CLUSTAL format seed alignment for MF_01001

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

WECG_PECCP            MTALKTTE------TIPLYTIRDLPIHGFRNMAQFVDYLFA-GERVETGTLVAINAEKVL
Q2NQC6_SODGM          ---MHNND------GVPHYQIRGLSLWGFRDRADFIDYLFA-GGRLKTGTLVAINAEKVL
D3V6K0_XENBS          ---MTLNN-------IPKYRIRGLSLWGFRGMSHFLDHLFQ-DGQVKTGTLVAINAEKVL
D3VHY4_XENNA          ---MGLNN-------IPKYRIRGLNIWGFRGMSHFLDHLFQ-GGRVQTGTLVAINAEKVL
WECG_PHOLL            ---MELNN-------IPKYSIRGLNIWGFRDMAHFLDHIFQ-REQVKTGTMVAINAEKVL
A0A140NND6_PROSM      ---MEQQS-------IPQYSIRGHQIWGFKDMTHFLDHLFA-DGETKSGTLVAINAEKVM
WECG_PROMH            ---MDTNS-------IPKYSIRGHNIWGFKDMAHFLDYLYQ-GAQIKSGSLIAINAEKIL
F4N6G6_YEREN          ---MEQNTEIPKSIDIPKYSVRGFDIWGFRDMEQTLDHLLS-SGPVKTGTLVAMNAEKLL
WECG_SERP5            ---MEAKI------SVPKYELRGFSLWGFRDMAQCMDFLFD-GGRVKRGTLVAMNAEKIL
A0A0B2IDF4_KLEAE      ---MTDNT------SAPQYALRGLQLIGWRDMQHALNYLFA-DGELRQGTLVAINAEKML
A0A1D8JLT6_9ENTR      ---MTETT------SAPLYLLRGLQLIGWRDMQHALDYLYA-DGEIRTGTLVAINAEKML
WECG_KLEP7            -MDMTGTI------SAPLYLLRGLQLIGWRDMPHALDYLFA-DGALREGTLVAINAEKML
WECG_ENT38            ---MTDNT------SAPMYTLRGLQLIGWRDMQHALDFLCAADGQIKSGTLVAINAEKML
A0A198GYQ4_9ENTR      ---MTDTT------SAPLYALRGIQLIGWRDMQHALDYLFS-EGQMKSGTLVAINAEKML
E3G3Y7_ENTLS          ---MTDNT------SAPLYDLRGLRLIGWRDMQHALDYLCA-GGTMKHGTLVAINAEKIL
WECG_SALSV            ---MTNNA------AAPLYSLRGLPLIGWRDMSHALNYLFA-DGQLKQGTLVAINAEKLL
D2TV30_CITRI          ---MTDNT------TAPMYALRGLQLIGWRDMRHALDYLYA-DGQLRQGTLVAINAEKVL
WECG_ECOL5            ---MNNNT------TAPTYTLRGLQLIGWRDMQHALDYLFA-DGQLKQGTLVAINAEKML
L0M8K4_ENTBF          ---MTDSH------TAPTYELRGLKLVGWRNMQHALDFLYA-DGQLKSGTLVAINAEKML
WECG_CROS8            --MMSEQV------TAPVYTLRGLPLLGWRDMQHALDYLYA-DGSLRHGTLVAINAEKML
I2BE71_SHIBC          ---MTDIT------TVPYYKVRGLELLGWRDMNHALDYLYQ-DGQLRKGTLVAINAEKIL
D4HUK1_ERWAC          ---MSASL------TVPQYQIRGLTLTGFADMAQFVDYLNQ-HGELKKGTLVAINAEKVL
E3DD13_ERWSE          ---MSASL------TVPQYQIRGLTLLGFADMAQCVDYLYQ-LEGPIAGTLVAINAEKVL
D2TCQ9_ERWP6          ---MSASV------TVPKYQIRGLTLSGFADMAQFVDYLNQ-PGELKKGTLVAINAEKVL
