CLUSTAL format seed alignment for MF_00990

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

A0A1V4NDF4_SALEN      MYDFVIIGGGIIGMSTAMQLIDVYPDARIALLEKESAPACHQTGHNSGVSHAGVYYTPGS
M7RE18_SALDU          MYDFVIIGGGIIGMSTAMQLIDVYPDARIALLEKESAPACHQTGHNSGVIHAGVYYTPGS
A0A5Y7ACM9_SALIN      MYDFVIIGGGIIGMSTAMQLIDLYPDARIALLEKESAPACHQTGHNSGVIHAGVYYTPGS
Q8ZMM3_SALTY          MYDFVIIGGGIIGMSTAMQLIDVYPDARIALLEKESAPACHQTGHNSGVIHAGVYYTPGS
A0A1J6Y4E9_SALHO      MYDFVIIGGGIIGMSTAMQLIDVYPDARIALLEKESAPACHQTGHNSGVIHAGVYYTPGS
A9MG22_SALAR          MYDFVIIGGGIIGMSTAMQLIDVYPDARIALLEKESAPACHQTGHNSGVIHAGVYYTPGS
A0A0K0HDL2_SALBC      MYDFVIIGGGIIGMSTAMQLIDVYPDARIALLEKESAPACHQTGHNSGVIHAGVYYTPGS
LHGD_ECOLI            MYDFVIIGGGIIGMSTAMQLIDVYPDARIALLEKESAPACHQTGHNSGVIHAGVYYTPGS
E3PH30_ECOH1          MYDFVIIGGGIIGMSTAMQLIDVYPDARIALLEKESGPACHQTGHNSGVIHAGVYYTPGS
I2WUP1_ECOLX          MYDFVIIGGGIIGMSTAMQLIDVYPDARIALLEKESGPACHQTGHNSGVIHAGVYYTPGS
B7LT10_ESCF3          MYDFVIIGGGIIGMSTAMQLIDVYPDARIALLEKESGPACHQTGHNSGVIHAGVYYTPGS
B7N6P4_ECOLU          MYDFVIIGGGIIGMSTAMQLIDVYPDARIALLEKESGPACHQTGHNSGVIHAGVYYTPGS
F0JSX3_ESCFE          MYDFVIIGGGIIGMSTAMQLIDVYPDARIALLEKESGPACHQTGHNSGVIHAGVYYTPGS
E3G4Z8_ENTLS          MYDFVIIGGGIIGMSTAMQLIDVYPDARIALLEKESAPARHQTGHNSGVIHAGVYYTPGS
A8ANL6_CITK8          MYDFVIIGGGIIGMSTAMQLIDVYPDASIALLEKESEPACHQTGHNSGVIHAGVYYTPGS
A0A0H3FPE5_KLEAK      MYDFVIIGGGIIGMSTAMQLIEIYPDARIALLEKESGPACHQTGHNSGVIHAGVYYTPGS
B5Y1D3_KLEP3          MYDFVIIGGGIIGMSTAMQLIEIYPDARIALLEKETGPACHQTGHNSGVIHAGVYYTPGS
I2BC73_SHIBC          MYDFVIIGGGIIGMSTAMQLIEVYPDARIALLEKEPGPACHQTGHNSGVIHAGVYYTPGS
A0A097R648_HAFAL      MYDFVIVGGGIIGMSTAMQLIGVYPDARIVLLEKEVGPACHQTGHNSGVIHAGVYYTPGS
                      ******:************** :**** *.*****  ** ********* **********

