CLUSTAL format seed alignment for MF_00984

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SSB_SERMA        --------------------------------MASRGVNKVILVGNLGQDPEVRYMP-NG
SSB_YERPE        --------------------------------MASRGVNKVILVGNLGQDPEVRYMP-NG
SSB_ECO57        --------------------------------MASRGVNKVILVGNLGQDPEVRYMP-NG
SSB_ECOL6        --------------------------------MASRGVNKVILVGNLGQDPEVRYMP-NG
SSB_ECOLI        --------------------------------MASRGVNKVILVGNLGQDPEVRYMP-NG
SSB_SHIFL        --------------------------------MASRGVNKVILVGNLGQDPEVRYMP-NG
SSB1_SALTI       --------------------------------MASRGVNKVILVGNLGQDPEVRYMP-SG
SSB1_SALTY       --------------------------------MASRGVNKVILVGNLGQDPEVRYMP-SG
SSB_PROMI        --------------------------------MASRGVNKVILIGNLGQDPEIRYMP-SG
SSB_VIBCH        --------------------------------MASRGVNKVILIGNLGQDPEVRYMP-SG
SSB_VIBVU        --------------------------------MASRGINKVILVGNLGNDPEIRYMP-SG
SSB_VIBPA        --------------------------------MASRGINKVILVGNLGNDPEIRYMP-NG
SSB2_SALTI       --------------------------------MASKGVNKVILVGNLGQDPEVRYMP-NG
SSB_PROVU        --------------------------------MASRGVNKVILVGNVGQDPEVRYMP-NG
SSB_BUCAI        --------------------------------MASRGVNKVILIGHLGQDPEVRYMP-NG
SSB_BUCAP        --------------------------------MASRGVNKVILIGHLGQDPEVRYMP-NG
SSB_BUCBP        --------------------------------MASRGINKVILIGYLGQDPDVRYMQ-NG
SSB_WIGBR        --------------------------------MTSRGINKVILIGNLGQDPEVRYIP-NG
SSB2_ECOLX       --------------------------------MAVRGINKVILVGRLGKDPEVRYIP-NG
SSBF_ECOLI       --------------------------------MAVRGINKVILVGRLGKDPEVRYIP-NG
SSB7_ECOLX       --------------------------------MAVRGINKVILVGRLGKDPEVRYIP-NG
SSBP_ECOLX       --------------------------------MSARGINKVILVGRLGNDPEVRYIP-NG
SSBR_ECOLX       --------------------------------MSARGINKVILVGRLGNDPEVRYIP-NG
SSB2_SALTY       --------------------------------MAARGVNKVILVGHIGQDPEVRYMP-NG
SSB_PSEPK        ---------------------------------MARGVNKVILVGTCGQDPEVRYLP-NG
SSB2_PSEPU       ---------------------------------MARGVNKVILVGTCGQDPEVRYLP-NG
SSB1_PSEPU       ---------------------------------MARGVNKVILIGTCGQDPEVRYLP-NG
SSB_PSESM        ---------------------------------MARGVNKVILVGTCGQDPEVRYLP-NG
SSB_PSEAE        ---------------------------------MARGVNKVILVGNVGGDPETRYMP-NG
SSB_COXBU        ---------------------------------MARGVNKVILIGNLGQDPEVRYTP-NG
SSB_SHEON        --------------------------------MASRGVNKVILVGNLGQDPEVRYMP-NG
SSB_SHEHA        --------------------------------MASRGVNKVILVGNLGKDPEVRYMP-NG
SSB_HAEDU        ----------------------------------MAGINKVIIVGNLGNDPEMRTMP-NG
SSB_HAEIN        ----------------------------------MAGINKVIIVGHLGNDPEIRTMP-NG
SSB_PASMU        ----------------------------------MAGVNKVIIVGNLGNDPEIRTMP-NG
SSB_CUPNH        ----------------------------------MASVNKVILVGNLGADPEVRYMP-SG
SSB_NITEU        ----------------------------------MASLNKVMLIGNLGRDPEIRYMP-SG
SSB_BORBR        ----------------------------------MASVNKVILVGNLGRDPEVRYSP-DG
SSB_BORPE        ----------------------------------MASVNKVILVGNLGRDPEVRYSP-DG
SSB_BORPA        ----------------------------------MASVNKVILVGNLGRDPEVRYSP-DG
SSB_RALSO        ----------------------------------MASVNKVIIVGNLGADPETRYMP-SG
SSB1_XYLFA       ----------------------------------MASLNKMQLIGNLGADPDIRYMQ-DG
SSB_XANAC        ---------------------------------MARGINKVILVGNLGNDPDTKYTQ-AG
SSB_XANCP        ---------------------------------MARGINKVILVGNLGNDPDTKYTQ-AG
SSB_XYLFT        ---------------------------------MARGINKVILVGNLGNDPDIKYTQ-GG
SSB2_XYLFA       ---------------------------------MARGINKVILVGNLGNDPDIKYTQ-GG
SSB_NEIMA        -----------------------------------MSLNKVILIGRLGRDPEVRYMP-NG
SSB_NEIMB        -----------------------------------MSLNKVILIGRLGRDPEVRYMP-NG
SSB1_CHLTE       ---------------------------------MARGLNKVMLIGHLGNDPERRETA-SG
SSB_BRUA2        ---------------------------------MAGSVNKVILVGNLGADPEIRRLN-SG
SSB_BRUAB        ---------------------------------MAGSVNKVILVGNLGADPEIRRLN-SG
SSB_BRUSU        ---------------------------------MAGSVNKVILVGNLGADPEIRRLN-SG
SSB_BRUME        ---------------------------------MAGSVNKVILVGNLGADPEIRRLN-SG
SSB_RHILO        ---------------------------------MAGSVNKVILVGNLGADPEIRRLN-SG
SSB_CAUVC        ---------------------------------MAGSVNKVILVGNLGADPEIRSLG-SG
SSB_AGRFC        ---------------------------------MAGSVNKVILIGNVGADPEIRRTQ-DG
SSB_RHIME        ---------------------------------MAGSVNKVILIGNVGADPEIRRTQ-DG
SSB_BRADU        ---------------------------------MAGSVNKVILVGNLGKDPEIRRTQ-DG
SSB_RHOS4        ---------------------------------MAGSVNKVIIIGNLGRDPEVRSFQ-NG
SSB_RICTY        ---------------------------------MAGSLNKVILIGNVGRDPEIRTTG-EG
SSB_RICPR        ---------------------------------MAGSLNKVILIGNVGRDPEIRTTG-EG
SSB_RICFE        ---------------------------------MAGSLNKVILIGNVGRDPEIRTTG-EG
SSB_RICCN        ---------------------------------MAGSLNKVILIGNVGRDPEMRTTG-EG
SSB_RICBR        ---------------------------------MAGSLNKVTLIGNLGRDPEIRTTG-EG
SSB_BACTN        -----------------------------------MSVNKVILIGNVGQDPRVKYFD-TG
SSB_CHLMU        -------------------------------------MLFGYLVGFLAADPEERMTS-GG
SSB_CHLTR        -------------------------------------MLFGYLVGFLAADPEERMTS-GG
SSB_CHLCV        -------------------------------------MMFGYFVGYLGADPEERMTS-KG
SSB_CHLPN        -------------------------------------MMFGHFAGYLGADPEERMTS-KG
SSB_BACCR        ------------------------------------MMNRVILVGRLTKDPDLRYTP-NG
SSB_BACAN        -------------------------------------MNRVILVGRLTKDPDLRYTP-NG
SSBA_BACSU       ------------------------------------MLNRVVLVGRLTKDPELRYTP-NG
SSB1_LISMO       ------------------------------------MMNRVVLVGRLTKDPELRYTP-AG
SSB1_LISIN       ------------------------------------MMNRVVLVGRLTKDPELRYTP-AG
SSB2_LISIN       ------------------------------------MMNRVVLVGRLTKDPDLRYTP-AG
SSB2_LISMO       ------------------------------------MMNRVVLVGRLTKDPDLRYTP-AG
SSB3_LISIN       ------------------------------------MMNRVVLVGRLTKDPELRYTP-AG
SSB_BACHD        ------------------------------------MLNRVVLVGRLTRDPELRYTP-NG
SSB_OCEIH        ------------------------------------MLNRVVLVGRLTRDPDLRYTP-NG
SSB2_STAAS       ------------------------------------MLNRVVLVGRLTKDPEYRTTP-SG
SSB1_STAAC       ------------------------------------MLNRVVLVGRLTKDPEYRTTP-SG
SSB_STAAR        ------------------------------------MLNRTILVGRLTRDPELRTTQ-SG
SSB1_STAAM       ------------------------------------MLNRTILVGRLTRDPELRTTQ-SG
SSB_STAAN        ------------------------------------MLNRTILVGRLTRDPELRTTQ-SG
SSB1_STAAS       ------------------------------------MLNRTILVGRLTRDPELRTTQ-SG
SSB_STAAW        ------------------------------------MLNRTILVGRLTRDPELRTTQ-SG
SSB2_STAAM       ------------------------------------MLNRTVLVGRLTKDPELRSTP-NG
SSB2_STAAC       ------------------------------------MLNRTVLVGRLTKDPELRSTP-NG
SSB2_LACLA       ------------------------------------MINNVVLVGRITRDPELRYTP-QN
SSB1_LACLA       ------------------------------------MINNVVLVGRLTRDPELRHTP-QN
SSB1_STRA3       ------------------------------------MINNVVLVGRMTRDAELRYTP-SN
SSB1_STRA5       ------------------------------------MINNVVLVGRMTRDAELRYTP-SN
SSB2_STRP6       ------------------------------------MINNVVLVGRMTKDAELRYTP-SQ
SSB_STRP1        ------------------------------------MINNVVLVGRMTKDAELRYTP-SQ
SSB_STRP3        ------------------------------------MINNVVLVGRMTKDAELRYTP-SQ
SSB_STRPQ        ------------------------------------MINNVVLVGRMTKDAELRYTP-SQ
SSB2_STRP8       ------------------------------------MINNVVLVGRMTKDAELRYTP-SQ
SSB_STRMU        ------------------------------------MINNVVLVGRMTRDAELRYTP-SN
SSB3_STRA5       ------------------------------------MINNIVLVGRMTKDAELRYTP-SN
SSB_STRPN        ------------------------------------MINNVVLVGRMTRDAELRYTP-SN
SSB_STRR6        ------------------------------------MINNVVLVGRMTRDAELRYTP-SN
SSB1_STRP8       ------------------------------------MINNVVLIGRLTKDVELRYTP-SQ
SSB4_STRA5       ------------------------------------MINNVVLIGRLTRDVELRYTP-SN
SSB_ENTFA        ------------------------------------MINNVVLVGRLTKDPDLRYTA-SG
SSB_LACPL        ------------------------------------MINRTILVGRLTRDPELRYTN-GG
SSBB_BACSU       ------------------------------------MFNQVMLVGRLTKDPDLRYTS-AG
SSB_CALS4        ------------------------------------MLNKVILIGRLTKDPVMRYTS-DM
SSB2_STRA3       ------------------------------------MYNKVIMIGRLTAKPEMVKTP-TD
SSB2_STRA5       ------------------------------------MYNKVIMIGRLTAKPEMVKTP-TD
SSB1_STRP6       ------------------------------------MYNKVIAIGRLVAKPELVKTA-TD
