CLUSTAL format seed alignment for MF_00987

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

FUCA_SHIFL            MERNKLARQIIDTCLEMTRLGLNQGTAGNVSVRYQDGMLITPTGIPYEKLTESHIVFIDG
FUCA_ECOLI            MERNKLARQIIDTCLEMTRLGLNQGTAGNVSVRYQDGMLITPTGIPYEKLTESHIVFIDG
FUCA_ECO57            MERNKLARQIIDTCLEMTRLGLNQGTAGNVSVRYQDGMLITPTGIPYEKLTESHIVFIDG
FUCA_ECOL6            MERNKLARQIIDTCLEMTRLGLNQGTAGNVSVRYQDGMLITPTGIPYEKLTESHIVFIDG
A8AP10_CITK8          MERNTLARQIIDTCLEMTRLGLNQGTAGNVSVRYQGGMLITPTGIPYDKLTESHIVFIDA
Q8ZMC7_SALTY          MERNRLARQIIDTCLEMTRLGLNQGTAGNVSVRYQGGLLITPTGIPYEKLTESHIVFIDA
A6TD81_KLEP7          MERNRLARQIIDTCLEMTRLGLNQGTAGNVSVRYQGGMLITPTGIPYEKLTEDKIVFIDA
W0I2K9_9GAMM          MNKTALARDIIATCLRMGKMGLNQGTAGNVSVRYQTGMLITPTGIPYERLTERHIVFVDA
Q7MJI5_VIBVY          MNRVELSQQIIDTCLEMTRLGLNQGTAGNVSVRFDNGMLITPTGIPYEKLTPDHIVYVAQ
FUCA_HAEIN            MNRAELSQKIIDTCLEMTKLGLNQGTAGNVSVRYKDGMLITPTGMPYHLMKTENIVYVDG
A0A369YHP9_9PAST      MNRLELSEKIIHTCLEMTRLGLNQGTAGNVSVRYKDGMLITPTGKPYELTRPEDIVYVDN
B0US21_HISS2          MDRSLLSKKIIFTCLEMTRLGLNQGTAGNVSVRYKDGMLITPTGMPYELLTENNIVYVDK
A0A3S5F3A5_MANHA      MNRQQLSRQIIDTCLEMTRLGLNQGTAGNVSVRYQDGMLITPTGTPYEEMTEDSIVFVNA
W0QDI5_9PAST          MERQALARQIIDTCLEMTRLGLNQGTAGNVSVRYKDGMLITPTGTPYEEMTEDSIVFVDS
B8F6Y3_HAEPS          MNRQTLARKIIDTCLEMTRLGLNQGTAGNISVRYQDGMLITPSGMPYEKMTEDDIVYVDN
                      *::  *:..** ***.* ::*********:***:. *:****:* **.      **::  

FUCA_SHIFL            NGKHEEGKLPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRSIPAIHYMIAAAGG
FUCA_ECOLI            NGKHEEGKLPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRSIPAIHYMIAAAGG
FUCA_ECO57            NGKHEEGKLPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGG
FUCA_ECOL6            NGKHEEGKLPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGG
A8AP10_CITK8          EGQHEQGKLPSSEWRFHMAAYQTRPDANAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGG
Q8ZMC7_SALTY          DGQHEQGKLPSSEWRFHMAAYQTRPDANAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGG
A6TD81_KLEP7          DGQHEQGKLPSSEWRFHQAAYQTRPDAQAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGG
W0I2K9_9GAMM          DGRTDWGKLPSSEWRFHQAVYLTRPDSQAVIHNHAVYSTAVSVLNRAIPAIHYMIAAAGG
Q7MJI5_VIBVY          DGSFEEGKLPSSEWLFHLTCYQQRDDINAVVHNHAINCAAVSILNKSIPAIHYMVAASGA
FUCA_HAEIN            NGKHEENKLPSSEWQFHLSVYHTRPEANAVVHNHSIHCAGLSILEKPIPAIHYMVAVSGT
A0A369YHP9_9PAST      NGKHEEGKLPSSEWQFHLAVYQARPEANAVVHNHARNCAGLSILEKPIPPIHYMIAVGGT
B0US21_HISS2          HGKHEEGKFPSSEWHFHLAVYEARPDVDAVVHNHSINCAAVSILEKPIPPFHYMIAVGGA
A0A3S5F3A5_MANHA      NGKHEGGKLPSSEWQFHLAVYEARPELNAVVHNHAKNCAAVSILGEPIPAIHYMIACTGT
W0QDI5_9PAST          NGKHEEGKLPSSEWQFHLAVYEARPELNAVVHNHAKNCAAVSILGEAIPAIHYMIACTGT
B8F6Y3_HAEPS          EGNFEAGKLPSSEWQFHLAVYQTRPELNAVVHNHAINCTGVSILNKDIPAIHYMIAVTGT
                      .*  : .*:***** ** : *  * : :**:***:  .:.:*:* . **.:***:*  * 

