Q5E226_ALIF1          AATMGLSLAVGIAVVEAL--ENLGCSGLKLKWPNDIYWNNRK------------------
Q8EK84_SHEON          AQAMGLSLVVACSLVEVL--KSFGVENVGVKWPNDIYLNFKK------------------
Q9HWC0_PSEAE          RELEGLSLVVGLAVLRAL--ESLGVQDTGLKWPNDLLQGGKK------------------
Q8P3Y0_XANCP          GQLAGLSLAVGVAVAEAL--RGCGFNEVGLKWPNDLLARGRK------------------
Q83CV0_COXBU          SELAGLSLVCGLAVCNAIEENCPLTKPIFVKWPNDIICEDKK------------------
BIRA_HAEIN            KSIEGLSLVIGLAIAEVL--------NVQVKWPNDILFDERK------------------
O30162_ARCFU          SELPKLTLIAGLSVAEAIP-------QSEIKWPNDVLIKGRK------------------
                                .                  ::* **:                        

B7JH22_BACC0          ------AVGILTEMQADPDK--INAVIMGIGINANQKQEHFDEEIQHI----ATSLAIES
Q813S9_BACCR          ------AVGILTEMQADLDK--INAVIMGIGINANQKQEHFDEEIQHI----ATSLAIES
BIRA_BACSU            ------TVGILTEMQAEEDR--VRSVIIGIGINVNQQPNDFPDELKDI----ATSLSQAA
Q8Y5Z9_LISMO          ------ICGVLTEMQAEAET--IHAVIIGMGINVNQQ--EFPEEIKDK----ASSLKLEL
Q2G258_STAA8          ------VCGFLTEMVANNDG--IEAIICGIGINLTQQLENFDESIRHR----ATSIQLHD
Q8TSW9_METAC          ------VCGILTEAKAEVDR--VDYVILGIGINVNMELKDIPESFRAG----STTLKVET
A5I0V9_CLOBH          ------VCGILTEMSGEINK--VNYVVVGMGINVNCEEEDIPKDLLSK----ATSLKIEK
Q2FUL7_METHJ          ------VAGILLELGAEERK--VEYCLVGIGIDANVNLESLNQTIRST----MTSISQEV
A9A3E8_NITMS          ------LAGMLVDVSLESNK--IENLVLGVGINFDVDVKQIEKNLKGTPNFYGVASLNEK
A0RX93_CENSY          ------VAGILVDASVSPGG--VDHAVIGVGINLDVKAGEISRRT-------GRAAASLS
Q8KGB5_CHLTE          ------LCGILCEMESEPDC--THFVVVGFGLNVNLD-PVP-EELRKI----ATSIAIET
Q728P6_DESVH          ------VCGNLTEVGLVADM--VDWVVTGVGVNVSTP-AEALVDAGVA----ATSLQTEC
A1S0A5_THEPD          ------LCGILVEGKAEADA--LKYLLLGVGVNVNNE-VPE--GLEGV----ATSIKEIL
Q74BU1_GEOSL          ------VAGMLNELSAETER--VEYLVLGIGVNINMERDQFPGDLRYP----ASSLALEA
Q1IVG0_KORVE          ------FCGILTELNAEATR--VRYVVIGVGINVNHQ--EFPEEISKV----ATSLRLES
D1B9U2_THEAS          ------LCGMLSEGAVEADR--VHHIVAGIGVNIKGS--PTIQDSPQD----VTSIAEEG
D4GTB0_HALVD          DRGYRKLCGILTEMEGEADR--VSWLVIGPGVNVNLDPAELPEVATSV---------AAE
Q5SLR8_THET8          -----KLAGVLLEARAEGEE--VSYALLGVGVNVAWAPEGAAFLQAYA---------PLS
Q82Z38_ENTFA          ------VCGILSEAMSNVETGQISNVIIGMGINFSITETEFPEDIRQK----VTSLFPDG