SSB3_CLOAB       -------------------------------------MNKVVLIGRLTKDPELKFTPGTG
SSB2_CLOAB       -------------------------------------MNKTILIGRLTKDPELKYIPNTG
SSB_CLOTE        -------------------------------------MNRVVLIGRLTKDPELKFTPGTG
SSB1_CLOAB       -------------------------------------MNKILLIGRMTKNPSIKQIETTG
SSB_CLOPE        -------------------------------------MNKVVLIGRLTKDPELRFAAGSG
SSB_UREPA        -------------------------------------MNKVILIGNLVRDPEARQIP-SG
SSB_THEMA        ----------------------------------MSFFNKIILIGRLVRDPEERYTL-SG
SSB_AQUAE        ------------------------------------MLNKVFIIGRLTGDPVITYLP-SG
SSB_WOLSU        ------------------------------------MYNKVILVGNLTRDVELRYLP-SG
SSB_HELHP        ------------------------------------MYNKVIIIGNLTRDVELRYLP-SG
SSB_HELPY        ------------------------------------MFNKVIMVGRLTRNVELKYLP-SG
SSB_HELPJ        ------------------------------------MFNKVIMVGRLTRNVELKYLP-SG
SSB_CAMJE        ------------------------------------MFNKVVLVGNLTRDIEMRYAQ-SG
SSB_LEPIC        ----------------------------------MKNIAHIILDGNLTSDPEIKTLN-SG
SSB_LEPIN        ----------------------------------MKNIAHIILDGNLTSDPEIKTLN-SG
SSB_RHOBA        ----------------------------------MASFNRVMLMGNLTRDIELRYLP-SG
SSB_TREPA        ----------------------------------MADVNHVVLVGRLTRDAELKYTS-AG
SSB_BORBU        ----------------------------------MADINSLVLSGRLTRDSELSYTE-SG
SSB_ANAVA        -----------------------------------MSINIVTLVGRVGTDPDIKYFE-SG
SSB1_NOSS1       -----------------------------------MSINIVTLVGRVGTDPDIKYFE-SG
SSB_THEEB        -----------------------------------MGLNVVHLVGRVGGDPEVRYFE-SG
SSB1_SYNY3       -----------------------------------MSVNSIHLVGRAGRDPEVKYFE-SG
SSB2_NOSS1       ----------------------------------MNYINKVMLVGRCGQEPDLKFFE-SG
SSB_PAEAU        ----------------------------------MAGETTITVIGNLTSDPELRFTP-SG
SSB_PAENI        ----------------------------------MAGETTITVIGNLTNDPELRFTP-SG
SSB_MYCBO        ----------------------------------MAGDTTITIVGNLTADPELRFTP-SG
SSB_MYCTU        ----------------------------------MAGDTTITIVGNLTADPELRFTP-SG
SSB_MYCLE        ----------------------------------MAGDTTITIVGNLTADPELRFTS-SG
SSB_MYCS2        ----------------------------------MAGDTTITVVGNLTADPELRFTP-SG
SSB2_STRCO       ----------------------------------MAGETVITVVGNLVDDPELRFTP-SG
SSB1_STRAW       ----------------------------------MAGETVITVVGNLVDDPELRFTP-SG
SSB_CORGL        ---------------------------------MAIGDTNITVVGNIVADPELRFTP-SG
SSB_COREF        ---------------------------------MAQGDTNITVVGNLVADPELRFTP-SG
SSB_BIFLO        ----------------------------------MAGETVITIVGNLTADPELRTIG-SG
SSB1_TROWT       ------------------------------------MDATVTVVGNLTADPELRYTA-TG
SSB1_TROW8       ------------------------------------MDATVTVVGNLTADPELRYTA-TG
SSB2_TROW8       --------------------------------MRGKRMNHITVSGLVATEPRSFLTA-EG
SSB2_TROWT       --------------------------------MRGKRMNHITVSGLVATEPRSFLTA-EG
SSB2_STRAW       -----------------------------------MNETIVCVVGNVATRPVYRELA-SG
SSB1_STRCO       -----------------------------------MNETMICAVGNVATTPVFRDLA-NG
SSBP_RABIT       -----MFRRPALQVLRQFVRH---ESEIASSLVLERSLNRVQLLGRVGQDPVMRQVE-GK
SSBP_BOVIN       -----MFRRPVVQVLRQFVRH---ESEVASSLVLERSLNRVQLLGRVGQDPVMRQVE-GK
SSBP_RAT         -----MFRRPVLQVFRQFVRQ---ESEVASSLVLERSLNRVQLLGRVGQDPVMRQVE-GK
SSBP_HUMAN       -----MFRRPVLQVLRQFVRH---ESETTTSLVLERSLNRVHLLGRVGQDPVLRQVE-GK
SSBP_PONAB       -----MFRRPVLQVLRQFVRH---ESETASSLVLERSLNRVHLLGRVGQDPVLRQVE-GK
SSBP_MOUSE       -----MFRRPVLQVFRQFVRH---ESEVASSLVLERSLNRVQLLGRVGQDPVMRQVE-GK
SSBPA_XENLA      -----MFHRPALQVFRQFARC---QSTDSV--ILERSINKVQLLGRVGQDPVMRQAE-GK
SSBPB_XENLA      -----MFHRPVLQVFRQFARC---QSTDSLSAILERSMNKVQLLGRVGQDPVMRQAD-GK
SSBP_DROME       MQHTRRMLNPLLTGLRNLPARGATTTTAAAPAKVEKTVNTVTILGRVGADPQLRGSQ--E
SSB_FUSNN        -------------------------------------MNLVVLNGRLTRDPELKFGQ-SG
SSB_MYCPE        -------------------------------------MNKVFIVGRLAQDPQ-QFVTQNG
SSB_ONYPE        ------------------------------------MLNKVQLIGNITHDLEQQYINTNE
SSB2_CHLTE       ----------------------------------MPEINSVIIAGNLTKDPVFRQTNSGG
SSB_MYCPU        -------------------------------------MNRICIVGRITRDPYNNITN-SG
SSB_STAES        ------------------------------------MLNKIVIVGRMTKDAQIYEKE--D
                                                             *               

SSB_SERMA        GAVANITLATSESWRDKATGEQK-----E-KTEWHRVVLFGK-LAEVAGEYLRKGSQVYI
SSB_YERPE        GAVANITLATSESWRDKQTGEQK-----E-KTEWHRVVLFGK-LAEVAGEYLRKGSQVYI
SSB_ECO57        GAVANITLATSESWRDKATGEMK-----E-QTEWHRVVLFGK-LAEVASEYLRKGSQVYI
SSB_ECOL6        GAVANITLATSESWRDKATGEMK-----E-QTEWHRVVLFGK-LAEVASEYLRKGSQVYI
SSB_ECOLI        GAVANITLATSESWRDKATGEMK-----E-QTEWHRVVLFGK-LAEVASEYLRKGSQVYI
SSB_SHIFL        GAVANITLATSESWRDKATGEMK-----E-QTEWHRVVLFGK-LAEVASEYLRKGSQVYI
SSB1_SALTI       GAVANLTLATSESWRDKQTGEMK-----E-QTEWHRVVMFGK-LAEVAGEYLRKGSQVYI
SSB1_SALTY       GAVANLTLATSESWRDKQTGEMK-----E-QTEWHRVVMFGK-LAEVAGEYLRKGSQVYI
SSB_PROMI        GAVANLTLATSESWRDKQTGEMK-----E-KTEWHRVVIFGK-LAEIAGEYLRKGSQVYI
SSB_VIBCH        GAVANITIATSETWRDKATGEQK-----E-KTEWHRVTLYGK-LAEVAGEYLRKGSQVYI
SSB_VIBVU        GAVANITVATSETWRDKATGEPR-----E-KTEWHRVTLYGK-LAEVAGEYLRKGSQVYI
SSB_VIBPA        GAVANITIATSESWRDKATGEQR-----E-KTEWHRVVLFGK-LAEVAGEYLRKGSQVYV
SSB2_SALTI       GAVVNLSLATSDTWTDKQTGDKK-----E-RTEWHRVVLYGK-LAEIASEYLRKGSQVYI
SSB_PROVU        GAVANLTLATSETWRDKQTGESK-----E-KTEWHRVVLFGK-LAEITGEFVKKGSQIYI
SSB_BUCAI        NAVVNMTLATSENWKDKNTGENK-----E-KTEWHRIVLFGK-LAEIAGEYLRKGSQVYI
SSB_BUCAP        NAVVNMTLATSENWKDKNTGENK-----E-KTEWHRIVLFGK-LAEIAGEYLRKGSQVYI
SSB_BUCBP        SAVTNITLATSETWKDKNNGEIK-----E-KTEWHRIVFFNK-LAEIAGEYLKKGSQVYI
SSB_WIGBR        NAITNLSLATSENWRDKNTGESK-----E-KTEWHRVILFGK-LAEVAGEYLKKGSQVYI
SSB2_ECOLX       GAVANLQVATSETWRDKQTGKMR-----E-QTEWHRVVLFGK-LAEVAGEYLRKGAQVYI
SSBF_ECOLI       GAVANLQVATSESWRDKQTGEMR-----E-QTEWHRVVLFGK-LAEVAGECLRKGAQVYI
SSB7_ECOLX       GAVANLQVATSESWRDKQTGEIR-----E-QTEWHRVVLFGK-LAEVAGEYLRKGAQVYI
SSBP_ECOLX       GAVANLQVATSESWRDKQTGEMR-----E-QTEWHRVVLFGK-LAEVAGEYLRKGAQVYI
SSBR_ECOLX       GAVANLQVATSESWRDKQTGEMR-----E-QTEWHRVVLFGK-LAEVAGEYLRKGAQVYI
SSB2_SALTY       GAVANLTLATSETWRVRQDGEMR-----E-HTEWHRVVVFGK-LAEIASEYLRKGAQVYI
SSB_PSEPK        NAVTNLSLATSEQWTDKQSGQKV-----E-RTEWHRVSLFGK-VAEIAGEYLRKGSQCYI
SSB2_PSEPU       NAVTNLSLATSEQWTDKQTGQKV-----E-RTEWHRVSLFGK-VAEIAGEYLRKGSQCYI
SSB1_PSEPU       NAVTNLSLATSEQWTDKQTGQKV-----E-KTERHRVSLFGK-VAEIAGEYLRKGSQVYI
SSB_PSESM        NAVTNLSLATSEQWTDKQSGQKV-----E-KTEWHRVSMFGK-VAEIAGEYLRKGSQVYI
SSB_PSEAE        NAVTNITLATSESWKDKQTGQQQ-----E-RTEWHRVVFFGR-LAEIAGEYLRKGSQVYV
SSB_COXBU        NAVANVTLATSTTWRDKQTGELQ-----E-RTEWHRIAFFNR-LAEIVGEYLRKGSKIYI
SSB_SHEON        NAVANITVATSESWKDQQ-GQQQ-----E-RTEWHRVVLFGK-LAEITGEYLRKGSQVYL
SSB_SHEHA        NAVANFTVATSESWKDQQ-GQPQ-----E-RTEWHNIVMYRR-LAEIAGEYLKKGSKIYI
SSB_HAEDU        EAVANISVATSESWTDKNTGERR-----E-VTEWHRIVFYRR-QAEVAGQYLRKGSQVYV
SSB_HAEIN        DAVANISVATSESWNDRNTGERR-----E-VTEWHRIVFYRR-QAEICGEYLRKGSQVYV
SSB_PASMU        EAVANISVATSESWIDKNTNERR-----E-VTEWHRIVFYRR-QAEVAGEYLRKGSKVYV
SSB_CUPNH        DAVANLRIATTDRYKDKQSGEMK-----E-ATEWHRVSMFGK-LAEIAGQYLRKGSSVYI
SSB_NITEU        DAMANLNIATTDTWKDK-GGEKQ-----E-RTEWHRVVMFGK-QAEIAGEYLKKGSQIYI
SSB_BORBR        AAICNVSIATTSQWKDKASGERR-----E-ETEWHRVVMYNR-LAEIAGEYLKKGRSVYI
SSB_BORPE        AAICNVSIATTSQWKDKASGERR-----E-ETEWHRVVMYNR-LAEIAGEYLKKGRSVYI
SSB_BORPA        AAICNVSIATTSQWKDKASGERR-----E-ETEWHRVVMYNR-LAEIAGEYLKKGRSVYI
SSB_RALSO        DAVTNIRVATTDRYKDKASGEMR-----E-ATEWHRIAFFGR-LAEIAGEYLKKGSQVYV
SSB1_XYLFA       TPTVTVSVATTDTWKDKDTGNKE-----E-KTEWHRVVFFGG-LAEIVGEFLKKGSQIYV
SSB_XANAC        MAITRVSLATTSMRKDR-DGNNQ-----E-RTEWHRVVFFGK-LGEIAGEYLRKGSQVYV
SSB_XANCP        MAITRVSLATTSMRKDR-EGNNQ-----E-RTEWHRVVFFGK-LGEIAGEYLRKGSQVYV
SSB_XYLFT        MTITTISLATTSVRKDK-DGNTQ-----E-RTEWHRVKFFGK-LGEIAGEYLRKGSQCYI
SSB2_XYLFA       MTITTISLATTSVRKDK-EGNTQ-----E-RTEWHRVKFFGK-LGEIAGEYLRKGSQCYI
SSB_NEIMA        EAVCNFSVATSETWNDR-NGQRV-----E-RTEWHNITMYRK-LAEIAGQYLKKGGLVYL
SSB_NEIMB        EAVCNFSVATSETWNDR-NGQRV-----E-RTEWHNITMYRK-LAEIAGQYLKKGGLVYL
SSB1_CHLTE       QSVVNFTLATSEGFKDS-SGNLQ-----E-RTEWHRIVAWGK-LADICSQYLKKGRQVYI
SSB_BRUA2        DMVANLRIATSESWRDRQTGERK-----D-RTEWHSVVIFNENLAKVAEQYLKKGAKVYI
SSB_BRUAB        DMVANLRIATSESWRDRQTGERK-----D-RTEWHSVVIFNENLAKVAEQYLKKGAKVYI
SSB_BRUSU        DMVANLRIATSESWRDRQTGERK-----D-RTEWHSVVIFNENLAKVAEQYLKKGAKVYI
SSB_BRUME        DMVANLRIATSESWRDRQTGERK-----D-RTEWHSVVIFNENLAKVAEQYLKKGAKVYI
SSB_RHILO        EPVVNIRIATSESWRDKNSGERK-----E-KTEWHNVVIFNEGIAKVAEQYLKKGMKVYV
SSB_CAUVC        DRVANLRIATSETWRDRSSGERK-----E-KTEWHRVVIFNDNLVKVAEQYLRKGSTVYI