FUCA_SHIFL            NSIPCAPYATFGTRELSEHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVEVLAQL
FUCA_ECOLI            NSIPCAPYATFGTRELSEHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVEVLAQL
FUCA_ECO57            NSIPCAPYATFGTRELSEHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVEVLAQL
FUCA_ECOL6            NSIPCAPYATFGTRELSEHVALALKNRKATLLQHHGLIACEANLEKALWLAHEVEVLAQL
A8AP10_CITK8          NSIPCAPYATFGTRELSEYVAVALKNRKATLLQHHGLIACEENLEKALWLAHEVEVLAQL
Q8ZMC7_SALTY          NSIPCAPYATFGTRELSDHVAVALKNRKATLLQHHGLIACEENLDKALWLAHEVEVLAQL
A6TD81_KLEP7          NSIPCAPYATFGTRELSEHVAVALKHRKATLLQHHGLIACEASLEKALWLAHEVEVLAQL
W0I2K9_9GAMM          DNVPCAPYATFGSRDLAAHVAVAMRDRKATLLQHHGLITCGENLARALWLAQEVEILAKL
Q7MJI5_VIBVY          TEIPCVPYATFGSSKLAQFVEEGIAKSKAILLQHHGLIAGEVNLEKALWLAHEVEVLADL
FUCA_HAEIN            DHIPCVPYATFGSHKLASYVATGIKESKAILLAHHGLITCGENLDKALWLAQEVEVLASW
A0A369YHP9_9PAST      DHIPCVPYATFGTHELADYVREGIKESKAILLSHHGLIACEENLDKALWLAHEVEVLASW
B0US21_HISS2          DHIPCVPYATFGTHELAEHVKQGIKKCKAILLAHHGLIAAEKNLDKALWLAHEVEVLAQW
A0A3S5F3A5_MANHA      NHIPCVPYAPFGTHQLANYVREGIKHSKAILLAHHGLITADKTLEKALGIAHEVEVIAEW
W0QDI5_9PAST          DHIPCVPYAPFGTHQLSEYVREGIKGSKAILLAHHGLITADKSLDKALGIAHEVEVIAEW
B8F6Y3_HAEPS          NHVPCVPYATFGTWQLAEYVKQGIAKSKAILLQHHGMIAAEVNLEKALWVAHEVEVLAEW
                        :**.***.**: .*: .*  .:   ** ** ***:*:   .* :** :*:***::*. 

FUCA_SHIFL            YLTTLAITDPVPVLSDEEIAVVLEKFKTYGLRIEE--
FUCA_ECOLI            YLTTLAITDPVPVLSDEEIAVVLEKFKTYGLRIEE--
FUCA_ECO57            YLTTLAITDPVPVLSDEEIAVVLEKFKTYGLRIEE--
FUCA_ECOL6            YLTTLAITDPVPVLSDEEIAVVLEKFKTYGLRIEE--
A8AP10_CITK8          YLSTLAITDPVPVLDDEAIAIVLEKFKTYGLRIEE--
Q8ZMC7_SALTY          YLSTLAIVDPVPVLDDEAIAIVLEKFKTYGLRIEE--
A6TD81_KLEP7          YLSTLAITDPVPVLDDEAIAIVLEKFKTYGLRIEE--
W0I2K9_9GAMM          YLAVLPVMDPVPVLSKQEMARVLEKFKTYGLRIDD--
Q7MJI5_VIBVY          YLKTLAITPDVPVLDEASMAVVLDKFKSYGLRVEK--
FUCA_HAEIN            YLKLLSTGLEIPLLSKEQMQVVLGKFHTYGLRIEES-
A0A369YHP9_9PAST      YLQLLATGLEIPLLNKDQMAVVLEKFKSYGLRIEE--
B0US21_HISS2          YMKLLATGLEIPLLTPKEMEIVLEKFKSYGLRIEK--
A0A3S5F3A5_MANHA      YLKLLASGKTIPTLDKAQMDIVLEKFKSYGSWVEGEQ
W0QDI5_9PAST          YLKLLATGKPIPTLNKEQMDVVLEKFKSYGSWVEEK-
B8F6Y3_HAEPS          YLKLLATTPDVPVLSDEEIKVVLGKFSTYGLRVEEKH
                      *:  *.    :* *    :  ** ** :**  ::