Q8DNH7_STRR6          ------IGGILTEAMTSVETGLVTDIIIGVGINFTIKD--FPQELKEK----AASLFKAT
F9UTT9_LACPL          ------VGGIITEASLELESISATAFIVGVGLNLTTTD--FPRELQAR----AQAVDP-S
Q9CEQ6_LACLA          ------VGGIITEAALDLESSSAGNFIMGIGLNLSTKD--FPADLSEK----AQGINP-E
F9UM67_LACPL          ------VVGILSEGITSLETGQISAVIIGIGINLTTTA--FPALLAHK----AGAVVA-N
Q32AE9_SHIDS          ------LAGILVELTGKTGD--AAQIVIGAGINMAMRRVEESVVNQGW----ITLQEAG-
BIRA_ECOLI            ------LAGILVELTGKTGD--AAQIVIGAGINMAMRRVEESVVNQGW----ITLQEAG-
BIRA_SALTY            ------LAGILVELTGKTGD--AAQIVIGAGINMAMRRVEEDVINQGW----ITLQEAG-
A0A384LBS3_YERPE      ------LAGILVELTGKTGD--AAQLVIGAGINLTMRGSETNAINQDW----INLQDAG-
Q9KV39_VIBCH          ------LAGILVEMSGQAGA--AAHLVIGMGINLAMRDNEGN-IDQPW----ISLAEVTG
Q5E226_ALIF1          ------LGGVLIELSAQSGG--AAHVVIGIGINVDLSERFTSEIDQPW----VDLKTILG
Q8EK84_SHEON          ------LAGILIEMSGQADS--ECQLIIGIGVNMAMSEGQGKGIDQPW----SDLSGLT-
Q9HWC0_PSEAE          ------IAGILLELSGDPAD--LCHVVIGIGINVNM--KTATDIGQPW----TSLREALG
Q8P3Y0_XANCP          ------LGGLLIEGGGEMAG--NARAVIGLGLNVHMPPAAAASIDQPW----VDLDTLAG
Q83CV0_COXBU          ------LAGILIEIEAETHG--FCSAIIGIGLNVNMEKEQDKINQPWI------SIKNLT
BIRA_HAEIN            ------LGGILVEIANHKNG--MLNLVIGIGINVSLSKQTEISQPYAE--------VCEI
O30162_ARCFU          ------VCGILSELHGEVER---PLVIVGVGINVKNPHPENGISLSEL------------
                              * : :             : * *::                           

B7JH22_BACC0          GKPIVRAELMQQIFLQLEKLYEEY-LQNG----FSVIKILWESYAVSIGKEINARTMRET
Q813S9_BACCR          GKPIVRAELMQQIYLQLEKLYEEY-LQNG----FSVIKILWESYAVSIGKEITARTMRET
BIRA_BACSU            GEKIDRAGVIQHILLCFEKRYRDY-MTHG----FTPIKLLWESYALGIGTNMRARTLNGT
Q8Y5Z9_LISMO          GESVSRKALLQEILTSLEKYYELF-LDKG----FAPIKLLWETKAIPFGEKLTASTTKGK
Q2G258_STAA8          KNKLDRYQFLEILLQEIEKRYNQF-LTLP----FSEIREEYTAASNIWNRTLLFTENDKQ
Q8TSW9_METAC          GKHIRRVSFLQDLLFELEQQYIRF-KTQP----FSQILNDWLALSDTIGREVKVTTPSRI
A5I0V9_CLOBH          DREFKRNILVADILNNFENLYTELIECNN----IDTSIEICKENSILIGKEVRIINRTRE
Q2FUL7_METHJ          NQNVDRAVLLAAILKEFENRYEMI-SQGE----FDAVIREWKNFSSTIGRRVRIVTLRTH
A9A3E8_NITMS          KIKIRPVELVQSFLVELEKIYKLL-DTKQ----TKKIISEWTKRSSTIGKNVKLNTVDGE
A0RX93_CENSY          DHADAAPAIVREFLSALERATDSL-DAGG----SAGILSRWTGLSCTVGRNISVETGGGT
Q8KGB5_CHLTE          GLRMSRARLLAAVLNRFEQLYRDWLEKE----NLAFILPYLEAHSWLKGRELKIEQFNTV