A0A1V4NDF4_SALEN      LKARFCLAGNQATKTFCDQNNIRYDTCGKMLVATSELEMARMRALWERTAANGLEREWLS
M7RE18_SALDU          LKARFCLAGNQATKTFCDQNNIRYDTCGKMLVATSELEMARMRALWERTAANGLEREWLS
A0A5Y7ACM9_SALIN      LKARFCLAGNQATKTFCDQNNIRYDTCGKMLVATSELEMARMRALWERTAANGLEREWLS
Q8ZMM3_SALTY          LKAQFCLAGNQATKTFCDQNNIRYDTCGKMLVATSELEMARMRALWERTAANGLEREWLS
A0A1J6Y4E9_SALHO      LKARFCLAGNLATKTFCDQNNIRYDTCGKMLVATSELEMARMRALWERTAANGLEREWLS
A9MG22_SALAR          LKARFCLAGNQATKTFCDQNNICYDTCGKMLVATSELEMTRMRALWERTAANGLEREWLS
A0A0K0HDL2_SALBC      LKARFCLAGNQATKTFCDQNGLHYDICGKMLVATSDLEMARMRALWERTAANGLEREWLS
LHGD_ECOLI            LKAQFCLAGNRATKAFCDQNGIRYDNCGKMLVATSDLEMERMRALWERTAANGIEREWLN
E3PH30_ECOH1          LKAQFCLAGNRATKAFCDQNGIRYDNCGKMLVATSDLEMERMRALWERTAANGIEREWLN
I2WUP1_ECOLX          LKAQFCLAGNRATKAFCDQNGIRFDNCGKMLVATSPLEMERMRALWERTAANGIEREWLN
B7LT10_ESCF3          LKAQFCLAGNRATKAFCDQNGIRYDNCGKMLVATSELEMERMRALWERTAANGIEREWLN
B7N6P4_ECOLU          LKAQFCLAGNRATKAFCDQNGIRYDNCGKMLVATSELEMERMRALWERTAANGIEREWLN
F0JSX3_ESCFE          LKAQFCLAGNRATKAFCDQNGIRYDNCGKMLVATSELEMERMRALWERTAANGIEREWLN
E3G4Z8_ENTLS          LKAQFCLAGNRATKAFCDQNGIRYDTCGKMLVATSSLEMERMRALWDRTAANGLEREWLS
A8ANL6_CITK8          LKAQFCLAGNRATKAFCDQNGIRYDTCGKMLVATSELEMARMRALWDRTAANGLEREWLS
A0A0H3FPE5_KLEAK      LKAQFCLAGNRATKAFCEQNAIRYDVCGKMLVATSPLEMERMRALWDRTAANGLQREWLS
B5Y1D3_KLEP3          LKAQFCLAGNRATKAFCEQNGIRYDVCGKMLVATSPLEMERMRALWDRTAANGLQREWLS
I2BC73_SHIBC          LKAQFCLAGNRATKAFCDQNNIHYDTCGKLLVATSELEMTRMKALWERTEANGLERYWLS
A0A097R648_HAFAL      LKAKFCLEGNRATKAFCDENGIRYDTCGKMLVATSELEMQRMRALWDRTEANGLERYWLS
                      ***:*** ** ***:**::* : :* ***:***** *** **:***:** ***::* **.

A0A1V4NDF4_SALEN      AAELREREPNIIGLGGIFVPSSGIVSYRDVATAMANRFQAKGGEIIYHAEVSALTEHAAG
M7RE18_SALDU          AAELREREPNIIGLGGIFVPSSGIVSYRDVATAMANRFQAKGGEIIYHAEVSALTEHAAG
A0A5Y7ACM9_SALIN      AAELREREPNIIGLGGIFVPSSGIVSYRDVATAMANRFQAKGGEIIYHAEVSALTEHAAG
Q8ZMM3_SALTY          AAELREREPNIIGLGGIFVPSSGIVSYRDVATAMANRFQAKGGEIIYHAEVSALTEHAAG
A0A1J6Y4E9_SALHO      AAELREREPNIIGLGGIFVPSSGIVSYRDVATAMANRFQAKGGEIIYHAEVSALTEHAAG
A9MG22_SALAR          AAELREREPNIIGLGGIFVPSSGIVRYRDIATAMANRFQAKGGEIIYHADVSALTEHAAG