D8MKT0_ERWBE          ------MD------SVPLYQIRGFTLLGFRDMAAFLDYLYL-GKNLKTGTLVAINAEKVL
E6WHF3_PANSA          MTLNTIKK------EEPRYALRGIDLYAFHDMASFLNFLLP-NEKPRSGTLVAINAEKML
D4GGM4_PANAM          --MSTVS-------ETPRYVIRGITLYGFDSMASFVDFLMP-HSAVRSGTLVAINAEKVL
H8NUI3_RAHAQ          ---MNLEN------KIPQYDIRGIRLWGFRNMAHFLDYLFA-GHQVKNGSLVAINAEKVL
D0Z985_EDWTE          ---MESNG------SIPHYAIRGIDIWGFRDSDQFLRHLLT-ETAVRPGTLVAINAEKVM
D2BYR3_DICZ5          ---MNDV---------PQYVIRGIPVHGFRDKAQCVSILFA-GGSPQAGTLIAINAEKVL
C6CGJ0_DICC1          ---MKDV---------PQYAIRGIPVQGFRDREQCVSTLFA-GGSPPAGTLIAINAEKVL
E0SKP8_DICD3          ---MNDAQ--------PQYRIRGIPVQGFRDMDQCVSALFA-GGSPHPGTLIAINAEKVM
C6C7B1_DICP7          ---MRETV--------PIYMLRGIAVSGFRDRDQCVAYLFP-DGQPRPGMLVALNAEKVL
                                      * * :*.  : .: .    :  :         * ::*:****::

WECG_PECCP            TAEKDVALRTLLDRA-EYKYADGISIVRSIRRKYPQADVTRIAGADLWEALMERAGKEGT
Q2NQC6_SODGM          NAERDAALKKLLDEA-EYKYADGISIVRSIRRKYRHAEVSRIAGADLWEDLMARAGREGV
D3V6K0_XENBS          TAEKDNVLNILLDEA-EYLYADGISIVRAIRRKYPGAQVSRIAGADLWEALMERAGREGT
D3VHY4_XENNA          TAEQDNALNMLLNEA-EYLYADGISIVRAIRRKYPDADVSRIAGADLWEALMERAGREGT
WECG_PHOLL            TAEEDTALSTLLSDA-EYLYADGISIVRAIRRKYPDTEVSRVAGADLWEAIMERAGKEGT
A0A140NND6_PROSM      TAEKDAALNTLLGQA-EYLYADGISIVRAIRRKYPQAQVSRVAGADLWEALMERAGKEGT
WECG_PROMH            TAETDKGLNQLLDEA-DYLYADGISVVRGIRRKYPDAQVSRIAGADLWEALMERAGKEGT
F4N6G6_YEREN          KAEDDAALRQLITEA-EYLYADGISMVRAIRRKYPQAKLSRVAGADLWEALMQRAGQQGV
WECG_SERP5            TAEQDTELHALLDEA-EYKYADGISMVRSIRRKYPGADVSRVAGADLWEALMQRAGREGT
A0A0B2IDF4_KLEAE      AVEDNPEVRALIEAA-EFKYADGISVVRSLRKKYPQAEVSRVAGADLWEALMERAGAQGT
A0A1D8JLT6_9ENTR      AVEDSPEVRALIEAA-EFKYADGISVVRSLRKKYPQAQVSRVAGADLWEALMARAGAQGT
WECG_KLEP7            AVEDNPEVRALIEAA-EFKYADGISVVRSLRKKYPQAQVSRVAGADLWEALMQRAGAEGT
WECG_ENT38            AIEDNAEVKGLIEAA-EFKYADGISVVRSIRKKYPQARVSRVAGADLWEALMARAGAANT
A0A198GYQ4_9ENTR      AIEDNAEVKSLIEAA-EFKYADGISVVRSVRKKYPGAQVSRVAGADLWEALMARAGAEGT
E3G3Y7_ENTLS          TIEDNAEVRQLIDAA-EFKYADGISVVRSVRKKYPEANVSRVAGADLWEALMARAGADGT
WECG_SALSV            TAEDNPEVRALIAAA-EFKYADGISVVRSIRKKFPQAQVSRVAGADLWEALMARAGKEGT