Q728P6_DESVH          GRPVARADVARAFLERAEHWYGALREGD----TGAVITRWKELSDIV-GRHLRVRHGDEL
A1S0A5_THEPD          GHPVPRLPLLKAILAGLDGYYAALKRGE----PGRVVEEWKTLSSTLGRRVRVSIVGGGV
Q74BU1_GEOSL          GRTVERIPFVRALLESLDRLYDEYLLKGFSPVRDAWLAR-----SAVMGRRVKVDGGAGI
Q1IVG0_KORVE          GRVWSRVEVAAALLKSLDRVYAE-LLRGGAEARRGMIARFQEMSSLAKDRRVFVEEDGG-
D1B9U2_THEAS          GTLVARHDLLAFFLRSLKHHIGILCEDR-----KAFINSYRGRCSTLGRRIVVS-SDSGT
D4GTB0_HALVD          AGPVERRVFVQRVLERFDALRSDL----------DAVLPAWRERADTLGRRVRVHTASGV
Q5SLR8_THET8          RREVLEGFLLK--LEALLPLLQTP----------EALLERYRQASLTLGRKVRVHTGKGV
Q82Z38_ENTFA          EPTATRNELVANIWNHFYQILDER--------STKDFLEEYRQRSFVIGKDVAFTQNGQD
Q8DNH7_STRR6          API-TRNELIIEIWRAFFETPAE------------ELLYLYKKQSFILGKEVTFTLEQKD
F9UTT9_LACPL          MS-VDRNRLAAALLSALVALSKRY--------ATADFLPAYRAKSLVLGQQVTLQVGDSV
Q9CEQ6_LACLA          FK-IDRNQLLAEMAKEVINNFANY--------RQPDLIDEYRKRSLLFGKNVTLKLGTKA
F9UM67_LACPL          PNGVTRNQVICELLRRFFNSYGTY--------RSGTFMDAYRKLSMVIDQQVELKSGTQK
Q32AE9_SHIDS          -INLDRNTLAAMLIRELRAALELFEQEG-----LAPYLSRWEKLDNFINRPVKLIIGDKE
BIRA_ECOLI            -INLDRNTLAAMLIRELRAALELFEQEG-----LAPYLSRWEKLDNFINRPVKLIIGDKE
BIRA_SALTY            -ITLDRNMLAAKLIYKLRAALELFEQEG-----LSPYLSRWKKLDNFIDRPVKLIIGDKE
A0A384LBS3_YERPE      -VTIDRNKLTAEILSELRLAVVKFENEG-----LSAFLSRWQKMDNYLNRPVKLIIGNQE
Q9KV39_VIBCH          QSRIDRNALAINLIAALDRTLRQYEISG-----MQNFVERWNRWDNFIGRPVKLLMGANE
Q5E226_ALIF1          -QNHIRNKLANTLLVSLEETMKAFECFG-----LSHFIERWNRYDNFKGQEISLQLGNGT
Q8EK84_SHEON          -CIPNKTDLVIALHKQLKRDIQLFEREG-----LVAFKTRWQEADLFHGKEIRLLMGENH
Q9HWC0_PSEAE          -ELVDRSRLLSALNRQLADYLDRHSREG-----FAASREEWESCNLWQGAQVILSTALSS
Q8P3Y0_XANCP          -RPVSRDQMVAAVLSGLIPALALFEAQG-----LAPFLSRYAALDLLSGRAVQVEEAGSL
Q83CV0_COXBU          ATDQDRNQLCAALINQLVNCIDCFEKKG-----FNEFLASWKTKDYLLNKQIQLKSGRQE
BIRA_HAEIN            DPDVERQTLLPKLIQHLYTRLNIFEQNG----IDEEFQQAWQSYNAFSNSEINVLTEQGV
O30162_ARCFU          -YDVSRREVFEQVIRNFSKNYRMLLDGRW-----CELRRRIERRCSSVGKAVRVTTPSGV
                              .                                                   

B7JH22_BACC0          ITGVAKGITEDGVLLLEDHEGKVHHIHSADIEIK------------
Q813S9_BACCR          ITGLAKGITEDGVLLLEDHEGKVHHIHSADIEIK------------
BIRA_BACSU            FYGKALGIDDEGVLLLETNEG-IKKIYSADIELG------------