A0A0K0HDL2_SALBC      AAELREREPNIRGLGAVFVPSSGIVSYRDVATAMAHRFQAKGGEIIYHADVCALKEHATG
LHGD_ECOLI            ADELREREPNITGLGGIFVPSSGIVSYRDVTAAMAKIFQSRGGEIIYNAEVSGLNEHKNG
E3PH30_ECOH1          ADELREREPNITGLGGIFVPSSGIVSYRDVTAAMAKIFQSRGGEIIYNAEVSGLNEHING
I2WUP1_ECOLX          ADELREREPNITGLGGIFVPSSGIVSYREVTAAMAKIFQDRGGEIIYNAEVSALNEHKNG
B7LT10_ESCF3          ADELRECEPNITGLGGIFVPSSGIVSYREVTAAMAKIFQARGGEIIYNAEVSGLNEHKNG
B7N6P4_ECOLU          AEELREREPNITGLGGIFVPSSGIVSYREVTAAMAKIFQARGGEIIYNAEVSGLSEHKNG
F0JSX3_ESCFE          AEELREREPNITGLGGIFVPSSGIVSYREVTAAMAKIFQARGGEIIYNAEVSALSEHKNG
E3G4Z8_ENTLS          AAELREREPNITGLGGIFVPSSGIVSYREVTAAMAKNFQAKGGEIVYNAEVSALHEHAAG
A8ANL6_CITK8          AAELREREPNITGLGGIFVPSSGIVSYRDVTAAMAKIFQAKGGEIVYNAEVSALKEHAAG
A0A0H3FPE5_KLEAK      ASELREREPNISGLGGIFVPSSGIVSYREVAAAMAKIFESKGGTIVYDAEVSALKEHASG
B5Y1D3_KLEP3          AGELREREPNITGLGGIFVPSSGIVSYRDVAAAMAKIFESKGGTIVYDAEVSALKEHASG
I2BC73_SHIBC          AQELREREPNITGLGGILVPSSGIVSYREVTAAMAKIFQARGGEIYYNAEVSALHEHASG
A0A097R648_HAFAL      AEELHEREPNIVGLGGILVPSSGIVSYTEVTQAMSDRFRAAGGEIVYNAEVTALREHAQG
                      * **:* **** ***.::******* * ::: **:. *.  ** * *.*:* .* **  *

A0A1V4NDF4_SALEN      IVIRTSQGREIETATLIGCAGLMADRLVKMLGVEPGFIICPFRGEYFRLAPRHNRIVNHL
M7RE18_SALDU          IVIRTSQGREIETATLIGCAGLMADRLVKMLGVEPGFIICPFRGEYFRLAPRHNRIVNHL
A0A5Y7ACM9_SALIN      VVIRTSQGREIETATLIGCAGLMADRLVKMLGVEPGFIICPFRGEYFRLAPRHNRIVNHL
Q8ZMM3_SALTY          VVIRTSQGREIETATLIGCAGLMADRLVKMLGVEPGFIICPFRGEYFRLAPRHNRIVNHL
A0A1J6Y4E9_SALHO      VVIRTSQGREIETATLIGCAGLMADRLVKMLGVEPGFIICPFRGEYFRLAPRHNRIVNHL
A9MG22_SALAR          VIIRTSRGQEIETATLIGCAGLMADRLVKMLGVDPGFIICPFRGEYFRLAPEHNRIVNHL
A0A0K0HDL2_SALBC      IVIRTSQGREIDAATLISCAGLMADRLVKMLGVEPGFIICPFRGEYFRLAPKHNRIVNHL
LHGD_ECOLI            VVIRTRQGGEYEASTLISCSGLMADRLVKMLGLEPGFIICPFRGEYFRLAPEHNQIVNHL
E3PH30_ECOH1          VVIRTRQGGEYEASTLISCSGLMADRLVKMLGLEPGFIICPFRGEYFRLAPEHNQIVNHL
I2WUP1_ECOLX          VVIRTSQGGEYEASTLISCSGLMADRLVKMLGLEPGFIICPFRGEYFRLAPEHNQIVNHL
B7LT10_ESCF3          VVIRTRQGGEYEASTLISCSGLMADRLVKMLGLEPGFIICPFRGEYFRLAPEHNHIVNHL
B7N6P4_ECOLU          VVIRTRQGGEYEASTLISCSGLMADRLVKMLGLEPGFIICPFRGEYFRLAPEHNQIVNHL
F0JSX3_ESCFE          VVIRTHQGREYEASTLISCSGLMADRLVKMLGLEPGFIICPFRGEYFRLAPAHNQIVNHL