D2TV30_CITRI          TAEDNPQVRALIEAA-EFKYADGISVVRSVRKKFPRAQVSRVAGADLWEALMARAGQQGT
WECG_ECOL5            TIEDNAEVRELINAA-EFKYADGISVVRSVRKKYPQAQVSRVAGADLWEELMARAGKEGT
L0M8K4_ENTBF          TAEDNAEVRTLINAA-EYKYADGISVVRSVRKKYPQADVSRVAGADLWEALMARAGREGT
WECG_CROS8            ALEADAEVRSLIEAA-EFKYADGISVVRSVRKKYPQAKVSRVAGADLWEALMARAGREGT
I2BE71_SHIBC          TMESDPVVHDLIAAA-EFKYADGISVVRSVRKKYPQAQVSRVAGADLWEALMARAGREGT
D4HUK1_ERWAC          AAEADPAVYQLLNEA-EYKYADGISIVRSIRKKYPQAKVSRIAGADLWAALMKRAGREGT
E3DD13_ERWSE          TAEANPAVYQLIDAA-EYKYADGISIIRSIRKKYPQAKVSRIAGADLWEALMARAGREGT
D2TCQ9_ERWP6          TAEADPEVYQLLNEA-EYKYADGISIVRSIRKKYPQAKVSRIAGADLWEALMERAGREGT
D8MKT0_ERWBE          TAESQPAIRQLIDEA-EFKYADGISIVRSVRKKYPQAEVSRIAGADLWEGLMERAGREGT
E6WHF3_PANSA          TLESDAEVRALIEQA-EFKYADGISIVRSLRKKYPQLQVNRIAGADLWEALMERAGRSGI
D4GGM4_PANAM          NAEQDAALRAQIQQA-EFKYPDGISIVRSVRKKYPQASVQRIAGADLWEALMERAGRNGT
H8NUI3_RAHAQ          TVESNPEMRTLIEHA-EFKYPDGISIVRAIRRKYPQSHVSRIAGADLWEGLMERAGREGT
D0Z985_EDWTE          TAEDDAALRALIAAA-EYKYADGISIVRAIRRKYPGAQVSRIAGADLWEALMQRAGELGI
D2BYR3_DICZ5          AADREAALRELMLQEGHCNYADGISVVRSIRRKYPGAQVERIAGADLWEALMQRAGELGT
C6CGJ0_DICC1          AAEHDATLRELMRQEEHCNYADGISVVCSIRRKYPGAQVERIAGADLWEALMQRAGQMGT
E0SKP8_DICD3          AADRDASLRELMLQEGNCNYADGISVVCSIRRKYPGAQVQRIAGADLWEALMRRAGQLGT
C6C7B1_DICP7          TTERNDELRALMTV--SCNYADGISVVCSIRRKYRAADVTRIAGVDLWEALMQRAGTLGT
                        : .  :   :       *.****:: .:*:*:    : *:**.***  :* ***  . 

WECG_PECCP            PVFLVGGKPDVLAQTEAKLRAQWNVNIVGSQDGYFAPEQRDALFERIRASGAQFVTVAMG
Q2NQC6_SODGM          PVFLVGGRPVVLMRTEAQLRARWNVNIVGRQDGYFSVDAQPALVERIRASGAAIVTVAMG
D3V6K0_XENBS          PVFLVGGKPDVLAQTENKLRSQWSVNIVGSQDGYFTQEGRDAVFERIHASGAAIVTVAMG
D3VHY4_XENNA          PVFLVGGKPAILVQTENKLRTQWNVNIVGSQDGYFTPETRDAVFERIRASGAAIITVAMG
WECG_PHOLL            PIFLVGGKPEILKQTESKLRAQWNVNIVGSQNGYFTPEERNAVFERIHASGAVIVTVAMG
A0A140NND6_PROSM      PVFLVGGKPEILEQTENKLRAQWNVNIVGSQNGYFTAEDRDALFERIRASGAKIVTVAMG
WECG_PROMH            PVFLVGGKPQVLAQTESKLKAQWNVNIVGSQDGYFTPQDRDALFERIKASGAKIVTIAMG
F4N6G6_YEREN          PVFLVGGKPDVLAETEAKLRAQWNVNLVGSQDGYFTPEQREAVFARIAASGAAIVTVAMG
