CLUSTAL format seed alignment for MF_01006

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

UPPP_BIFLO       -----------MNFFQAIILGIVQALTEYLPVSSSA-HIRIFGDLMLG-----------S
UPPP2_STRAW      -----------MSWFESLILGLVQGLTEFLPVSSSA-HLRLTAAFAGW-----------E
UPPP_CHLTE       -----------MNLFQAIILGIIQGLTEFLPISSSA-HLRIVPALMGW-----------G
UPPP1_STRAW      --------MSVINVGQAVVLGAVEGVTEFLPVSSTG-HLKITEGLMGIP--------VDD
UPPP_CORDI       ---MTQDPSSQISWSQTIVLSIVQGLTEFLPISSSG-HLRIVSELF-----------WGK
UPPP2_RHILO      ----------------------MQGITELLPISSTA-HMRIVPALLGW----------QD
UPPP_GLOVI       -------MQQQIGIFEAIVLGFVQGITEYFPISSTA-HLRVVPALLGW----------AD
UPPP_SYNPX       MADPSASLGLWEACWRDLVLGIVQGLTEFLPISSTA-HLKVVPVLLDW----------GD
UPPP_THEEB       --------MDIILWLQAVILGLVQGMTEFLPISSTA-HLILFSDLLGW----------KS
UPPP2_CHRVO      -----------MNAIEALLFAVIQGVSELFPVSSLG-HGVLIPDWL------HWSINRTH
UPPP_MYCPA       -------MTAHLSYVEAVVVGAFQGVTELFPVSSLG-HAVLVPALVGGRWAQDLSVSAHR
UPPP_VIBVY       -----------MSYFEAFVLALIQGLTEFLPISSSA-HLILPSAIL-----------GWE
UPPP_GEOSL       -----------MDIMHAAVLGILQGLTEILPISSSA-HLILVPWLL-----------GWP
UPPP_PROMP       -----------MEFFKYIFYGIIQGLTEFIPISSTA-HLKIISLLFGMD-----------
UPPP_SACS2       ----------MNYILIGVILGIVQGISEWIPISSKTQVLIVSSTLLGLSF----------
UPPP_SULTO       ----------MNLLDI-IIIGIVQGISEWLPISSKTQVLISSHYLLNLPI----------
UPPP_PYRAE       ----------MDLGVA-AILGVVQGISEWLPISSKTQIMLVSIWLLNASP----------
UPPP_PYRIL       ----------MDFLTA-IVLGVVQGVSEWLPISSKTQVMFVSQLLLSATP----------
UPPP_METBU       ----------MLSLSEAIILGIVQGLAEWLPISSEGMTSLVMVTFFGRSL----------
UPPP_METTP       -----------MDALQALVLGALQGITEWLPVSSEGQTMLAMISWLGMRP----------
UPPP_THEMA       ---------------MDLLLGIVQGLTEFLPISSSG-HLTLLSHLLKTD-----------
UPPP_METMP       --------------MEELILGIVQGLTEFLPISSSG-HLAIFTALFNST-----------
UPPP1_BACHD      ----MEWSQELWLLIKYLLLGLFQGFTEPIPVSSSG-HLVLLQHFLGIE-----------
UPPP_OCEIH       ----MNVFENFWTIVHYFVLGLVQGITEPIPISSSG-HIIIFRELFGIE-----------
UPPP2_BACHD      -----------MSIIEAIIIGIVQGITEFLPISSTA-HIVITQFLFDYT-----------
UPPP3_BACCR      -----------MNWLEAFILGIIQGLTEFLPISSTG-HLYLGRHLFRLD-----------
UPPP_BACTN       -----------MSWLEAMILGLIQGLTEYLPVSSSG-HLAIGSALFGIQG----------