SSB_AGRFC        RPIANLRIATSETWRDRNSGERK-----E-KTEWHTVVVFNEGLCKVVEQYVKKGAKLYI
SSB_RHIME        RPIANLRIATSETWRDRNSGERR-----E-KTEWHTVVVFNEGLCKVVEQYVKKGAKLYI
SSB_BRADU        RPIANLSIATSETWRDKNSGERK-----E-KTEWHRVVIFNEGLCKVAEQYLKKGAKVYI
SSB_RHOS4        GKVVNLRIATSEQWRDRASGERK-----E-RTEWHSVAIFDENLARVAEQYLRKGSTVYI
SSB_RICTY        KKIINLSLATTETWKDRITSERK-----E-RTEWHRVVIFSEGLVSIVERYVTKGSKLYI
SSB_RICPR        KKIINLSLATTETWKDRITSERK-----E-RTEWHRVVIFSEGLVSIVERYVTKGSKLYI
SSB_RICFE        KKIINLSLATTETWKDRITSERK-----E-RTEWHRVVIFSEGLVSVVERYVTKGSKLYI
SSB_RICCN        KKIINLSLATTETWKDRITSERK-----E-RTEWHRVVIFSEGLVSVVERYVTKGSKLYI
SSB_RICBR        KEIANLSLATTDIWKDRVTGEKK-----E-KTEWHRVVIFNEGLVSVVKNYVKKGSKLYI
SSB_BACTN        SAVATFPLATTDRGYTLANGTQI-----PERTEWHNIVASNR-LAEIVDKYVHKGDKLYL
SSB_CHLMU        KRVVVLRLGVKSRVGSK------------DETVWCRCNIWNN-RYDKMIPYLKKGSSVIV
SSB_CHLTR        KRVVVLRLGVKSRVGSK------------DETVWCRCNIWNN-RYDKMLPYLKKGSSVIV
SSB_CHLCV        KRVVVLRLGVKSRIGTK------------DETVWCKCNVWHN-RYDKMLPYLKKGSGVIV
SSB_CHLPN        KRVITLRLGVKTRVGMK------------DETVWCKCNIWHN-RYDKMLPYLKKGSGVIV
SSB_BACCR        VAVATFTLAVNRAFANQQGE---------READFINCVIWRK-QAENVANYLKKGSLAGV
SSB_BACAN        VAVATFTLAVNRAFANQQGE---------READFINCVIWRK-QAENVANYLKKGSLAGV
SSBA_BACSU       AAVATFTLAVNRTFTNQSGE---------READFINCVTWRR-QAENVANFLKKGSLAGV
SSB1_LISMO       VAVATFTLAVNRTFTNQQGE---------READFINCVVWRK-PAENVANFLKKGSMAGV
SSB1_LISIN       VAVATFTLAVNRTFTNQQGE---------READFINCVVWRK-PAENVANFLKKGSMAGV
SSB2_LISIN       AAVATFTLAVNRTFTNQQGE---------READFIQCVVWRK-PAENAANFLKKGSMAGV
SSB2_LISMO       VAVATFTLAVNRTFTNQNGE---------READFINCVVWRK-PAENVANFLKKGSMAGV
SSB3_LISIN       VAVATFTLAVNRPFKNGQGE---------QEADFIQCVVWRK-PAENVANFLKKGSLAGV
SSB_BACHD        VAVANFTLAVNRPFSNQQGE---------READFINCVVWRK-QAENVANYLKKGSLAGV
SSB_OCEIH        VAVANFNIAVNRPFSNQQGN---------READFINCVIWRR-PAENLANYMKKGSMVGV
SSB2_STAAS       VSVATFTLAVNRTFTNAQGE---------READFINCVVFRR-QADNVNNYLSKGSLAGV
SSB1_STAAC       VSVATFTLAVNRTFTNAQGE---------READFINCVVFRR-QADNVNNYLSKGSLAGV
SSB_STAAR        VNVASFTLAVNRTFTNAQGE---------READFINIIVFKK-QAENVNKYLSKGSLAGV
SSB1_STAAM       VNVASFTLAVNRTFTNAQGE---------READFINIIVFKK-QAENVNKYLSKGSLAGV
SSB_STAAN        VNVASFTLAVNRTFTNAQGE---------READFINIIVFKK-QAENVNKYLSKGSLAGV
SSB1_STAAS       VNVASFTLAVNRTFTNAQGE---------READFINIIVFKK-QAENVNKYLSKGSLAGV
SSB_STAAW        VNVASFTLAVNRTFTNAQGE---------READFINIIVFKK-QAENVNKYLSKGSLAGV
SSB2_STAAM       VNVGTFTLAVNRTFTNAQGE---------READFINVVVFKK-QAENVKNYLSKGSLAGV
SSB2_STAAC       VNVGTFTLAVNRTFTNAQGE---------READFINVVVFKK-QAENVKNYLSKGSLAGV
SSB2_LACLA       QAVATFSLAVNRQFKNANGE---------READFINCVIWRQ-QAENLANWAKKGALIGV
SSB1_LACLA       QAVGTFGLAVNRQFKNANGE---------READFINCVIWRQ-QAENLAKFAKKGALIGI
SSB1_STRA3       QAVATFSLAVNRNFKNQSGE---------READFINCVIWRQ-QAENLANWAKKGALVGI
SSB1_STRA5       QAVATFSLAVNRNFKNQSGE---------READFINCVIWRQ-QAENLANWAKKGALVGI
SSB2_STRP6       VAVATFTLAVNRTFKSQNGE---------READFINCVIWRQ-PAENLANWAKKGALIGV
SSB_STRP1        VAVATFTLAVNRTFKSQNGE---------READFINCVIWRQ-PAENLANWAKKGALIGV
SSB_STRP3        VAVATFTLAVNRTFKSQNGE---------READFINCVIWRQ-PAENLANWAKKGALIGV
SSB_STRPQ        VAVATFTLAVNRTFKSQNGE---------READFINCVIWRQ-PAENLANWAKKGALIGV
SSB2_STRP8       VAVATFTLAVNRTFKSQNGE---------READFINCVIWRQ-PAENLANWAKKGALIGI
SSB_STRMU        QAVATFTLAVNRNFKNQNGE---------READFINIVIWRQ-QAENLANWAKKGTLLGI
SSB3_STRA5       QAVATFSLAVNRNFKNQSGE---------READFINCVIWRQ-QAENLANWAKKGALVGI
SSB_STRPN        VAVATFTLAVNRTFKSQNGE---------READFINVVMWRQ-QAENLANWAKKGSLIGV
SSB_STRR6        VAVATFTLAVNRTFKSQNGE---------READFINVVMWRQ-QAENLANWAKKGSLIGV
SSB1_STRP8       VACAQFTLAVNRNFKNQDGQ---------KEADFINCVIWRK-SAENLSNWAKKGQLIAI
SSB4_STRA5       IANATFNLAVNRNFKNAAGD---------READFINCVMWRQ-QAENLANWTKKGMLIGI
SSB_ENTFA        SAVATFTLAVNRNFTNQNGD---------READFINCVIWRK-PAETMANYARKGTLLGV
SSB_LACPL        AAVATFTIAVNRQFTNQNGE---------READFISCVIWRK-AAENFANFTHKGSLVGI
SSBB_BACSU       AAVAHVTLAVNRSFKNASGE---------IEADYVNCTLWRK-TAENTALYCQKGSLVGV
SSB_CALS4        VPVTTFTLAVNRNYVSQSGE---------RPTDFIPIVTWRK-LAEICANNLKKGRLVAV
SSB2_STRA3       KSVTRATVAVNRRFKGSNGE---------READFINVVMWGR-LAETLASYGTKGSLISV
SSB2_STRA5       KSVTRATVAVNRRFKGSNGE---------READFINVVMWGR-LAETLASYGTKGSLISI
SSB1_STRP6       KHVARLSLAVNRRFKNASGE---------READFISVVVWGK-LAETLVSYASKGSLMSI
SSB3_CLOAB       TAVASFTLAVDRRFKKE-GQ---------QEADFIPIVVWGK-QAESTANYMSKGKLMGV
SSB2_CLOAB       TATCNFTLAVDRRFKKE-GQ---------QEADFIPIVVWGK-QAESTANYMSKGKLMGV
SSB_CLOTE        TAVTTFVLAVDRRFSKD-GK---------NEADFIPVVVWGK-QAESTANYMSKGKLIGI
SSB1_CLOAB       NNRCNFTIAVNRRVRNTNGE---------NEADFIPVTVWGK-TAENVARYMKKGYLVGV
SSB_CLOPE        TAVARFTLAVNRQFKKD-------------EADFISCIAFGK-TGETIAQYITKGRQLAV
SSB_UREPA        RLVTNFTIAVNDNTPNA-------------NANFIRCVAWNN-QANFLTTYLKKGDAIAI
SSB_THEMA        TPVTTFTIAVDRVPRKNAPDDA-------QTTDFFRIVTFGR-LAEFARTYLTKGRLVLV
SSB_AQUAE        TPVVEFTLAYNRRYKNQNGEFQ-------EESHFFDVKAYGK-MAEDWATRFSKGYLVLV
SSB_WOLSU        SALAKIGIATNRRFKKQDGSQG-------DEVCFVDVNLFGR-TAEIANQYLKKGSKILI
SSB_HELHP        SALATIGLASNRRFKKQDGSQG-------EEVCFIDVKLFGR-SAEVANQYLRKGSKILI
SSB_HELPY        SAAATIGLATSRRFKKQDGTLG-------EEVCFIDARLFGR-TAEIANQYLSKGSSVLI
SSB_HELPJ        SAAATIGLATSRRFKKQDGTLG-------EEVCFIDARLFGR-TAEIANQYLSKGSSVLI
SSB_CAMJE        SAIGASAIAVTRRFTAN-GEKR-------EETCFIDISFYGR-TAEVANQYLTKGSKVLI
SSB_LEPIC        KSVATFTLAVNHDYKSTLEE-P-------GEVSFVEIELWDR-QAVNAHEYLKKGKKATV
SSB_LEPIN        KSVATFTLAVNHDYKSTLEE-P-------GEVSFVEIELWDR-QAVNAHEYLKKGKKATV
SSB_RHOBA        MAVAEFSIAVNEKRKASDGQWV-------EDVSFFEITLFGR-TAEVASEYLSKGSPIFV
SSB_TREPA        GALCRFSVAINRRRKSG-DDWV-------EEVNFFDIVLWGR-QGEVISQYLIKGKQVAV
SSB_BORBU        MAVLRFSIANNRRMKKN-DEWI-------DYPQYFDCVIFSK-RAESLNDYLKKGKQVVV
SSB_ANAVA        SVKCRLTLAVNRRS------KN-------DKPDWFTLELWDK-TAEVAGNYVRKGSLIGV
SSB1_NOSS1       SVKCRLTLAVNRRS------KN-------DKPDWFTLELWDK-TAEVAGNYVRKGSLIGV
SSB_THEEB        SVKCRLTLAVNRPS------KD-------DQPDWFNLEIWGK-TAQVAADYVRKGTLLGI
SSB1_SYNY3       NVVCNFTLAVNRRTSK----KD-------EPPDWFDLEIWGK-TAEIAGNYVKKGSLIGI
SSB2_NOSS1       AVKASISIAVRPPY------RS-------EQALWFDLVAWGN-QAEVIGNYVRKGTQIAI
SSB_PAEAU        SAVANFTIASTPRTFDRQSNEWK-----DGETLFLRASVWRE-AAENVAESLTKGTRVIV
SSB_PAENI        SAVANFTIASTPRTFDRQASEWK-----DGETLFLRASVWRE-MAENVAGSLTKGTRVIA
SSB_MYCBO        AAVANFTVASTPRIYDRQTGEWK-----DGEALFLRCNIWRE-AAENVAESLTRGARVIV
SSB_MYCTU        AAVANFTVASTPRIYDRQTGEWK-----DGEALFLRCNIWRE-AAENVAESLTRGARVIV
SSB_MYCLE        AAVVNFTVASTPRIYDRQSGEWK-----DGEALFLRCNIWRE-AAENVAESLTRGARVIV
SSB_MYCS2        AAVANFTVASTPRMFDRQSGEWK-----DGEALFLRCNIWRE-AAENVAESLTRGSRVIV
SSB2_STRCO       AAVAKFRVASTPRTFDRQTNEWK-----DGESLFLTCSVWRQ-AAENVAESLQRGMRVIV
SSB1_STRAW       AAVAKFRVASTPRTFDRQTNEWK-----DGESLFLTCSVWRQ-AAENVAESLQRGMRVIV
SSB_CORGL        AAVANFRIASTPRSFNRQTNQWE-----DGEALFLTVNVWRQ-AAENVAESLSKGMRVIV
SSB_COREF        AAVANFRIASTPRTFNRTTNQWE-----DGEGLFLTCNVWRE-AAENVAESLTKGMRVIV
SSB_BIFLO        VTVASFTIASTPRTWNRQTNQFE-----DGQALFMRCSAWRD-LADHCAQSLKKGMRVIA
SSB1_TROWT       AAVVNMTIASTPRMYDRQSGEWK-----DGEPLFLRGILWRE-YAINAAASLAKGMRVVA
SSB1_TROW8       AAVVNMTIASTPRMYDRQSGEWK-----DGEPLFLRGILWRE-YAINAAASLAKGMRVVA
SSB2_TROW8       VHITSFRLAAQDRHFSRNANSWV-----SGDTNWFTVTGFRA-LGSNAAESISKGDRVIV
SSB2_TROWT       VHITSFRLAAQDRHFSRNANSWV-----SGDTNWFTVTGFRA-LGSNAAESISKGDRVIV
SSB2_STRAW       AS-ARFRLAVTSRYWDREKSEWK-----DGHTNFFTVWANRA-LATNVGASLSVGDPVVV
SSB1_STRCO       PS-VRFRLAVTARYWDREKNAWT-----DGHTNFFTVWANRQ-LATNASGSLAVGDPVVV
SSBP_RABIT       NPVTIFSLATNEMWRSGDNETYQ-MGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYV
SSBP_BOVIN       NPDTIFSLATNEMWRSGENETYQ-MGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYV
SSBP_RAT         NPVTIFSLATNEMWRSGDNEAYQ-MGDVSQKTTWHRISVFRPGLRDVAYQYVKKGARIFV
SSBP_HUMAN       NPVTIFSLATNEMWRSGDSEVYQ-LGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYL
SSBP_PONAB       NPVTIFSLATNEMWRSGDSEVYQ-LGDISQKTTWHRISVFRPGLRDVAYQYVKKGSRIYL
SSBP_MOUSE       NPVTIFSLATNEMWRSGDSEVYQ-MGDVSQKTTWHRISVFRPGLRDVAYQYVKKGARIFV
SSBPA_XENLA      NPVTIFSLATNELWRSGESETFHTAGDVNQKTTWHRISVFRPGLRDVAYQHVKKGARLLV
SSBPB_XENLA      NPVTIFSLATNELWRSGENEVFQPAGDVNQKTTWHRVSVFRPGLRDVAYQHVKKGARLLV
SSBP_DROME       HPVVTFSVATHTNYKYEN-------GDWAQRTDWHRVVVFKPNLRDTVLEYLKKGQRTMV
SSB_FUSNN        KAYSRFSIAVDRPFQSSSDKNSQ-------TADFINCVAFGK-TAEFIGEYFRKGRKILL
SSB_MYCPE        ITQSRISIASSDNWNKN-------------ETYFFPCVAWQS-TANFINSYLHKGDLVAI
SSB_ONYPE        GKIPKVNFQLAVNNKD--------------TTQFIPCVVFRN-QADNMFMYLHKGSKVYV
SSB2_CHLTE       TPVVNFSIACNRRFRDSNHQWQE-------DVCYVGVVAWNK-LAESCRDNLRKSSAVLV
SSB_MYCPU        ISYSRFTIAVDRRNFSSQRSEN--------ITDYIPVVAWRG-LSEFIKKNVFKGTLVSV
SSB_STAES        NKIATFCVATERNYKDDNNE---------ISTDYLLCKAFGK-TATNIEKYTSQGTLVGI
                        .                                              .     