WECG_SERP5            PVFLIGGKPSVLAETEQKLRSQWNVNLVGSQDGYFKPEQREPLFERIRASGAAIVTVAMG
A0A0B2IDF4_KLEAE      PVFLIGGKPEVLAETQAKLRERWKVNIVGSQDGYFSADQRQQLFERVRDSGAKIVTVAMG
A0A1D8JLT6_9ENTR      PVFLIGGKPEVLAQTEQQLRQRWNVNIVGSQDGYFAADQRQALFERIRDSGAKIVTVAMG
WECG_KLEP7            PVFLVGGKPEVLAQTESRLRQRWQVNIVGSQDGYFTPEQRQALFERIRDSGAKIVTVAMG
WECG_ENT38            PVFLIGGKPEVLSQTEQKLRAQWNVNIVGSQDGYFKPEDRQALFERVRDSGAKIVTVAMG
A0A198GYQ4_9ENTR      PVFLIGGKPDVLAQTEQKLRGQWNVNIVGSQDGYFKPEDRQALFERVRDSGAKIVTVAMG
E3G3Y7_ENTLS          PVFLVGGKPEVLAQTAQKLRAQWNVNLVGSQDGFFTPQERQAVFERIRDSGAKIITVAMG
WECG_SALSV            PVFLVGGKPEVLAQTEAKLRTQWNVNIVGSQDGYFTPEQRQALFSRIHASGAKIVTVAMG
D2TV30_CITRI          PVFLVGGKPDVLAQTEAKLRAQWNVNIVGSQDGYFKAEQQQALFARIQASGAQFVTVAMG
WECG_ECOL5            PVFLVGGKPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQALFERIHASGAQIVTVAMG
L0M8K4_ENTBF          PVFLVGGKPEVMAQTEAKLRQQWNVNLVGTQDGYFKPEQRQALFERIRDSGAKIVTVAMG
WECG_CROS8            PVFLVGGKPQVLAQTIEKLKRQWNVNIVDAQDGYFKPEERAALFARIRDSGAQIVTVAMG
I2BE71_SHIBC          PVFLVGGKPGVLEETVAKLRSQWQVNIVGAQDGYFAAQDRDALFRRIRDSGAKIVTVAMG
D4HUK1_ERWAC          PVFLVGGRPEILAQTADKLIKQWQVNIVGSQDGFFAPGEREALFARIKASGAKLVTVAMG
E3DD13_ERWSE          PVFLVGGRAATLAQTIDKLRKQWKVNIVGSQDGFFAPGEREALFARIKASGAQLVTVAMG
D2TCQ9_ERWP6          PVFLVGGQPEILAQTADKLCKQWNVNIVGSQDGFFTPGEREALFVRIKASGARLITVAMG
D8MKT0_ERWBE          PVFLIGGKPQVLVQTEDKLRRQWNVNIVGSQDGYFAPADREALFARIAASGAKIVTVAMG
E6WHF3_PANSA          PVFLLGGHDTVLQETCEKLRRQWNVNIVGSQDGYFTPQEREALFARIAASNAQIVSVALG
D4GGM4_PANAM          PVFLIGGRQAVLDETCDKLRRQWNVNIVGAQDGYFVPAERDALFARVAASGARLVTVAMG
H8NUI3_RAHAQ          PVFLIGGKPEVLAQTEEKLRAKWNVNIVGSQNGYFVPEQREALFERVKSSGAAIVTVAMG
D0Z985_EDWTE          PVFLVGGQPDVLAQTEAALRRRWGVNVVGAQDGYFSPEQRNALFERIHASGAQIVTVAMG
D2BYR3_DICZ5          PVFLLGGKPSVLAATERKLREQWQVNIVGTQDGYFAPQQRQAVLERVRDSGAQLVTVALG
C6CGJ0_DICC1          PVFLLGGKPAVLAETERKLREQWQVNIVGVQDGYFAPEQRQSVLARVRDSGAQLVTVALG
E0SKP8_DICD3          PVFLLGGKPAVLAETERKLREQWQVNIVGTQDGYFAPEQRQAVLERVRDSGAQLVTAALG
C6C7B1_DICP7          PVFLIGGRAQVLAETAERLRTRWRVNIVGMQDGYFDAEQQSTLLERINESGAQLVTVAMG