UPPP_BORBU       ----------MTNILSAIILGIIQGITEFLPISSSG-HLLLFRHFINLK-----------
UPPP_TREDE       -----------MSIFQAIILGAVQGLAEFLPISSSG-HLAIVEYFFKQE-----------
UPPP_RHOBA       ----------MQELIRVVILAIVQGIAEFLPISSSG-HLVILGSMLGEL-----------
UPPP_AQUAE       -----------MTEWQAVVLGIVEGISEFLPISSTG-HLILTAHILGIK---------HT
UPPP_WOLSU       -----------MDIFHAIILGIVEGLTEFLPVSSTG-HLILVSELLGIK---------QD
UPPP_PORGI       -----------MTILQAIVLAIVEGLTEFLPVSSTG-HMIIAEGIMGVE---------ST
UPPP_BDEBA       -----------MSYLHAIILGIVEGITEFLPISSTG-HMIIASSMMGIE---------DS
UPPP1_CLOAB      --------MEHIEILKAIFLGIVEGITEWLPISSTG-HMILVNEFIRLN-V-------TE
UPPP_STRMU       --------MLFFEIIKAIIFGIVEGITEWLPISSTG-HLILVEEFIHFNNA-------NA
UPPP_FUSNN       ---------------MVVILAIVEGITEFLPISSTG-HMILVNKLIGGEYL-------SP
UPPP_BACSU       --------MTLWELFVAAILGIVEGLTEYAPVSSTG-HMIIVDDIWLKSS-----NLMSE
UPPP_STAES       --------MFLLELIKGIILGIVEGLTEFAPVSSTG-HMILVDDMWLKST-----NFLGS
UPPP_ECOLI       -------MSDMHSLLIAAILGVVEGLTEFLPVSSTG-HMIIVGHLLG----------FEG
UPPP2_CLOAB      ------MYTNLIFIFKIILEGIIEGVTEFLPVSSTG-HMIILGSIIGFKEGAKPVSLYGA
UPPP_CLOTE       ----------MLLILKAIILAIVEGLTEFVPVSSTG-HLILVSDVINFK----------G
UPPP_CALS4       --------MKMELLIKAFIMGIVEGLTEFLPISSTG-HLIIVGSFIKFT----------G
UPPP_NITEU       --------MDWLILLKALLLGIVEGLTEFLPISSTG-HLILAGDLLNFND---------D
UPPP2_SHEON      --------MDLIYFIKAFFLGVIEGITEFLPISSTG-HLILIGDWINFSS---------N
UPPP_RHOPA       ---------MLIDIIRAVILGIVEGVTEFLPVSSTG-HLLLAERFFNLGEG--------N
UPPP_DEIRA       -----------MDWLYSLIYGIVEGITEFLPISSTG-HLILTGNLLHVPWP--------K
UPPP_XYLFT       ----------MFELFTALMLGILEGITEFLPVSSTG-HLLIAEHWLG-------------
UPPP_LEPIN       ----------MNPYLNAFLRSIIEAITEFLPVSSTG-HLFLFSSFFPFYGE-------NV
UPPP_BUCAP       -------MFFFHKIVIPIIIGIIQGITEFFPVSSTG-HMIIFIDWLDIK----------N
UPPP_BUCBP       -------MTMTTNIFNAIILGIVEGITEFFPISSSG-HLLIFTNILEMK----------N
UPPP_WIGBR       ----------MKEILIIIILGIVEGITEFFPISSNG-HLILINYIFNID----------K
UPPP_TROWT       ------------MVLEAVLLGIVQGITEFLPISSTA-HMYILAKLLNLH-----------
                                       .:..:*  *:**                          

UPPP_BIFLO       DPGAAFTAIIQIGTELAVILYFRHDIINILTHWFSCLFGKNGKDWKARMG--------RG
UPPP2_STRAW      DPGAAFTAITQIGTEAAVLIYFRKDIARIISAWFRSLVNKEM----------------RH