SSB_SERMA        EGSLQTRKWQDQ-SGQDRYTTEI-VVNVGGTMQMLGGRQG-GGAPAG-----Q-------
SSB_YERPE        EGALQTRKWQDQ-SGQERYTTEV-VVNVGGTMQMLGGRQG-GGAPAGGGAAPQ-------
SSB_ECO57        EGQLRTRKWTDQ-SGQDRYTTEV-VVNVGGTMQMLGGRQG-GGAPAGGNIG---------
SSB_ECOL6        EGQLRTRKWTDQ-SGQDRYTTEV-VVNVGGTMQMLGGRQG-GGAPAGGNIG---------
SSB_ECOLI        EGQLRTRKWTDQ-SGQDRYTTEV-VVNVGGTMQMLGGRQG-GGAPAGGNIG---------
SSB_SHIFL        EGQLRTRKWTDQ-SGQDRYTTEV-VVNVGGTMQMLGGRQG-GGAPAGGNIG---------
SSB1_SALTI       EGQLRTRKWTDQ-SGQERYTTEINVPQIGGVMQMLGGRQG-GGAPAG-------------
SSB1_SALTY       EGQLRTRKWTDQ-SGQERYTTEINVPQIGGVMQMLGGRQG-GGAPAG-------------
SSB_PROMI        EGQLQTRKWQDQ-SGQDRYSTEV-VVNIGGTMQMLGGR-G-GQDNAP-------------
SSB_VIBCH        EGQLQTRKWQDQ-SGQDRYSTEVVVQGYNGIMQMLGGRAQQGGMPAQGGMNV--------
SSB_VIBVU        EGQLQTRKWQDQ-NGQDRYSTEVVVQGYNGIMQMLGGRQQQGGAPAMGGAP---------
SSB_VIBPA        EGQLQTRKWQDQ-SGQDRYSTEVVVQGFNGVMQMLGGRAQ-GGAPAMGGQQ---------
SSB2_SALTI       EGALRTRKWTDQ-SGVEKYTTEV-VVSQSGTMQMLGGRNS-AGSGQQQ------------
SSB_PROVU        EGALQTRKWTDQ-AGVEKYTTEV-VVNVGGTMQMLGGRQG-GNDNQNNNAG---------
SSB_BUCAI        EGSLQTRKWQDQ-NGLERYTTEI-IVNIGGTMQMLGNRNSN-------------------
SSB_BUCAP        EGSLQTRKWQDQ-NGLERYTTEV-IVNIGGTMQMLGNRNSN-------------------
SSB_BUCBP        EGSLQTRKWKDQ-NGIERYITEI-IVSVGGTMQMLGSRNSSSL-----------------
SSB_WIGBR        EGNLQTRKWQDQ-NGQDRYITEI-VVGINGCMQMLGNRASYDYT----------------
SSB2_ECOLX       EGQLRTRSWED--NGITRYVTEI-LVKTTGTMQMLGRAAGAQTQPEEG------------
SSBF_ECOLI       EGQLRTRSWED--NGITRYVTEI-LVKTTGTMQMLVRAAGAQTQPEEG------------
SSB7_ECOLX       EGQLRTRSWED--NGITRYVTEI-LVKTTGTMQMLGRAAGTQTQPEEA------------
SSBP_ECOLX       EGQLRTRSWDD--NGITRYITEI-LVKTTGTMQMLGSAPQQNAQAQPK------------
SSBR_ECOLX       EGQLRTRSWDD--NGITRYITEI-LVKTTGTMQMLGSAPQQNAQAQPK------------
SSB2_SALTY       EGQLRTRKWTDQ-SGQDKYTTEV-IVNVGGTMQMLGRHNSQPQQEPQT------------
SSB_PSEPK        EGKLQTREWE-K-DGIKRYTTEI-IVDINGTMQLLGGRPQGQQQ----GGD---------
SSB2_PSEPU       EGKLQTREWE-K-DGIKRYTTEI-IVDMQGTMQLLGGRPQNQQQ----GGD---------
SSB1_PSEPU       EGKLQTREWE-K-DGIKRYTTEI-VVDMQGTMQLLGGRPQ--------------------
SSB_PSESM        EGKLQTREWE-K-DGIKRYTTEI-VVDMQGTMQLLGGRPQGDAQQGQGGGG---------
SSB_PSEAE        EGSLRTRKWQGQ-DGQDRYTTEI-VVDINGNMQLLGGRPSGDDS----------------
SSB_COXBU        EGSLRTRKWQDK-NGVDRYTTEI----IANEMHMLDNRGGGNSG----------------
SSB_SHEON        EGKLQTRKWKDQ-SGQDRYSTEV-VIDQSGSMQMLGSRNQGGQGAPMGGMPQNGGYQSAP
SSB_SHEHA        EGKLQTSKWQDQATGQDRYKTEI-NASE---MQMLDSRGQGGGQQGGGDYGQQQNQYNAP
SSB_HAEDU        EGRLKTRKWQDQ-NGQDRYTTEI----QGDVLQMLGGRNQAGDVATH-------------
SSB_HAEIN        EGRLKTRKWQDQ-NGQDRYTTEI----QGDVMQMLGGRNQ--NAGGY-------------
SSB_PASMU        EGRLKTRKWQDQ-NGQDRYTTEI----QGDVLQMLDSRNE--------------------
SSB_CUPNH        EGRIRTRKWQDQS-GQDKYSTEI----VADQMQMLGGRGGAS--DG--------------
SSB_NITEU        EGRLQTRKWTDKS-NVERYTTEI----VADRMQMLGGRSGG----G--------------
SSB_BORBR        EGRLKTRKWQDKDTGADRYSTEI----VADQMQMLGGRDSGGDSGG--------------
SSB_BORPE        EGRLKTRKWQDKDTGADRYSTEI----VADQMQMLGGRDSGGDSGG--------------
SSB_BORPA        EGRLKTRKWQDKDTGADRYSTEI----VADQMQMLGGRDS----GG--------------
SSB_RALSO        EGRLKTRQWE-KD-GQKQYSTEI----VAEQMQMLGSRQGMGGEGG--------------
SSB1_XYLFA       EGALRSRNWTDKE-GNKRYTTEI----MAKEMQMLGKKQD--------------------
SSB_XANAC        EGELRYDKYTGQD-GVEKYSTDI----VANEMQMLGGRGEGGGGG---------------
SSB_XANCP        EGELRYDKYTGQD-GVEKYSTDI----VANEMQMLGGRGEGGGGGG--------------
SSB_XYLFT        EGSIRYDKFTGQD-GQERYVTEI----VADEMQMLGGRSDGGGMG---------------
SSB2_XYLFA       EGSIRYDKFTGQD-GQERYVTEI----VADEMQMLGGRSDGGGMG---------------
SSB_NEIMA        EGRIQSRKYQGK-DGIERTAYDI----VANEMKMLGGRNENSGGAPYEEGYG--------
SSB_NEIMB        EGRIQSRKYQGK-DGIERTAYDI----VANEMKMLGGRNENSGGAPYEEGYG--------
SSB1_CHLTE       EGRLQTRSWDDNKTGDKKYATEI----VCTDMQMLGAKDSGGG-----------------
SSB_BRUA2        EGALQTRKWQDQ-NGNDRYSKEIVLQKFRGELQMLDSRS-EGGEGRSF------------
SSB_BRUAB        EGALQTRKWQDQ-NGNDRYSKEIVLQKFRGELQMLDSRS-EGGEGRSF------------
SSB_BRUSU        EGALQTRKWQDQ-NGNDRYSTEIVLQKFRGELQMLDSRS-EGGEGRSF------------
SSB_BRUME        EGALQTRKWQDQ-NGNDRYSTEIVLQKFRGELQMLDSRS-EGSEGRSF------------
SSB_RHILO        EGQLQTRKWQDQ-TGADKYTTEVVLQRFRGELQMLDGRQGEGGQVGGY------------
SSB_CAUVC        EGALQTRKWTDN-TGQEKYSTEIVLQKFRGELTMLGGRG---GDAGMS------------
SSB_AGRFC        EGQLQTRKWQDQ-TGNDRYSTEIVLQGFNSTLTMLDGRG-EGGGGR--------------
SSB_RHIME        EGQLQTRKWQDQ-TGNDRYSTEVVLQGFNSTLTMLDGRGGEGGGAG--------------
SSB_BRADU        EGALQTRKWTDQ-SGVEKYSTEVVLQGFNSTLTMLDGRG--GGGGG--------------
SSB_RHOS4        EGQLETRKWQDQ-SGQDRYSTEVVLRPFRSSLTMLGGRG-EGAGAGGG------------
SSB_RICTY        EGSLQTRKWNDN-SGQEKYTTEVVLQNFNSQLILLDNKN-SNNHT-QG------------
SSB_RICPR        EGSLQTRKWNDN-SGQEKYTTEVVLQNFNSQLILLDHKN-SNQNT-QG------------
SSB_RICFE        EGSLQTRKWNDN-SGQEKYTTEVVLQNFNSQLILLDSKN-SNNHT-QD------------
SSB_RICCN        EGSLQTRKWNDN-SGQEKYTTEVVLQNFNSQLILLDSKN-SNNHN-QD------------
SSB_RICBR        EGSLQTRKWNDS-SGVEKYTTEIVLQNFNSQLILLDSKN-STSSSLQD------------
SSB_BACTN        EGKIRTRSYSDQ-SGAMRYITEI----FVDNMEMLSPKGANTGAGAPQ------------
SSB_CHLMU        AGELS-VESYMGRDGSPQASISV----SVDTLKF-----NSGSSRPESR-----------
SSB_CHLTR        AGELS-LESYVGRDGSPQASISV----SVDTLKF-----NSGSSRPDAR-----------
SSB_CHLCV        AGDIS-VESYMSKDGTPQSSLVI----SVDTIKFSPFGRNE-SRSLSLL-----------
SSB_CHLPN        AGDIS-VESYMSKDGSPQSSLVI----SVDSLKFSPFGRNEGSRSPSL------------
SSB_BACCR        DGRLQ-TRNYEGQDGKRVYVTEV----LAESVQFLEPRNGGGEQRGS-------FNQQPS
SSB_BACAN        DGRLQ-TRNYEGQDGKRVYVTEV----LAESVQFLEPRNGGGEQRGS-------FNQQPS
SSBA_BACSU       DGRLQ-TRNYENQQGQRVFVTEV----QAESVQFLEPKNGGGSGSGG-------YNEGNS
SSB1_LISMO       DGRVQ-TRNYEGNDGKRVYVTEI----VAESVQFLEPRNSNGGGGNN-YQSGNNNNNYNS
SSB1_LISIN       DGRVQ-TRNYEGNDGKRVYVTEI----VAESVQFLEPRNSNGGGGNNNYQGGNNNNNYNN
SSB2_LISIN       DGRIQ-TRNYEDSDGKRVFVTEV----VAESVQFLEPRN-HAEGATS--------NNYQ-
SSB2_LISMO       DGRVQ-TRNYEDNDGKRVFVTEV----VAESVQFLEPKNNNVEGATS--------NNYQ-
SSB3_LISIN       DGRVQ-TRNYEGNDGKRVYVTEI----VAESVQFLESKQNGAGGSTS--------NNNQ-
SSB_BACHD        DGRIQ-TRSYDNNEGRRVFVTEV----MAESVQFLEPRGSQSQGGSN-------VDNFGG
SSB_OCEIH        DGRIQ-TRNFEGQDGKTVYVTEV----VADSVQFLETKGSQGGQDSS--------GGYQ-
SSB2_STAAS       DGRLQ-SRNYENQEGRRVFVTEV----VCDSVQFLEPKNAQQNGGQRQ------QNEFQD
SSB1_STAAC       DGRLQ-SRNYENQEGRRVFVTEV----VCDSVQFLEPKNAQQNGGQRQ------QNEFQD
SSB_STAAR        DGRLQ-TRNYENKEGQRVYVTEV----VADSIQFLEPKNS----NDTQ------QDLYQQ
SSB1_STAAM       DGRLQ-TRNYENKEGQRVYVTEV----IADSIQFLEPKNS----NDTQ------QDLYQQ
SSB_STAAN        DGRLQ-TRNYENKEGQRVYVTEV----IADSIQFLEPKNS----NDTQ------QDLYQQ
SSB1_STAAS       DGRLQ-TRNYENKEGQRVYVTEV----VADSIQFLEPKNT----DDNQ------QDLYQQ
SSB_STAAW        DGRLQ-TRNYENKEGQRVYVTEV----VADSIQFLEPKNT----DDNQ------QDLYQQ
SSB2_STAAM       DGRLQ-TRNYENKDGQRVFVTEV----VADSVQFLEPKNN----NQQQ------NNNYQQ
SSB2_STAAC       DGRLQ-TRSYDNKEGRRVFVTEV----VADSVQFLEPKNN----NKQ--------NNQQH
SSB2_LACLA       TGRIQ-TRNYENQQGQRVYVTEV----VADSFQMLESRSAREGMGG--------------
SSB1_LACLA       TGRIQ-TRNYENQQGQKVYVTEV----VADTFQMLES-----------------------
SSB1_STRA3       TGRIQ-TRNYENQQGQRVYVTEV----VAESFQLLESRATREGGSP--------------
SSB1_STRA5       TGRIQ-TRNYENQQGQRVYVTEV----VAESFQLLESRATREGGSP--------------
SSB2_STRP6       TGRIQ-TRNYENQQGQRVYVTEV----VADNFQMLESRATREGGST--------------
SSB_STRP1        TGRIQ-TRNYENQQGQRVYVTEV----VADNFQMLESRATREGGST--------------
SSB_STRP3        TGRIQ-TRNYENQQGQRVYVTEV----VADNFQMLESRATREGGST--------------
SSB_STRPQ        TGRIQ-TRNYENQQGQRVYVTEV----VADNFQMLESRATREGGST--------------
SSB2_STRP8       TGRIQ-TRNYENQQGQRVYVTEV----VADNFQMLESRATREGGST--------------
SSB_STRMU        TGRIQ-TRNYENQQGQRVYVTEV----VADNFQILESRATREGQS---------------
SSB3_STRA5       TGRIQ-TRNYENQQGQRIYVTEV----VAENFQLLESRNSQ-------------------
SSB_STRPN        TGRIQ-TRSYDNQQGQRVYVTEV----VAENFQMLESRSVREGHTG--------------
SSB_STRR6        TGRIQ-TRSYDNQQGQRVYVTEV----VAENFQMLESRSVREGHTG--------------
SSB1_STRP8       TGRIQ-TRNYENQQGQRVYVTEV----VAESFQILEKRDNT-------------------
SSB4_STRA5       TGRIQ-TRSYENQQGQRIYVTEV----VADSFQILEKRDNS-------------------
SSB_ENTFA        VGRIQ-TRNYENQQGQRVYVTEV----VCENFQLLESRSASEQRGTGGGSFNNNENGYQS
SSB_LACPL        DGRIQ-TRNYENQQGVRVYVTEV----VVENFSLLESRAESERHQAANGGS---------
SSBB_BACSU       SGRIQ-TRSYENEEGVNVYVTEV----LADTVRFMDPKPREKAAD---------------
SSB_CALS4        TGSIQ-TRTWDDSSGNRHWVTEV----VADDVRFLEPKSGFGSGSAP-------------
SSB2_STRA3       DGELR-TRKYE-KDGQTHYITEV----LASSFQLLESRSQR-------------------
SSB2_STRA5       DGELR-TRKYE-KDGQTHYITEV----LASSFQLLESRAQR-------------------
SSB1_STRP6       DGELR-TRKYD-KDGQVHYVTEV----LCQSFQLLESRAQR-------------------
SSB3_CLOAB       SGRIQ-TRSYDAKDGTRRYVTEI----VAEEVQFLEWG-SSNNNSMAN------------
SSB2_CLOAB       SGRIQ-TRSYDAKDGTRRYVTEV----VAEEVKFLEWG-KDSN-----------------
SSB_CLOTE        SGRIQ-TRSYEAKDGTRRYVTEV----VADEVKFLEWGNKQSSGSQGF------------
SSB1_CLOAB       SGRLQ-VRTYQDVDGNRKYITEV----VGEEVQFLETK----------------------
SSB_CLOPE        SGNIR-TGSYEAQDGTRRYTTDV----VVESFDFIDSGNGGARGNSGF------------
SSB_UREPA        EGRIV-SRSYVDNNGKTNYVTEV----YADQVQSLSRRNQSPSDNNK-------------