                      *:**:**:   :  *   *  :* **:*. *:*:*    :  :. *:  *.* ::: *:*

WECG_PECCP            SPRQEILMRDCRHHYPDALYMGVGGTYDVFTGHVKRAPLVWQNLGLEWLYRLLSQPSRIF
Q2NQC6_SODGM          SPRQEQLIALIRREHPAALYMGVGGTYDVFTRHVKRAPKGWQDLGLEWLYRLLSQPSRLQ
D3V6K0_XENBS          SPKQEIFMRDCRKVYSDALYMGIGGTYDVFTGHVKRAPKIWQNLGLEWLYRLLSQPSRIR
D3VHY4_XENNA          SPKQEIFMRDCRKVYPDALYMGIGGTYDVFTGHIKRAPKVWQNLGLEWLYRLLSQPSRIR
WECG_PHOLL            SPKQEIFMRDCRKIHSNALYMGVGGTYDVFTGHVKRAPKAWQNLGLEWLYRLLSQPSRIR
A0A140NND6_PROSM      SPKQEILMRDCRKVYPDALYMGVGGTYDVFTGHVKRAPKVWQNLGLEWLYRLLSQPTRIK
WECG_PROMH            SPKQELFIRACRQVHPDALYMGVGGTYDVFTGHVKRAPKAWQNLGLEWLYRLLSQPSRIK
F4N6G6_YEREN          SPKQEMFMRDCRKVYPNALYMGVGGTYDVFTGHVKRAPKIWQNMGLEWLYRLLAQPSRIR
WECG_SERP5            SPKQEILMRDCRKVHPQALYMGVGGTYDVFTGHVKRAPKVWQNLGLEWLYRLLSQPSRLG
A0A0B2IDF4_KLEAE      SPRQEILMRDCRLVYPAALYMGVGGTYDVFTGHVHRAPKFWQNLGLEWFYRLLLQPSRIK
A0A1D8JLT6_9ENTR      SPRQEILMRDCRDVYPQALYMGVGGTYDVFTGHVQRAPKFWQDLGLEWFYRLVSQPSRIK
WECG_KLEP7            SPRQEIFMRDCRRLYPHALYMGVGGTYDVFTGHVHRAPKFWQDLGLEWFYRLLLQPSRIK
WECG_ENT38            SPRQEILMRDCRMICPDALYMGVGGTYDVFTGHVKRAPKVWQNLGLEWLYRLLSQPSRIT
A0A198GYQ4_9ENTR      SPRQEILMRDCRLVCPNALYMGVGGTYDVFTGHVKRAPKVWQRLGLEWLYRLLSQPTRIK
E3G3Y7_ENTLS          SPKQEIFMRDCRAVHPQALYMGVGGTYDVFTGHVKRAPKVWQDLGLEWLYRLVSQPSRIT
WECG_SALSV            SPKQELLMRDCREVHPHALYMGVGGTYDVFTGHVKRAPKIWQNLGLEWLYRLLSQPKRIT
D2TV30_CITRI          SPKQEIFMRDCRQVHPQALYMGVGGTYDVFTGHVKRAPKMWQNLGLEWLYRLLSQPSRIT
WECG_ECOL5            SPKQEIFMRDCRLVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLLSQPSRIK
L0M8K4_ENTBF          SPKQEILMRDCREIYPDALYMGVGGTYDVFTGHVKRAPKFWQNLGLEWLYRLLSQPSRIT
WECG_CROS8            SPRQEIFMRDCRLVHPDALYMGVGGTYDVFTGHVKRAPKAWQNLGLEWLYRLLSQPSRLK
I2BE71_SHIBC          SPRQEILMRDCRQVYPDALYMGVGGTYDVFTGHVKRAPRLWQQLGLEWLYRLVLQPSRIR
D4HUK1_ERWAC          SPRQEILMQECKAVYPQALYMGVGGTYDVYTGQVKRAPEVWQKMGLEWLYRLILQPSRLG
E3DD13_ERWSE          SPRQEILMQECQAVYPQALYMGVGGTYDVYTGQVKRAPEVWQKMGLEWLYRLILQPSRLG
D2TCQ9_ERWP6          SPRQEILMKACRAVYPDALYMGVGGTYDVFTGQVKRAPRIWQNMGLEWLYRLILQPSRLK
D8MKT0_ERWBE          SPRQEILMRDCKAVWPEALYMGVGGTYDVFTGHVKRAPKIWQKMGLEWLYRLIMQPSRLR