UPPP_CHLTE       DPGAAFTAIIQIGTLAAVLIYFAKDIVSISGAVISGLVKGKP----------------LG
UPPP1_STRAW      NAVVGFSAVIQVGAIAAVLVYFFKDIVRIVSAWGRGLRNRDE----------------RH
UPPP_CORDI       DAGASFTAVVQLGTEAAVLVYFAKDIAKILTGWFRGLFDKKQ----------------RG
UPPP2_RHILO      P-GSAFSAAMQLAALAAVISYFWGDVRDLLFGSLDALTRRDFS-----------------
UPPP_GLOVI       P-GTAYSAVIQLGSLLAVLTYFYKDLVEILSGTVRALRTGDTQ-----------------
UPPP_SYNPX       P-GVSVTAAIQLGSIVAVIAYFRRDLAQVMQGISKAFRHGQWR-----------------
UPPP_THEEB       IWHKTALDAMQFGSVIAVLGYFWQDIHQIVQGSWQAWQRRDWQ-----------------
UPPP2_CHRVO      PDFLPFMVMLHLGTAAALLIYFRRDWVDLIGGWLKA--GGRASNP---------------
UPPP_MYCPA       SPYLAFIVGLHVATAAALLVFFWRDWVRILAGFFSSLRHRRIRTP---------------
UPPP_VIBVY       DQGLAFDVAVHVGTLAAVVIYFRKEVITLFAALFASIFKGERSK----------------
UPPP_GEOSL       ESGLTFDVGLHVGTLIALCVYFRRDIAYLISDAITGLREGFGSQ----------------
UPPP_PROMP       DPGSSVSAIIQIGSVFAIFWYFRKSISNYKNTNSRKPSYSFLF-----------------
UPPP_SACS2       NVAYSFGLFMEIGTIAAAIFYFRSEISGLLKALVRMSSRRE-------------------
UPPP_SULTO       AIAYSFGLFMEMGSIGSATIYFRKDIMSVFR-----------------------------
UPPP_PYRAE       EYAYSLGLFLEAASVLAALIYFRGVYLKALRGFVGDAE----------------------
UPPP_PYRIL       ELAYSLGLFLEAASVLAALIYFRLVYLKILRGFLGDAE----------------------
UPPP_METBU       SEAIPISIWLHLGTLLAAIVYFREDVKVLLYGVPDYVRSFS--RK---------------
UPPP_METTP       TDALSCSIFLHTGTMLAVLVRFRSRLLGMLNTESKLMRTV--------------------
UPPP_THEMA       -LNAYQTAVLHLGTLVSVVLFALDGI--------RRSLRSW-------------------
UPPP_METMP       -PDVGYFAFLHLATFLAVLIFVKAEVFEIITGITKKETEYI-------------------
UPPP1_BACHD      IEGLSFEVMVNFASLFAVIAIYRFDLLKLVKGSARYVLYQD-AQG---------------
UPPP_OCEIH       ARGLSFEIFVNLASLLAVLIIYRKDIVRLAVNSWNFIFKQE-KES---------------
UPPP2_BACHD      FPGFGFEIFLHIASILAVILYFRKDLLQVIVGFFSYFKDKS-EEN---------------
UPPP3_BACCR      EAGLFLDTMLHIGTLLAVFIYYKKEFIYLIKNPF--------------------------
UPPP_BACTN       EENLAFTIVVHVATVCSTLVILWKEIDWIFKGLFKFQMND--------------------
UPPP_BORBU       -LSIIFDIYLHLATVLVIIIYYRKRILELFLTFIRFSLRKTVKSD---------------
UPPP_TREDE       DLPILFDILLHVATLAAVCTVFAKRIAGLFSVLGRFIIRKSKPED---------------
UPPP_RHOBA       GESVTLEIILHAGTLGSILVVFWQRIWALLLKDR--------------------------