E3G4Z8_ENTLS          VVIHTRQGQEFEAATLISCSGLMADRLVKMLGVDPGFIICPFRGEYFRLASQHNQIVNHL
A8ANL6_CITK8          VVITTRGGQIYEASTLISCSGLMADRLVKMLGVDPGFIICPFRGEYFRLASQHNQIVNHL
A0A0H3FPE5_KLEAK      VVVHTRQGGEYEASTLITCSGLMADRLVKMIGVDPGFIICPFRGEYFQLAPQHNQIVNHL
B5Y1D3_KLEP3          VVIRTRQGAEYEASTLIACSGLMADRLVKMLGVDPGFIICPFRGEYFQLAPQHNQIVNHL
I2BC73_SHIBC          VVVTTRQGHSYEGATLISCSGLMADRLVKMIGVDPGFIICPFRGEYFRLAPQHNQIVNHL
A0A097R648_HAFAL      VIVTTTAG-DYEGSNLITCSGLMADRLVKMLGVDPGFIICPFRGEYFRLAPQHNHIVNHL
                      ::: *  *   : :.** *:**********:*::*************:**. **:*****

A0A1V4NDF4_SALEN      IYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLALKREGYRKRDVSFTDTLEIFRSAGIRR
M7RE18_SALDU          IYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLALKREGYRKRDVSFTDTLEIFRSAGIRR
A0A5Y7ACM9_SALIN      IYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLALKREGYRKRDVSFTDTLEIFRSAGIRR
Q8ZMM3_SALTY          IYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLALKREGYRKRDVSFTDTLEIFRSAGIRR
A0A1J6Y4E9_SALHO      IYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLALKREGYRKRDVSFTDTLEVFRSAGIRR
A9MG22_SALAR          IYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLALKREGYRKRDISFADTLEILRSPGIRR
A0A0K0HDL2_SALBC      IYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLALKREGYRKRDISFTDTLEILLSSGIRR
LHGD_ECOLI            IYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLAFKREGYRKRDFSFSDTLEILGSSGIRR
E3PH30_ECOH1          IYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLAFKREGYRKRDFSFSDTLEILGSSGIRR
I2WUP1_ECOLX          IYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLAFKREGYRKRDFSFSDTLEILGSSGIRR
B7LT10_ESCF3          IYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLAFKREGYRKRDFSFSDTLEILGSSGIRR
B7N6P4_ECOLU          IYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLAFKREGYRKRDFSFSDTLEILGSSGIRR
F0JSX3_ESCFE          IYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLAFKREGYRKRDFSFSDTLEILGSSGIRR
E3G4Z8_ENTLS          IYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLAFKREGYRKRDFSLADTLEIFGSSGIRR
A8ANL6_CITK8          IYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLAFKREGYRKGDFSLSDTLEIFGSSGIRR