SSB_THEMA        EGEMRMRRWETP-TGEKRVSPEV----VANVVRFMDRKP---------------------
SSB_AQUAE        EGRLSQEKWEK--EGKKFSKVRI----IAENVRLINRPK---------------------
SSB_WOLSU        EGRLVLESWTDQ-SGQKRSKHSV----TAESLQMLDSK------GASQGGYEGED--YSS
SSB_HELHP        EGRLSLESWNDQ-SGAKRSRHTI----TAESMQMLDSKP-----SGDENPYNNTN--ASN
SSB_HELPY        EGRLTYESWMDQ-TGKKNSRHTI----TADSLQFMDKKSDNPQANAMQDSIMHEN--SNN
SSB_HELPJ        EGRLTYESWMDQ-TGKKNSRHTI----TADSLQFMDKKSDNPQANSMQDSMTHEN--FNN
SSB_CAMJE        EGRLRFEQWSDQ-NGQNRSKHSI----QVENMEMLGNSN-----APQQGGNFGNNSFSNN
SSB_LEPIC        IGELRQDRWKAQ-DGSNRSKLKV----VGQMIRFDGLPG------KKE------------
SSB_LEPIN        IGELRQDRWKAQ-DGSNRSKLKV----VGQMIRFDGLPG------KKE------------
SSB_RHOBA        EGRLKQDTWEK--DGQKRSKVKV----IGERMQMIGGRG------ESGGGGGGGG-----
SSB_TREPA        EGELRQSRWEQE--GQSRSKVEI----SATNVQLLGSVL---------------------
SSB_BORBU        SGSLKYESWQDRNTGDKRSKVNI----FVDNLQMFSSG----------------------
SSB_ANAVA        KGSLKFDSWSDRQTGVNRSTPVI----RVDQLELLGSK----------------------
SSB1_NOSS1       KGSLKFDSWSDRQTGVNRSTPVI----RVDQLELLGSK----------------------
SSB_THEEB        KGSLKFDRWQDRNTGVDRSSPII----LVERMDILSSK----------------------
SSB1_SYNY3       QGSLKFDHWEDRNSGTPRSKPVI----RVNNLDLLGSK----------------------
SSB2_NOSS1       TGEFGFDRWADKNSGTMRQKPVI----TINTIELLGSP----------------------
SSB_PAEAU        SGRLK-SRSYETKEGEKRTVIEL----EVDEIGPSLRYANAKVNRTQRNNNQGA------
SSB_PAENI        SGRLK-SRSYETKEGDNRTVVEL----EVDEIGPSLRYANARVNRTQRSGNQNT------
SSB_MYCBO        SGRLK-QRSFETREGEKRTVIEV----EVDEIGPSLRYATAKVNKASRSGG---------
SSB_MYCTU        SGRLK-QRSFETREGEKRTVIEV----EVDEIGPSLRYATAKVNKASRSGG---------
SSB_MYCLE        TGRLK-QRSFETREGEKRTVVEV----EVDEIGPSLRYATAKVNKASRSGGGGG------
SSB_MYCS2        TGRLK-QRSFETREGEKRTVVEV----EVDEIGPSLRYATAKVNKASRSGGGGG------
SSB2_STRCO       QGRLK-QRSYEDREGVKRTVYEL----DVDEVGASLRSATAKVTKTSGQ-GRGGQ-----
SSB1_STRAW       QGRLK-QRSYEDREGVKRTVYEL----DVEEVGASLKNATAKVTKTTGRSGQGGQ-----
SSB_CORGL        TGRLK-QRSYETREGEKRSVFEV----EADEVGPSLTFAKADVQRTPRGGNSG-------
SSB_COREF        QGRLR-QRSYETREGEKRTIFEV----EVDDVGPSLKYAKAEVTRIPRGGGQGGFG----
SSB_BIFLO        TGRLQ-QRSYQAQDGSQRTVVEM----QLDEIGPSLRYATAQVTRQSSGQGGFQGRSGGF
SSB1_TROWT       VGKLK-QRNYETREGDRRTSVEL----EIDEIGPTLRYATAKCSRATQAGHGVSP-----
SSB1_TROW8       VGKLK-QRNYETREGDRRTSVEL----EIDEIGPTLRYATAKCSRATQAGHGVSP-----
SSB2_TROW8       YGRLR-LRTWG----DNKMAVEI----EAESFGHDLRWGTSVFSKRFYQLP---------
SSB2_TROWT       YGRLR-LRTWG----DNKMAVEI----EAESFGHDLRWGTSVFSKRFYQLP---------
SSB2_STRAW       QGRLK-VRTEAR-EGQNWTSADI----DALAVGHDLSRGTSAFRRPSAKDG---------
SSB1_STRCO       QGRLK-VRTDVR-EGQSRTSADI----DAVAIGHDLARGTAAFRRTART-----------
SSBP_RABIT       EGKVDYGEYMDK-NNVRRQATTI----IADNIVFLSDQTKEKA-----------------
SSBP_BOVIN       EGKVDYGEYTDK-NNVRRQATTI----IADNIIFLSDQIKEKP-----------------
SSBP_RAT         EGKVDYGEYMDK-NNVRRQATTI----IADNIIFLSDQAREKPLNG--------------
SSBP_HUMAN       EGKIDYGEYMDK-NNVRRQATTI----IADNIIFLSDQTKEKE-----------------
SSBP_PONAB       EGKIDYGEYMDK-NNVRRQATTI----IADNIIFLSDQTKEKE-----------------
SSBP_MOUSE       EGKVDYGEYMDK-NNVRRQATTI----IAGKKLVVHSVSGCSLEGLA-------------
SSBPA_XENLA      EGKIDYGEYTDK-NNVRRQATTI----IADNIIFLSDLR-DKL-----------------
SSBPB_XENLA      EGKIDYGEYTDK-NNVRRQATTI----IADNIIFLTDLR-DKP-----------------
SSBP_DROME       QGKITYGEITDQ-QGNQKTSTSI----IADDVLFFRDANN--------------------
SSB_FUSNN        NGRLQMSQYESE--GKKITTYVV----IADSVEFGEAKTSSGTTETSSYGR---------
SSB_MYCPE        DGKLIRRSYVSK-EGKTVYVIEI----VIESIKPLSSKNSNNAASSIDK-----------
SSB_ONYPE        EGTLSIEKYINN-ESENKTSTKV----IVQRVIFLDNKNQ--------------------
SSB2_CHLTE       DGELQSRTWKAQ-DGTSRTVVEI----KARRIQFLNKRKKNGEDDEEG------------
SSB_MYCPU        EGSLQSYIRSED--KNTSYEVNIENFSILESRQIIEERKSKIQGNHSMNSSFL-------
SSB_STAES        TGQMRSRKYEKE--GQTHFVTEL----YVETIKFMSPKNKNN------------------
                  * .                  :                                     

SSB_SERMA        -----------------------SAGGQGGWGQPQQPQ----------------------
SSB_YERPE        -----------------------DGGAQGGWGQPQQPQ----------------------
SSB_ECO57        -----------------------GGQPQGGWGQPQQPQ----------------------
SSB_ECOL6        -----------------------GGQPQGGWGQPQQPQ----------------------
SSB_ECOLI        -----------------------GGQPQGGWGQPQQPQ----------------------
SSB_SHIFL        -----------------------GGQPQGGWGQPQQPQ----------------------
SSB1_SALTI       ------------------------GQQQGGWGQPQQPQQPQ-------------------
SSB1_SALTY       ------------------------GQQQGGWGQPQQPQQPQ-------------------
SSB_PROMI        ------------------------SQGQGGWGQPQQPQ----------------------
SSB_VIBCH        ------------------------PAQQGSWGQPQQPA----------------------
SSB_VIBVU        ------------------------QQQQGGWGQPQQPA----------------------
SSB_VIBPA        -------------------------QQQGGWGQPQQPA----------------------
SSB2_SALTI       ----------------------------GGWGQPQQP-----------------------
SSB_PROVU        --------------------------SNQGWGQPQQPQ--P-------------------
SSB_BUCAI        -------------------------LQAMTVNDKNSTGIK--------------------
SSB_BUCAP        -------------------------SHNVTLNE-NNNIVK--------------------
SSB_BUCBP        -------------------------TASSGLSKNNDNLSK--------------------
SSB_WIGBR        ------------------------KPEAKEWNKKNKNIIN--------------------
SSB2_ECOLX       -------------------------QQFSAQPQPEPQSEAG-------------------
SSBF_ECOLI       -------------------------QQFSGQPQPEPQAEAG-------------------
SSB7_ECOLX       -------------------------QQFSGQPQPESQPEP--------------------
SSBP_ECOLX       -------------------------PQQNGQPQ----SADA-------------------
SSBR_ECOLX       -------------------------PQQNGQPQ----SADA-------------------
SSB2_SALTY       -------------------------PPTAAKGE-----GKA-------------------
SSB_PSEPK        ------------------------PYNQGGGNYGGGQQQQY-------------------
SSB2_PSEPU       ------------------------PYNQGGSN----QQ----------------------
SSB1_PSEPU       --------------------------NQDGTN----------------------------
SSB_PSESM        ------------------------NYNQSAPR---PQQSRP-------------------
SSB_PSEAE        ---------------------------QRAPR----------------------------
SSB_COXBU        --------------------------NYGNHSEGGASN----------------------
SSB_SHEON        QQAAPAQNQYAPAPQAAPAYQAPAPQPQSGYNQPPAQQSYGQQQAQPHVQ----------
SSB_SHEHA        QQQAPQQG-YAPKPQSAPQQPAYAPKPQSAPQQPAQQQGGYQSQGQ--------------
SSB_HAEDU        -------------------------QNQAGWNAPASTQNNYNQ-----------------
SSB_HAEIN        -------------------------GNDMGGAPQSSYQARQTN-----------------
SSB_PASMU        -------------------------RQQTGGYAPQTAAPQYNA-----------------
SSB_CUPNH        -------------------------DSDSGTDRSAS------------------------
SSB_NITEU        -------------------------SYDPPADRDHD------------------------
SSB_BORBR        -------------------------GYGGGYDDAP-------------------------
SSB_BORPE        -------------------------GYGGGYDDAP-------------------------
SSB_BORPA        -------------------------GYGGGYDDAP-------------------------
SSB_RALSO        -------------------------GGGGGYSRGESSGGGGYGG----------------
SSB1_XYLFA       -------------------------NNKVGNARHG-------------------------
SSB_XANAC        -------------------------MGGDRPQRS-APRQQGGGGGQGGGG----------
SSB_XANCP        -------------------------MGGDRPQRTQAPRQQQGGG----------------
SSB_XYLFT        -------------------------GGGERPQRQTSQRQ---------------------
SSB2_XYLFA       -------------------------GGGERPQRQTSQRQ---------------------
SSB_NEIMA        -------------------------QSQEAYQRPAQQS----------------------
SSB_NEIMB        -------------------------QSQEAYQRPAQQS----------------------
SSB1_CHLTE       -------------------------TSDASYSQNRPSYS---------------------
SSB_BRUA2        -------------------------GGGGNRNQMSDYSG---------------------
SSB_BRUAB        -------------------------GGGGNRNQMSDYSG---------------------
SSB_BRUSU        -------------------------GGGGNRNQMSDYSG---------------------
SSB_BRUME        -------------------------GGGGNRNQMSDYSG---------------------
SSB_RHILO        -------------------------SGGGS-SRGSDFGQ---------------------
SSB_CAUVC        -------------------------SGGGD-EYGGGYSG---------------------
SSB_AGRFC        -------------------------SGGGDFGGGNDYGSGGGYDQQ--------------
SSB_RHIME        -------------------------RGGSDYGGGG-YEE---YDQ---------------
SSB_BRADU        -------------------------SFGEEP--GGDFGS---------------------
SSB_RHOS4        -------------------------MGGGGYEDRGGPDN---------------------
SSB_RICTY        -------------------------SGHNEYKYPEIKNH---------------------
SSB_RICPR        -------------------------SGHHEYKYPETKNH---------------------
SSB_RICFE        -------------------------SGRSEYKHPEAKNH---------------------
SSB_RICCN        -------------------------SGHSEYKHPETKNH---------------------
SSB_RICBR        -------------------------SGHSEYKHSKP------------------------
SSB_BACTN        -------------------------PSATQAQQPQQMQQ---------------------
SSB_CHLMU        ------------------GSDEGRQRSNDNVSLGFEGES---------------------