UPPP_AQUAE       DFVKSFEISIQLGSILAVVVLYFNRL----------------------------------
UPPP_WOLSU       DFHKTFEISIQLGSILAVLALFRERL----------------------------------
UPPP_PORGI       SFVRAFTVMIQFGAILSVLVLYRKRFFCFPVAPRALGQGKGKEF----------------
UPPP_BDEBA       SFTKAFEVIIQFGAIMSVLVLYWKRF----------------------------------
UPPP1_CLOAB      AFKQVFLVVIQLGAILSVVLLYFNKLIPFSLN------GGFYLK----------------
UPPP_STRMU       AFTNMFNVVIQLGAILAVVVIYFDRLNPFKSG------KTAREV----------------
UPPP_FUSNN       TFRNSFLIIIQLGAIFSVVVYFWKDISPFV--------KTKKEF----------------
UPPP_BACSU       EAANSFKVVIQLGSILAVAIVFKDRILNLLGLKKNITSDQEQG-----------------
UPPP_STAES       QSAFTFKVVIQLGSVFAAAWVFRERFLEILHIGQHKPEPSTSGDRR-------------S
UPPP_ECOLI       DTAKTFEVVIQLGSILAVVVMFWRRLFGLIGIHFGRPLQHEGESK---------------
UPPP2_CLOAB      EYIHMFEIIIQLGAILAIVVLYWDKIFSALKPSNLFPSMKEHEKSGIGVVGEFFVKGYNT
UPPP_CLOTE       DYANLFNVVIQLGAILAVVVVYWDKLLNSVK--DIFAPDRR-------------------
UPPP_CALS4       KFATMFEIVIQLGAILAVVYYFKDKILSSLK--ALKPGEW--------------------
UPPP_NITEU       KAK-VFTVAIQLGAILAVCWEYRERLVNIIRNLGTRQ-----------------------
UPPP2_SHEON      EEK-VFEVVIQLGGILAVCWLFRDKIINLINGVLKSDPV---------------------
UPPP_RHOPA       FWK-SFAVLIQLGAILAILALYFVKLWRIALGMFTDAN----------------------
UPPP_DEIRA       EVKDTFEVVIQGGAILAVLVYYWRDFLKIRHIGHDRG-----------------------
UPPP_XYLFT       SRSDFFNIVIQAGAILAITFVFRKKVWSLATGLDKYSNRD--------------------
UPPP_LEPIN       EFDDLFDIFIQSGAILSVLFLYREKFKSQIVSSFRYILKQNSDSEG--------------
UPPP_BUCAP       KDTKILEIFVQLGSTISVFLFFYKKIIQILQLPMQK-ESNEKKN----------------
UPPP_BUCBP       NEIKILNTIIQTGAALSILLHFKEKFVIFLEQIFIC-KQITKKND---------------
UPPP_WIGBR       ENIQNIIKIIQIGPIFSIILLFKEKIKKSITFFYFNINNIKKKLI---------------
UPPP_TROWT       VPGRFFLSSVQLGTSFALILYFFKDVKGIISETSRSIYSFIQFGIRQKQG--------KR
                           . .                                               

UPPP_BIFLO       DNYATLGWNIIVGSIPIIILGFTLQNVIETS-------LRNLWITVTVLLVFGILLWMVD
UPPP2_STRAW      DHDAQMGWLVIVGSIPIGVLGVTLKDQIEGP-------FRDLRITATMLIVMGVILGIAD
UPPP_CHLTE       TDEARTGWMIAVGTIPIVVFGLTFKHEIETV-------LRSLYIVSASMIGLALVLVVAE
UPPP1_STRAW      HHDYKFAWWVIYATIPIVIVGLAAKSLIEGP-------LASLWVVAASLIVGSGVMWAAD
UPPP_CORDI       -FDYRMGWMVIVGTLPVSIVGLLAKDIIRDN-------LRNMWITASVLIAFSFVFIAAE