A0A0H3FPE5_KLEAK      IYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLALKREGYRKRDISLTDTLEILTSPGIRR
B5Y1D3_KLEP3          IYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLALKREGYRKRDISLADTLEILTSPGIRR
I2BC73_SHIBC          IYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLAFKREGYRKRDFSLADTLEIFGSAGIRR
A0A097R648_HAFAL      IYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLAFKREGYRKRDISLSDTLEIFGSSGIRS
                      *********************************:******* *.*::****:: *.*** 

A0A1V4NDF4_SALEN      VLQNHLLSGLGEMKNSLCKSGYLRRVQKYCPSLTVNDLQPWPAGVRAQAVSPDGKLIDDF
M7RE18_SALDU          VLQNHLLSGLGEMKNSLCKSGYLRRVQKYCPSLTVNDLQPWPAGVRAQAVSPDGKLIDDF
A0A5Y7ACM9_SALIN      VLQNHLLSGLDEMKNSLCKSGYLRRVQKYCPSLTVNDLQPWPAGVRAQAVSPDGKLIDDF
Q8ZMM3_SALTY          VLQNHLLSGLGEMKNSLCKSGYLRRVQKYCPSLTVNDLQPWPAGVRAQAVSPDGKLIDDF
A0A1J6Y4E9_SALHO      VLKNHLLSGLGEMKNSLCKSGYLRRVQKYCPSLTVNDLQPWPAGVRAQAVSPDGKLIDDF
A9MG22_SALAR          VLQNHLLSGLNEMKNSLCKSGYLRRVQKYCPSLTANDLQPWPAGVRAQAVSPDGKLIDDF
A0A0K0HDL2_SALBC      VLQNHLLSGLGEMKNSLCKSGYLRQVQKYCPSLTVNDLQPWPAGVRAQAVSPDGKLIDDF
LHGD_ECOLI            VLQNHLRSGLGEMKNSLCKSGYLRLVQKYCPRLSLSDLQPWPAGVRAQAVSPDGKLIDDF
E3PH30_ECOH1          VLQNHLRSGLGEMKNSLCKSGYLRLVQKYCPRLSLSDLQPWPAGVRAQAVSPDGKLIDDF
I2WUP1_ECOLX          VLQNHLRSGLGEMKNSLCKSGYLRLVQKYCPRLSLSDLQPWPAGVRAQAVSPDGKLIDDF
B7LT10_ESCF3          VLQNHLRSGLGEMKNSLCKSGYLRLVQKYCPGLSLSDLQPWPAGVRAQAVSPDGKLIDDF
B7N6P4_ECOLU          VLQNHLRSGLGEMKNSLCKSGYLRLVQKYCPRLSLSDLQPWPAGVRAQAVSPDGKLIDDF
F0JSX3_ESCFE          VLQNHLRSGLGEMKNSLCKSGYLRLVQKYCPGLSLSALQPWPAGVRAQAVSPDGKLIDDF
E3G4Z8_ENTLS          VLQKNLRSGLGEMKNSLCKSGYLRLVQKYCPSLTLSDLQPWPAGVRAQAVSPDGKLIDDF
A8ANL6_CITK8          VLQNNLRSGLGEMKNSLCKSGYLRLVQKYCPSLTLKDLQPWPAGVRAQAVSPDGKLIDDF
A0A0H3FPE5_KLEAK      VLQNNLRSGLGEMKNSLCRSGYLRLVQKYCPSLTLSDLRPWPAGVRAQAVSPQGKLIDDF
B5Y1D3_KLEP3          VLQNNLRAGLGEMKNSLCRSGYLRLVQKYCPSLTLSDLRPWPAGVRAQAVSPQGKLIDDF
I2BC73_SHIBC          VLQNNLRAGLGEMKNSLCRSGYLRLVQKYCPSLTLNDLQPWPAGVRAQAVSPQGKLIDDF
A0A097R648_HAFAL      VMRQNLKSGLDEMKNSLCKGGYLKRVQKYCPSLTKQDLQPYPAGVRAQAVSPDGKLIDDF
                      *::::* :**.*******:.***: ****** *: . *:*:***********:*******