E6WHF3_PANSA          SPRQELLMRDCRAHWPDALYMGVGGTYDVFTGHVARAPRSWQKLGLEWLYRLIRQPSRWR
D4GGM4_PANAM          SPRQELLMAECQKHWPEALYMGVGGTYDVFTGHVKRAPVIWQKLGLEWFYRLIKQPSRLR
H8NUI3_RAHAQ          SPKQEILMRDCRLVHPDALYMGIGGTYDVFTGHVKRAPKIWQNLGLEWLYRLILQPSRLR
D0Z985_EDWTE          SPRQEILMRDCRAYYPQALYMGVGGTYDVFTGRVRRAPHLWRRFGLEWLYRLLSQPTRWR
D2BYR3_DICZ5          SPRQELLIRDCRRLYPTALYMGVGGTYDVFTGLVKRAPLVWQRHGVEWLYRLLTQPSRFR
C6CGJ0_DICC1          SPRQELLIRDCRQLYPDALYMGVGGTYDVFTGQVKRAPLTWQRYGVEWLYRLLTQPSRFR
E0SKP8_DICD3          SPRQELLMRDCRRLYPAALYMGVGGTYDVFTGQVKRAPPAWRRYGVEWLYRLLTQPSRFR
C6C7B1_DICP7          SPRQELLIRDAYRRYPGALYMGVGGTYDVFTGHVRRAPAFWRRNGLEWCYRLLTQPSRIR
                      **:** ::       . *****:******:*  : ***  *:  *:** ***: **.*  

WECG_PECCP            RQFKLLKYVAYHYSGRL
Q2NQC6_SODGM          RQLKLLRYLGYHISGRL
D3V6K0_XENBS          RQIKLLKFLGYYYGGKL
D3VHY4_XENNA          RQIKLLRFLGYYYSGKL
WECG_PHOLL            RQFKLLKFIGYYYSGRL
A0A140NND6_PROSM      RQFKLLKFLAYYYGGKL
WECG_PROMH            RQFKLLKFVGYYYSNKL
F4N6G6_YEREN          RQFKLLKFVGYYYSGRL
WECG_SERP5            RQLRLLKFVSYYYRGKM
A0A0B2IDF4_KLEAE      RQFRLLRYLRWHYSGKL
A0A1D8JLT6_9ENTR      RQARLLRYLRWHYTDKL
WECG_KLEP7            RQFRLLRYLRWHYSGKL
WECG_ENT38            RQIKLLRYLAWHYTGKM
A0A198GYQ4_9ENTR      RQIRLLRYLTWHYTGKM
E3G3Y7_ENTLS          RQVRLLRYLGWHYTGRL
WECG_SALSV            RQMRLLRYLRWHYTGDL
D2TV30_CITRI          RQLRLLRYLRWHYTGDL
WECG_ECOL5            RQLRLLRYLRWHYTGNL
L0M8K4_ENTBF          RQLRLLRYLRWHYTNQL
WECG_CROS8            RQLRLLRYLGWHYTGRL
I2BE71_SHIBC          RQLRLLRYLAWHYSGNI
D4HUK1_ERWAC          RQLKLLKYLNYHRRGDL
E3DD13_ERWSE          RQLKLLKYLNYHWRGDL
D2TCQ9_ERWP6          RQFSLLKYLNYHWRGDL
D8MKT0_ERWBE          RQLRLLKYLNYHWRGDL
E6WHF3_PANSA          RQIKLLKYLGYHWRGDL
D4GGM4_PANAM          RQLKLVKYLRYHWRGDL
H8NUI3_RAHAQ          RQLKLLKFIRYYYTGRL
D0Z985_EDWTE          RQVKLLRFVAYYYARKL
D2BYR3_DICZ5          RQLKLLRYLAWHISGRL
C6CGJ0_DICC1          RQLKLLRYLAWHVGGRL
E0SKP8_DICD3          RQFKLLRYLVWHFGGKL
C6C7B1_DICP7          RQWRLLRYLFYHFSGRL
                      **  *:::: ::    :