SSB_CHLTR        ------------------GSDEGRQRANDNVSIGFDGES---------------------
SSB_CHLCV        ------------------EESSAQTTSYDNVSLGFEGES---------------------
SSB_CHLPN        -------------------EDNHQQVGYESVSVGFEGEA---------------------
SSB_BACCR        GAG-------------FGN-QGSNPFG--QSSNSGNQGN---------------------
SSB_BACAN        GAG-------------FGN-QSSNPFG--QSSNSGNQGNQG-------------------
SSBA_BACSU       GGGQ-----------YFGGGQNDNPFGGNQNNQRRNQGN---------------------
SSB1_LISMO       GGNNFG-------QAPTNNGGFGQDQ--QQSQNQNYQST---------------------
SSB1_LISIN       GGNNFG-------QAPTNNGGFGQDQ--QQSQNQNYQST---------------------
SSB2_LISIN       -----------------NEANYSNNN--KTSSYRADTSQ---------------------
SSB2_LISMO       -----------------NKANYSNNN--QTSSYRADTSQ---------------------
SSB3_LISIN       -----------------SETNYSNDN--KTSSYRADRSQ---------------------
SSB_BACHD        G--------------SPNNPMGGNDFG-QQSGGSGRQSGG--------------------
SSB_OCEIH        ------------------QNRNQNQYQ-NQNQYASNQNQD--------------------
SSB2_STAAS       ----------------YGQGFGGQQSGQNNSYNNSSNTKQ--------------------
SSB1_STAAC       ----------------YGQGFGGQQSGQNNSYNNSSNTKQ--------------------
SSB_STAAR        ----------------QVQ----QTRGQSQ---YSNNKPV--------------------
SSB1_STAAM       ----------------QVQ----QTRGQSQ---YSNNKPV--------------------
SSB_STAAN        ----------------QVQ----QTRGQSQ---YSNNKPV--------------------
SSB1_STAAS       ----------------QAQ----QTRGQSQ---YSNNKPV--------------------
SSB_STAAW        ----------------QAQ----QTRGQSQ---YSNNKPV--------------------
SSB2_STAAM       ----------------QRQ----TQTG---------------------------------
SSB2_STAAC       ----------------NGQ----TQTG---------------------------------
SSB2_LACLA       ---------------GTSAGSYSAPSQSTNNTPRPQTNNN--------------------
SSB1_LACLA       ---------------NKTQGQQTSKPQAQNKKPQ--------------------------
SSB1_STRA3       ---------------NSYNNGGYNNAPSNN-SYSASSQ----------------------
SSB1_STRA5       ---------------NSYNNGGYNNAPSNN-SYSASSQ----------------------
SSB2_STRP6       ---------------GSFNGGFNNNTSSSN-SYSAPAQ----------------------
SSB_STRP1        ---------------GSFNGGFNNNTSSSN-SYSAPAQ----------------------
SSB_STRP3        ---------------GSFNGGFNNNTSSSN-SYSAPAQ----------------------
SSB_STRPQ        ---------------GSFNGGFNNNTSSSN-SYSAPAQ----------------------
SSB2_STRP8       ---------------GSFNGGFNNNTSSSN-SYSAPAQ----------------------
SSB_STRMU        ---------------NSYNAGGNNNFGGNNFSSQGSSQS---------------------
SSB3_STRA5       ---------------------QQTNQSGNS------------------------------
SSB_STRPN        ---------------GAYSAPTANYSAPTN------------------------------
SSB_STRR6        ---------------GAYSAPTANYSAPTN------------------------------
SSB1_STRP8       ----------------------ANTSSLAD------------------------------
SSB4_STRA5       ----------------------TNQASMDD------------------------------
SSB_ENTFA        QNRSF--------GNNNASSGFNNNNNSFNPSSSQSQNN---------------------
SSB_LACPL        -------------GNNNYNNGNSNYNNNNNGYSNQGQNAAPQQSSANNNNPFGNGNTG--
SSBB_BACSU       ------------------------------------------------------------
SSB_CALS4        ----------------EEEKELDEDFDKLF------------------------------
SSB2_STRA3       ------------------------------------------------------------
SSB2_STRA5       ------------------------------------------------------------
SSB1_STRP6       ------------------------------------------------------------
SSB3_CLOAB       --------------------DQFN------------------------------------
SSB2_CLOAB       ------------------------------------------------------------
SSB_CLOTE        --------------------NNFE------------------------------------
SSB1_CLOAB       ------------------------------------------------------------
SSB_CLOPE        --------------------GSGNDFGGSF------------------------------
SSB_UREPA        ---------------VNVDTMMESYTGINTDAAFSSNKPQ--------------------
SSB_THEMA        ---------------------------AETVSETEEELEI--------------------
SSB_AQUAE        ---------------------------GAELQAEEEEEVP--------------------
SSB_WOLSU        Y-------------DSTPS-------YGATSSAKSAPNTQ--------------------
SSB_HELHP        TGMQHN-------TNNSPN-------YNQTHSQPQGNGNI--------------------
SSB_HELPY        AYPANH-------NAPSQDPFNQA--YAQNAYAKE-NLQA--------------------
SSB_HELPJ        AYPTNY-------NAPSQDPFSQAQSYPQNAYTKE-NSQA--------------------
SSB_CAMJE        NYSGNY-------ENQSYDPYMSENQNFNKAKANPAPQRN--------------------
SSB_LEPIC        --------------REVA------------------------------------------
SSB_LEPIN        --------------REVA------------------------------------------
SSB_RHOBA        -------------GRPAASRPNSGGAPAESQRSNYVNSNT--------------------
SSB_TREPA        ---------------GGAARAEDGEFSSSRVAAESTAGRV--------------------
SSB_BORBU        --------------------------SNTIQMQDSDVNSL--------------------
SSB_ANAVA        --------------------------------QDRDGGS---------------------
SSB1_NOSS1       --------------------------------QDRDGGS---------------------
SSB_THEEB        --------------------------------RDTDPNAV--------------------
SSB1_SYNY3       --------------------------------RDNAEAT---------------------
SSB2_NOSS1       --------------------------------RKEESTST--------------------
SSB_PAEAU        ------------------------GNGGGFGNQGAGAQA---------------------
SSB_PAENI        ------------------------RRTGD-GSPGDAGQT---------------------
SSB_MYCBO        -------------------------FGSGSRPAPAQTSS---------------------
SSB_MYCTU        -------------------------FGSGSRPAPAQTSS---------------------
SSB_MYCLE        ------------------------GFGSGSRQAPAQMSG---------------------
SSB_MYCS2        ------------------------GFGSGGG---GSRQS---------------------
SSB2_STRCO       -----------------------GGYGGGGGGQGGGGWGGGP------------------
SSB1_STRAW       -----------------------GGYGGGGGGQQGGGWGGGS------------------
SSB_CORGL        ----------------GNYGG--GNQGGGLGGNQGNQQGGFSNQNSGGFGGNQGNQQ--Q
SSB_COREF        ----------------GNQGGGFGGQGGNQGGNPGGGQGGFG-QNTGGFGGQQGNQGGFG
SSB_BIFLO        QGGQQP-------NQGYGNQGGQGGYAGGQGGYNGGYQGGGAGYSQQ-------------
SSB1_TROWT       -----------------------DPWADSQGSQGIDSHTTRS------------------
SSB1_TROW8       -----------------------DPWADSQTGQGIDSHTTRS------------------
SSB2_TROW8       ------------------------EASDNLRTKYDVDEAET-------------------
SSB2_TROWT       ------------------------EASDNLRTKYDVDEAET-------------------
SSB2_STRAW       ------------------------EAGVSPAARPEPNWETE-------------------
SSB1_STRCO       ------------------------EASTSPP-RPEPNWEVP-------------------
SSBP_RABIT       ------------------------------------------------------------
SSBP_BOVIN       ------------------------------------------------------------
SSBP_RAT         ------------------------------------------------------------
SSBP_HUMAN       ------------------------------------------------------------
SSBP_PONAB       ------------------------------------------------------------
SSBP_MOUSE       ------------------------------------------------------------
SSBPA_XENLA      ------------------------------------------------------------
SSBPB_XENLA      ------------------------------------------------------------
SSBP_DROME       ------------------------------------------------------------
SSB_FUSNN        ------------------------SESKSTNNTIETPGFD--------------------
SSB_MYCPE        -----------------------NYNPTNTKNNNYSQQSN--------------------
SSB_ONYPE        ------------------------------------------------------------
SSB2_CHLTE       -------------------------FIEDDTHETHHLDD---------------------
SSB_MYCPU        --------------ENNINYNALKEYKNHNTNNIQNQNSYS-------------------
SSB_STAES        ------------------------------------------------------------
                                                                             

SSB_SERMA        -------GGNQFSGGQQQSRPAQNSA---------PATS--NEPPMDFDDD-IPF-----
SSB_YERPE        -------GGNQFSGGQ-ASRPAQPAP---------AAPQGGNEPPMDFDDD-IPF-----
SSB_ECO57        -------GGNQFSGGA-QSRPQQSAP---------AAPS--NEPPMDFDDD-IPF-----
SSB_ECOL6        -------GGNQFSGGA-QSRPQQSAP---------AAPS--NEPPMDFDDD-IPF-----
SSB_ECOLI        -------GGNQFSGGA-QSRPQQSAP---------AAPS--NEPPMDFDDD-IPF-----
SSB_SHIFL        -------GGNQFSGGA-QSRPQQSAP---------AAPS--NEPPMDFDDD-IPF-----
SSB1_SALTI       -------GGNQFSGGA-QSRPQQ-SA---------PAPS--NEPPMDFDDD-IPF-----
SSB1_SALTY       -------GGNQFSGGA-QSRPQQ-SA---------PAPS--NEPPMDFDDD-IPF-----
SSB_PROMI        -------ASQQFSGGA-PSRPAQQPA---------AAPAPSNEPPMDFDDD-IPF-----
SSB_VIBCH        ---------KQHQPMQ-QSAPQQY------------SQPQYNEPPMDFDDD-IPF-----
SSB_VIBVU        ---------AQPSYQK-QAPAQQQPM---------QSQPQYNEPPMDFDDD-IPF-----
SSB_VIBPA        ---------QQQYNAP-QQQ-QQAPQ---------QPQQQYNEPPMDFDDD-IPF-----
SSB2_SALTI       -----------------AAPSHSGMP---------PQQHPANEPPMDFDDD-IPFAPFGH
SSB_PROVU        -------NNNQTPAQQLNQRSQGQNQ---------PQGHGNSSQPIDFNDD-IPFAGLGA
SSB_BUCAI        --------IKKTDAVEFDKKIETHES---------NKDLTHSPSEIDFDDE-IPF-----
SSB_BUCAP        --------TKKIEINNSPKKIEKIDS-----------------SEIDFDDE-IPF-----