A0A1V4NDF4_SALEN      LFVTTPRSIHTCNAPSPAATSAIPIGAHIVSKVQALRASQSNPGRTLRAARSVDALHAAF
M7RE18_SALDU          LFVTTPRSIHTCNAPSPAATSAIPIGAHIVSKVQALRASQSNPGRTLRAARSVDALHAAF
A0A5Y7ACM9_SALIN      LFVTTPRSIHTCNAPSPAATSAIPIGAHIVSKVQALRASQSNPGRALRAARSVDALHAAF
Q8ZMM3_SALTY          LFVTTPRSIHTCNAPSPAATSAIPIGAHIVSKVQALRASQSNPGRTLRAARSVDALHAAF
A0A1J6Y4E9_SALHO      LFVATPRSIHTCNAPSPAATSAIPIGAHIVSKVQALRESQSNPGRTLRAARSVDTLHAAF
A9MG22_SALAR          LFVATPRSIHTCNAPSPAATSAIPIGAHIVSKVQALRESQINPGRTLRAARSVDVLHAAF
A0A0K0HDL2_SALBC      LFVTTPRSIHTCNAPSPAATSAIPIGAHIVSKVQTLREGQVNPGRTLRAARRVDALHAAF
LHGD_ECOLI            LFVTTPRTIHTCNAPSPAATSAIPIGAHIVSKVQTLLASQSNPGRTLRAARSVDALHAAF
E3PH30_ECOH1          LFVTTPRTIHTCNAPSPAATSAIPIGAHIVSKVQTLLASQSNPGRTLRAARSVDALHAAF
I2WUP1_ECOLX          LFVTTPRTIHTCNAPSPAATSAIPIGAHIVSKVQTLLASQSNPGRTLRAARSVDALHAAF
B7LT10_ESCF3          LFVTTPRTIHTCNAPSPAATSAIPIGAHIVSKVQTLLASQSNPGRTLRAARSVDALHAAF
B7N6P4_ECOLU          LFVTTPRTIHTCNAPSPAATSAIPIGAHIVSKVQTLLASQSNPGRTLRAARSVDALHAAF
F0JSX3_ESCFE          LFVTTPRTIHTCNAPSPAATSAIPIGAHIVSKVQTLLASQSNPGRTLRAARSVDALHAAF
E3G4Z8_ENTLS          LFVTTPRSIHTCNAPSPAATSAIPIGAHIVSKVMALLESQNNPGRTLRAAQSVDALHAAF
A8ANL6_CITK8          LFVTTPRSIHTCNAPSPAATSAIPIGAHIVSKVQTLLASQSHPGRTLRAARRVDSLNAAF
A0A0H3FPE5_KLEAK      LFVTTARSIHTCNAPSPAATSAIPIGAHIVSKVQTLLASQSNPGRTLRAARSVETLHAAF
B5Y1D3_KLEP3          LFVTTARSIHTCNAPSPAATSAIPIGAHIVSKVQTLLESQSNPGRTLRAARSVETLHAAF
I2BC73_SHIBC          LFVTTPRSIHTCNAPSPAATSAIPIGAHIVSKVQALLASQTNPGRTLRAARPAASLHAAS
A0A097R648_HAFAL      LFVTTARSIHVCNAPSPAATSAIPIGTHIVGKVQALLAGQTHNGRTLTAAINDKPSLATV
                      ***:*.*:**.***************:***.** :*  .* : **:* **       *: 

A0A1V4NDF4_SALEN      TR---
M7RE18_SALDU          TR---
A0A5Y7ACM9_SALIN      TR---
Q8ZMM3_SALTY          TR---
A0A1J6Y4E9_SALHO      TR---
A9MG22_SALAR          TR---
A0A0K0HDL2_SALBC      TR---
LHGD_ECOLI            NQ---
E3PH30_ECOH1          NQ---
I2WUP1_ECOLX          NQ---
B7LT10_ESCF3          NQ---
B7N6P4_ECOLU          NQ---
F0JSX3_ESCFE          NQ---
E3G4Z8_ENTLS          TRSSS
A8ANL6_CITK8          TR---
A0A0H3FPE5_KLEAK      TR---
B5Y1D3_KLEP3          TR---
I2BC73_SHIBC          TT---
A0A097R648_HAFAL      -----