Q8Y5Z9_LISMO          IHGQVKGISDEGVLLLQDTLGEVHSIYSADILLDNEK---------
Q2G258_STAA8          FKGQAIDLDYDGYLIVRDEAGESHRLISADIDF-------------
Q8TSW9_METAC          IEGKAVGVTPDGALIIRKSDDTKEEIIAGRCIYARPK---------
A5I0V9_CLOBH          SFGKAVGLNSNGELLVQFENGEIKPLISGEISVRGMNGYV------
Q2FUL7_METHJ          FEGEAIDIDPNGALVVKKDNGKIERVIAGDCIHI------------
A9A3E8_NITMS          IKGKAIRIDDDGALVVS-DNKDTNRVIAGDIIHVSK----------
A0RX93_CENSY          VRGRALCVDPDGALVLD-CNGDRRRVVSGDLVP-------------
Q8KGB5_CHLTE          LTGTEAGLSPQGHLLLRTVDGALLSVTSGEAHLLPVNHEPRSA---
Q728P6_DESVH          VEGRVADMTPEGWLCILAGNGTLHRLHAGDVIDSRV----------
A1S0A5_THEPD          VEGVAVDVTSRGELVVQKDTGGRVTVDAGDVEHLR-----------
Q74BU1_GEOSL          LAGTVEGIDEIGALLVRTA-GGSLERVLAGDV----SLEG------
Q1IVG0_KORVE          YAGTSAGLDERGFLQVSTNHGKSVRTVLSGGVRSIEDVEGIRQLHH
D1B9U2_THEAS          LEGVAEDVEDEGSLLIRTSTGLLRFSAGDVRHVRPIKGGEGE----
D4GTB0_HALVD          IEGDAVDIEHPGTLVVSTDAGEKRVHAGDCEHLRPADDGR------
Q5SLR8_THET8          VEGLAEDVLPDGSLLV----GGVRVGAGEVELLPLL----------
Q82Z38_ENTFA          FRGVATTINGNGELIVQLPDGTAKTLSSGEISLDQIGEWRRG----
Q8DNH7_STRR6          YKGLAKDISENGKLLVQCDNGKEIWLNSGEISLNSWK---------
F9UTT9_LACPL          VNGVAEDIDEHGGLVVRMLTGERRTFTSGEVIRVGLPV--------
Q9CEQ6_LACLA          VNGKVEGISDDGSLILKAKSGELQTFKSGEVVKVDW----------
F9UM67_LACPL          YRGVVTDIDAHGALVVKLETGQSRHFSSGEITKVNLLSGGYHG---
Q32AE9_SHIDS          IFGISRGIDKQGALLLE-QDGIIKPWMGGEISLRSAEK--------
BIRA_ECOLI            IFGISRGIDKQGALLLE-QDGIIKPWMGGEISLRSAEK--------
BIRA_SALTY            IFGISRGIDTQGALLLE-QDGVIKPWMGGEISLRSAE---------
A0A384LBS3_YERPE      IFGIARGIDQQGALLLE-QDGNIKPYIGGEISLRGV----------
Q9KV39_VIBCH          VRGIERGIDEHGGVLLE-TEEGLKSFIGGEISLRKND---------
Q5E226_ALIF1          VTGVCNGIDAQGALLLI-NADGLTAYNGGEISIKK-----------
Q8EK84_SHEON          LDGICRGIDEQGAVLLE-NADGIQAYIGGEISLRPI----------
Q9HWC0_PSEAE          IEGRVLGVDSRGALRLE-VDGVEQGFSGGELSLRLRQ---------
Q8P3Y0_XANCP          HRGTALGLAADGALRVQ-IGSDVRLFHSGEVSVRPA----------
Q83CV0_COXBU          LQGKSLGINPQGYLTVQLSDGSERIFSSGDTTLLK-----------
BIRA_HAEIN            ISGIEQGIDERGYLKVL-CGNKIQMFNGGEVSLRKK----------
O30162_ARCFU          AEGIAEAISEDGSLVVS----GKKIYAGDCIHLR------------
                        *    :   * : :