SSB_BUCBP        --------QLLSEKKQESFNDSKLQN-----------------NNLDFDDEDIPF-----
SSB_WIGBR        --------EKQ-DIKESKKN--KIEE------------------EINFDDD-IPF-----
SSB2_ECOLX       -------TKKGGAKTKGRGRKVAQPE---------PQLQPPEGDDYGFSDD-IPF-----
SSBF_ECOLI       -------TKKGGAKTKGRGRKAAQPE---------PQPQPPEGDDYGFSDD-IPF-----
SSB7_ECOLX       --------KKGGAKTKGRERKAAQPE---------PR-QPSE-PAYDFDDD-IPF-----
SSBP_ECOLX       -------TKKGGAKTKGRGRKAAQPE---------PQPQTPEGEDYGFSDD-IPF-----
SSBR_ECOLX       -------TKKGGAKTKGRERKAAQPE---------PQPQTPEGEDYGFSDD-IPF-----
SSB2_SALTY       -------VKGAGNAAKGK--NAAAPQ---------QPPAQPD-PAYDFDDD-IPF-----
SSB_PSEPK        -------NQAPPRQQAQRPQQAPQRP-------APQQPAPQPAADFDSFDDDIPF-----
SSB2_PSEPU       -----------PRQQAPRQQRPQQPP-------APQQPA-QPAADFDSFDDDIPFMDPYR
SSB1_PSEPU       --------------QAQQQRR-------------PQQPAPQPQPAYDPMDDDIPFMDPYR
SSB_PSESM        -------QQSAPQQSAPQQNYNQQPPQQRDSRPAPQQQAPQPAADFDSFDDDIPF-----
SSB_PSEAE        -------EPMQRPQQAPQQQSRPAPQ---------QQPAPQPAQDYDSFDDDIPF-----
SSB_COXBU        ---------KQSAPTSSQTPTAGDDS-----------------SVADFDDD-IPF-----
SSB_SHEON        ---PHAQPQQGGYAPKPAAPAYQAPAAPAQRPAPQPQQNFTPDLDDGWDDD-IPF-----
SSB_SHEHA        ------QPQAPAYAPKPQAAPQQRPAPAPQQAAPQ--QNFTPDLDDGWDDD-IPF-----
SSB_HAEDU        -------GASNYNPNQTQAYSAPQTN--------RTKPAAESVMD-NFDDD-IPF-----
SSB_HAEIN        -------NGNSYQS------SRPAPQ--------QAAPQAEPPMD-GFDDD-IPF-----
SSB_PASMU        -------PTGSYGAQP----SRPAT---------KPAPQNEPPMDMGFEEDNIPF-----
SSB_CUPNH        ---QQSPASAQRSAPTGQRQPPARRQ----------PAQPPSNGFGDF-NEDIPFARPAA
SSB_NITEU        ---YQS-----------QSTPPAK----------------SNTGFDDM-EDDIPF-----
SSB_BORBR        ----RQQR----APAQRPAAAPQRPA----------PQAAPAANLADM-DDDIPF-----
SSB_BORPE        ----RQQR----APAQRPAAAPQRPA----------PQAAPAANLADM-DDDIPF-----
SSB_BORPA        ----RQQR----APAQRPAAAPQRPA----------PQAAPAANLADM-DDDIPF-----
SSB_RALSO        ---GRAQGGGGMSRGEGGGGQGGGAR----------RQQAPSNGFEDM-DDDIPF-----
SSB1_XYLFA       -----------------------------------------DALPADE-DDYYDF-----
SSB_XANAC        ---YGGGGGGGGQDYAPRRQ--QPAQ------------QQSAPPMDDFADDDIPF-----
SSB_XANCP        -------GGGGGQDYAPRRQ--QPAQ------------QQSAPPMDDFADDDIPF-----
SSB_XYLFT        -------------DYAPRRQTRQPSQ----------SPQSSPPPMDDFADDDIPF-----
SSB2_XYLFA       -------------DYAPRRQARQPSQ----------SPQSSPPPMDDFADDDIPF-----
SSB_NEIMA        -------RQPASDAPSHPQEAPAAPR---------RQPVPAAAPVEDIDDD-IPF-----
SSB_NEIMB        -------RQPASDAPSHPQEAPAAPR---------RQPVPAAAPVEDIDDD-IPF-----
SSB1_CHLTE       ----------RPSRPEPSSGNYGASP--------------SSGGAQEFEKDDLPF-----
SSB_BRUA2        ---------GGGD--FGSSG--PSSGS--------------SGGFSRDLDDEIPF-----
SSB_BRUAB        ---------GGGD--FGSSG--PSSGS--------------SGGFSRDLDDEIPF-----
SSB_BRUSU        ---------GGGD--FGSSG--PSSGS--------------SGGFSRDLDDEIPF-----
SSB_BRUME        ---------GGGD--FGSSG--PSSGS--------------SGGFSRDLDDEIPF-----
SSB_RHILO        ---------SGPNESFNRGGGAPRGGG--------------GGGSSRELDDEIPF-----
SSB_CAUVC        ---------GGSS--FGGGQRSQPSGP--------------RESFSADLDDEIPF-----
SSB_AGRFC        ---------SSPRGGSSRGGGQPS------------------GGFSNDMDDDIPF-----
SSB_RHIME        ---------SRPSSGGARSGGQSNQPNQ-------------GGNFSRDLDDDIPF-----
SSB_BRADU        ---------SGPVSSAPRRAVAAG-----------------GGGRNSDMDDDIPF-----
SSB_RHOS4        ---------YDNYGSGPRGGASSGGAPS-------------GGGRRNDLDDEIPF-----
SSB_RICTY        ------------------------------------------SFDHSDLDDEIPF-----
SSB_RICPR        ------------------------------------------SFDHSDLDDEIPF-----
SSB_RICFE        ------------------------------------------SFDHSDLDDEIPF-----
SSB_RICCN        ------------------------------------------SFDHSDLDDEIPF-----
SSB_RICBR        ------------------------------------------SFDHSDLDDEIPF-----
SSB_BACTN        --------------PQQPQQQAQPSQ---------------AQPIQDNPADDLPF-----
SSB_CHLMU        ---------------------------LDTEIALDKEVYAGFGEDQQYASEDVPF-----
SSB_CHLTR        ---------------------------LDTDSALDKEVYAGFGEDQQYASEDVPF-----
SSB_CHLCV        ---------------------------LDAEAIADKDMYAGYGQGQQYVSEDVPF-----
SSB_CHLPN        ---------------------------LDAEAIKDKDMYAGYGQEQQYVCEDVPF-----
SSB_BACCR        -----------------------------SGFTKNDDPFSNVGQPIDISDDDLPF-----
SSB_BACAN        ----------------------------NSGFTKNDDPFSNVGQPIDISDDDLPF-----
SSBA_BACSU       --------------------------------SFNDDPFANDGKPIDISDDDLPF-----
SSB1_LISMO       ----------------------------------NNDPFASDGKPIDISDDDLPF-----
SSB1_LISIN       ----------------------------------NNDPFASDGKPIDISDDDLPF-----
SSB2_LISIN       ----------------------------------KSDSFANEGKPIDINPDDLPF-----
SSB2_LISMO       ----------------------------------KSDSFASEGKPIDINEDDLPF-----
SSB3_LISIN       ----------------------------------NGDSFANEGAPVDINPDDLPF-----
SSB_BACHD        ---------------------------------FSEDPFANDGKPIDISDDDLPF-----
SSB_OCEIH        ----------------------------------QEDPFKNNGEPIDISDDDLPF-----
SSB2_STAAS       ----------------------------------SDNPFANANGPIDISDDDLPF-----
SSB1_STAAC       ----------------------------------SDNPFANANGPIDISDDDLPF-----
SSB_STAAR        ----------------------------------KDNPFANANGPIELNDDDLPF-----
SSB1_STAAM       ----------------------------------KDNPFANANGPIELNDDDLPF-----
SSB_STAAN        ----------------------------------KDNPFANANGPIEIDDNDLPF-----
SSB1_STAAS       ----------------------------------KDNPFANANCPIEIDDNDLPF-----
SSB_STAAW        ----------------------------------KDNPFANANCPIEIDDNDLPF-----
SSB2_STAAM       -----------------------------------NNPFDNNADSIE----DLPF-----
SSB2_STAAC       -----------------------------------NNPFDNTEEDFS----DLPF-----
SSB2_LACLA       --------------------------NATPNFGRDADPFGSSP--MEISDDDLPF-----
SSB1_LACLA       --------------------------APDPFKAPAADPFAGG---TEISDDDLPF-----
SSB1_STRA3       ---------------------------QTPNFSRDESPFGNSNP-MDISDDDLPF-----
SSB1_STRA5       ---------------------------QTPNFSRDESPFGNSNP-MDISDDDLPF-----
SSB2_STRP6       ---------------------------QTPNFGRDDSPFGNSNP-MDISDDDLPF-----
SSB_STRP1        ---------------------------QTPNFGRDDSPFGNSNP-MDISDDDLPF-----
SSB_STRP3        ---------------------------QTPNFGRDDSPFGNSNP-MDISDDDLPF-----
SSB_STRPQ        ---------------------------QTPNFGRDDSPFGNSNP-MDISDDDLPF-----
SSB2_STRP8       ---------------------------QTPNFGRDDSPFGNSNP-MDISDDDLPF-----
SSB_STRMU        ---------------------------QTPNFARDESPFGDSNP-MDISDDDLPF-----
SSB3_STRA5       ----------------------------------SNSYFGNANK-MDISDDDLPF-----
SSB_STRPN        ---------------------------SVPDFSRNENPFGATNP-LDISDDDLPF-----
SSB_STRR6        ---------------------------SVPDFSRNENPFGATNP-LDISDDDLPF-----
SSB1_STRP8       ---------------------------------SMP-DYG--------PEPDLPF-----
SSB4_STRA5       ---------------------------------QLPPSFGNSQP-MDISDDDLPF-----
SSB_ENTFA        --------------------------NGMPDFDKDSDPFGGSGSSIDISDDDLPF-----
SSB_LACPL        -------------------NASSAAPSSSANNNNQADPFANNGDQIDISDDDLPF-----
SSBB_BACSU       ------------------------------------------------------------
SSB_CALS4        ----------------------------------EDIPDDFDGFTPIESEDDLPF-----
SSB2_STRA3       --------------------------------AMRENNISGDLSDLVLEEEELPF-----
SSB2_STRA5       --------------------------------AMRENNVSGDLSDLVLEEEELPF-----
SSB1_STRP6       --------------------------------AMRENNVTNDLVDLVLEEDTLPF-----
SSB3_CLOAB       -----------------------------NGNENGSMQLPDNNDITPIDDGDIPF-----
SSB2_CLOAB       -------------------------------IENVDFGVPVQEDITPVDNSDIPF-----
SSB_CLOTE        -----------------------------SDPLSYNNEDNYNDDITPVDEGEVPF-----
SSB1_CLOAB       -----------------------------------------KEAV---------------
SSB_CLOPE        ---------------------------GMPDNSFSDSSFNSNDDMTPIDDGDIPF-----
SSB_UREPA        -----------------------TTLSSTTSNLNKNNDEEDEITSWINLDDDLE------
SSB_THEMA        -----------------------------PEEDFSSDTFSEDEPPF--------------
SSB_AQUAE        -----------------------------PIEEEIEKLGKEEEKPFTDEEDEIPF-----
SSB_WOLSU        -----------------------------APYKEPQ-IPEINID-----DDEIPF-----
SSB_HELHP        -----------------------------GTGNYPQNIPEINID-----DEDIPF-----
SSB_HELPY        -----------------------------QPSKYQNSVPEINID-----EEEIPF-----
SSB_HELPJ        -----------------------------QPSKYQNSVPEINID-----EEEIPF-----
SSB_CAMJE        -----------------------------QSPQHEEKLKEIDIDAYDSDDTNLPF-----
SSB_LEPIC        ------------------------------------------------------------
SSB_LEPIN        ------------------------------------------------------------
SSB_RHOBA        -----------------------------PSSHDSQPTGDGPGYD----EPDIPF-----
SSB_TREPA        -----------------------------RGTSSDSRSPTGDILGEKRGLDATSSLDEAD
SSB_BORBU        -----------------------------TNHKKEDVVKDIDIVDDKFSEDIPF------
SSB_ANAVA        ------------------------------SDFAPENF----------------------
SSB1_NOSS1       ------------------------------SDFAPENF----------------------
SSB_THEEB        -----------------------------PAGYVPEI-----------------------
SSB1_SYNY3       ------------------------------MNNYPEEF----------------------
SSB2_NOSS1       -----------------------------SAPNETQAVANANF-----------------
SSB_PAEAU        --------------------------------TQQDDPWAANSSASAGSWGNGP------
SSB_PAENI        --------------------------------ASRDDPWAVNSPANAGSRSDGT------
SSB_MYCBO        --------------------------------ASGDDPWG--SAPASGSFGGG-------
SSB_MYCTU        --------------------------------ASGDDPWG--SAPASGSFGGG-------
SSB_MYCLE        --------------------------------GVGDDPWG--SAPTSGSFGVG-------
SSB_MYCS2        --------------------------------EPKDDPWG--SAPASGSFSGA-------
SSB2_STRCO       ------------------------GGGQQGGGAPADDPWATGGAPAGGQQGGGGQGGGGW
SSB1_STRAW       ------------------------GGAPQGGGAPADDPWATG-TPAGGNQGGGG--GGGW
SSB_CORGL        SNQGG-FGGNQNQSQGNNFNQGGFGGG-SPQAAPDNDPWNSAPPAGSGGFGGA-------
SSB_COREF        GGQGGNPGGNQGQS-GNNFNQGGFGGGGNQAAAPDNDPWNSAPPAGSGGFGGA-------
SSB_BIFLO        ------------------------SAAPANPSAPAVDPWSNAGASDAGSFSTFGASSDFG
SSB1_TROWT       --------------------EEITENAKNGEGAGKNELNKKVLVGDNVSYEDFD------
SSB1_TROW8       --------------------EEITENAKNGEGAGKNELNKKVLVGDNVSYEDFD------
SSB2_TROW8       ---------------------------------PEIHAKAA-------------------
SSB2_TROWT       ---------------------------------PEIHAKAA-------------------
SSB2_STRAW       ---------------------------------PGSQPS---VEHQPQPEPAGVT-----
SSB1_STRCO       ---------------------------------AGGTPGEPVPEQRPDPVPVG-------
SSBP_RABIT       ------------------------------------------------------------
SSBP_BOVIN       ------------------------------------------------------------
SSBP_RAT         ------------------------------------------------------------
SSBP_HUMAN       ------------------------------------------------------------
SSBP_PONAB       ------------------------------------------------------------
SSBP_MOUSE       ------------------------------------------------------------
SSBPA_XENLA      ------------------------------------------------------------
SSBPB_XENLA      ------------------------------------------------------------
SSBP_DROME       ------------------------------------------------------------
SSB_FUSNN        ------------------------------------ENSSDDMGAPTEIDDEFPF-----
SSB_MYCPE        --------MSVSEAMDDFESNFAQKTSSTNITSKNEEKETFKDDPFALNDDEDPDQVVSL
SSB_ONYPE        ------------------------------------------------------------
SSB2_CHLTE       ---------------------------------------DGHMYEYKYLSSD--------
SSB_MYCPU        ------------------------------NEKSQSQTSFLDDEQTSESNEKWDLESDWD
SSB_STAES        -----------------------------------ETPSDNQFENNTYQPDDLEIIHI--
                                                                             

SSB_SERMA        ---------------------
SSB_YERPE        ---------------------
SSB_ECO57        ---------------------
SSB_ECOL6        ---------------------
SSB_ECOLI        ---------------------
SSB_SHIFL        ---------------------
SSB1_SALTI       ---------------------
SSB1_SALTY       ---------------------
SSB_PROMI        ---------------------
SSB_VIBCH        ---------------------
SSB_VIBVU        ---------------------
SSB_VIBPA        ---------------------
SSB2_SALTI       SVARHALYVLS----------
SSB_PROVU        SFGKHTIHAIC----------
SSB_BUCAI        ---------------------
SSB_BUCAP        ---------------------
SSB_BUCBP        ---------------------
SSB_WIGBR        ---------------------
SSB2_ECOLX       ---------------------
SSBF_ECOLI       ---------------------
SSB7_ECOLX       ---------------------
SSBP_ECOLX       ---------------------
SSBR_ECOLX       ---------------------
SSB2_SALTY       ---------------------
SSB_PSEPK        ---------------------
SSB2_PSEPU       FNWHLQ---------------
SSB1_PSEPU       FSCLLQ---------------
SSB_PSESM        ---------------------
SSB_PSEAE        ---------------------
SSB_COXBU        ---------------------
SSB_SHEON        ---------------------
SSB_SHEHA        ---------------------
SSB_HAEDU        ---------------------
SSB_HAEIN        ---------------------
SSB_PASMU        ---------------------
SSB_CUPNH        LDGIPFRNDGAPRY-------
SSB_NITEU        ---------------------
SSB_BORBR        ---------------------
SSB_BORPE        ---------------------
SSB_BORPA        ---------------------
SSB_RALSO        ---------------------
SSB1_XYLFA       ---------------------
SSB_XANAC        ---------------------
SSB_XANCP        ---------------------
SSB_XYLFT        ---------------------
SSB2_XYLFA       ---------------------
SSB_NEIMA        ---------------------
SSB_NEIMB        ---------------------
SSB1_CHLTE       ---------------------
SSB_BRUA2        ---------------------
SSB_BRUAB        ---------------------
SSB_BRUSU        ---------------------
SSB_BRUME        ---------------------
SSB_RHILO        ---------------------
SSB_CAUVC        ---------------------
SSB_AGRFC        ---------------------
SSB_RHIME        ---------------------
SSB_BRADU        ---------------------
SSB_RHOS4        ---------------------
SSB_RICTY        ---------------------
SSB_RICPR        ---------------------
SSB_RICFE        ---------------------
SSB_RICCN        ---------------------
SSB_RICBR        ---------------------
SSB_BACTN        ---------------------
SSB_CHLMU        ---------------------
SSB_CHLTR        ---------------------
SSB_CHLCV        ---------------------
SSB_CHLPN        ---------------------
SSB_BACCR        ---------------------
SSB_BACAN        ---------------------
SSBA_BACSU       ---------------------
SSB1_LISMO       ---------------------
SSB1_LISIN       ---------------------
SSB2_LISIN       ---------------------
SSB2_LISMO       ---------------------
SSB3_LISIN       ---------------------
SSB_BACHD        ---------------------
SSB_OCEIH        ---------------------
SSB2_STAAS       ---------------------
SSB1_STAAC       ---------------------
SSB_STAAR        ---------------------
SSB1_STAAM       ---------------------
SSB_STAAN        ---------------------
SSB1_STAAS       ---------------------
SSB_STAAW        ---------------------
SSB2_STAAM       ---------------------
SSB2_STAAC       ---------------------
SSB2_LACLA       ---------------------
SSB1_LACLA       ---------------------
SSB1_STRA3       ---------------------
SSB1_STRA5       ---------------------
SSB2_STRP6       ---------------------
SSB_STRP1        ---------------------
SSB_STRP3        ---------------------
SSB_STRPQ        ---------------------
SSB2_STRP8       ---------------------
SSB_STRMU        ---------------------
SSB3_STRA5       ---------------------
SSB_STRPN        ---------------------
SSB_STRR6        ---------------------
SSB1_STRP8       ---------------------
SSB4_STRA5       ---------------------
SSB_ENTFA        ---------------------
SSB_LACPL        ---------------------
SSBB_BACSU       ---------------------
SSB_CALS4        ---------------------
SSB2_STRA3       ---------------------
SSB2_STRA5       ---------------------
SSB1_STRP6       ---------------------
SSB3_CLOAB       ---------------------
SSB2_CLOAB       ---------------------
SSB_CLOTE        ---------------------
SSB1_CLOAB       ---------------------
SSB_CLOPE        ---------------------
SSB_UREPA        ---------------------
SSB_THEMA        ---------------------
SSB_AQUAE        ---------------------
SSB_WOLSU        ---------------------
SSB_HELHP        ---------------------
SSB_HELPY        ---------------------
SSB_HELPJ        ---------------------
SSB_CAMJE        ---------------------
SSB_LEPIC        ---------------------
SSB_LEPIN        ---------------------
SSB_RHOBA        ---------------------
SSB_TREPA        FSSSDLDTVPF----------
SSB_BORBU        ---------------------
SSB_ANAVA        ---------------------
SSB1_NOSS1       ---------------------
SSB_THEEB        ---------------------
SSB1_SYNY3       ---------------------
SSB2_NOSS1       ---------------------
SSB_PAEAU        ---------------DSEPPF
SSB_PAENI        ---------------DTEPPF
SSB_MYCBO        ---------------DDEPPF
SSB_MYCTU        ---------------DDEPPF
SSB_MYCLE        ---------------DEEPPF
SSB_MYCS2        ---------------DDEPPF
SSB2_STRCO       GGGSGG-----GGGYSDEPPF
SSB1_STRAW       GGSSGGSSGGSGGGYSDEPPF
SSB_CORGL        ---------------DDEPPF
SSB_COREF        ---------------DDEPPF
SSB_BIFLO        GD-------------DSDPEF
SSB1_TROWT       ---------------SDEVPF
SSB1_TROW8       ---------------SDEVPF
SSB2_TROW8       ---------------------
SSB2_TROWT       ---------------------
SSB2_STRAW       ---------------------
SSB1_STRCO       ---------------------
SSBP_RABIT       ---------------------
SSBP_BOVIN       ---------------------
SSBP_RAT         ---------------------
SSBP_HUMAN       ---------------------
SSBP_PONAB       ---------------------
SSBP_MOUSE       ---------------------
SSBPA_XENLA      ---------------------
SSBPB_XENLA      ---------------------
SSBP_DROME       ---------------------
SSB_FUSNN        ---------------------
SSB_MYCPE        DWLDEFKE-------------
SSB_ONYPE        ---------------------
SSB2_CHLTE       ---------------------
SSB_MYCPU        ---------------------
SSB_STAES        ---------------------