UPPP2_RHILO      DRHFRLASWIVLATIPIVIAGVALSGVLNAC--NS--PLRSLTVIGWSCIAMAILLALAE
UPPP_GLOVI       SREVRLFWGIILGTIPIVIAGLALKSTLEAP--GS--PLRALSVIAVASIVMAALLWLSE
UPPP_SYNPX       EPEARLGIAMAVGTLPILAVGLAIKLFWDEGYETS--PLRSVPSIAVVSIVMALLLAVAE
UPPP_THEEB       REEWKLLLGITVGTIPALAAGLLLKLA------KV--ELDRPQIIATMAIAMAILLGLAE
UPPP2_CHRVO      --HARLMWLVIAGTLPAGLLGLLLEKQLRAL------FASTTAVLVFLALNGLLLLWGDK
UPPP_MYCPA       --DERLAWLIVVGTIPVGLAGLALEQLFRTT------LGKPVPAAAFLLLNGVALYAGEV
UPPP_VIBVY       --EAKLAWMIVIATIPACIFGLVMKDVIEVY------LRSAY-VIATTTIIFGLLLWWVD
UPPP_GEOSL       --TSRLPFFIIAGTVPAAIAGKTLEKPIEEF------FRGSHTLIALLLIAFGLLLALAD
UPPP_PROMP       ---NKLNKSIFIGTIPIVFIGVIIKLFVPGF-SDS--FLRSNLSIALVSILMSLIMLFAD
UPPP_SACS2       --DYLLLKFLVIVTIITGLVGVPLYLFVISLPI----LGLPMTVLGVVLLIDGIVIYLSR
UPPP_SULTO       --DRKLLLYLAIITIITGLVGVPLYIISDKLLKNAYDPSIPMIILGIALIVDGLYIRYSR
UPPP_PYRAE       --GRRWLVYILVTTLVTAVVGLPLYYVARKWLVVGHSAGFLMIVLGLAVVLNAVFLQRAR
UPPP_PYRIL       --GRKWLTYVIVTTAATGAVGIPLYMAAKRYLLLGASAGWLMVVLGVAVIFNAVLLQRAR
UPPP_METBU       QPHDPVISFLLISTALTGIVGLPLLLFVTDNVEIS--GGSATAVIGIMLIVTGILQRTVS
UPPP_METTP       ----------IVATLFTGITGVPLYMLFRDRFTG---GEQATLLIGSLLIATGLMLRLRS
UPPP_THEMA       ----RIILNLIVSTIPAGVFGVLFEKQIDQLFSSP-------RFLPLFFSATALILMFTR
UPPP_METMP       ----NLASKLVLSTIPAVIVGLCFGDFIESVFSST-------LLIGVFLSITGILMLLSD
UPPP1_BACHD      KGDFRISFYLLLATVPAVLAALLFKDWIETELKQ--------LHVIAFALLITGMALWLI
UPPP_OCEIH       KSDFMFVVYLVLATIPVGIVGVLFGDEIGAFIGEDG------TTVVGITLLITAAAIWMI
UPPP2_BACHD      RIQFMFAIYIIVATGITGVLGLLLEDLVGAQMKTPP------FIAGALIITGTFLIIIER
UPPP3_BACCR      ---SKLMLLLIVGTIPAVVIGLLFKDFFEDISKTGI------TI-GWEFLVSGFFLYMAD
UPPP_BACTN       --ETRYVINIVISMIPIGIVGVFFKDYVEAIFGSGL------MIVGCMLLLTAALLSFSY
UPPP_BORBU       LTNLKLILLILIITIVTGVVGTFISKYESMFTLS----------FVLINFIITGILILML
UPPP_TREDE       KDDLMMIAAIIVATAVTGVIGLLLKDWVKTIDIR----------LIPIFFIITGLLLIAS
UPPP_RHOBA       ----RVIGLLVIGTLPAVVIGLTIKTQFPEILRSP-------LLAGAMLIVTGVMLIVLG
UPPP_AQUAE       IRDYEIWKRIIAAFIPTGIIGFLLYKLIKGFLIGND------LVVVVSLILGGIILIFAD
UPPP_WOLSU       FSGVDIWLKLAVAFIPTGALGFLLYKHVKALFAPS--------TVAYALILGGIVFLVLE
UPPP_PORGI       MSRFDLYWKLLIALVPAVILGFLFEDWVDRMLGSV-------WVVAVVLFLGGIFMLFVD
UPPP_BDEBA       LPHWGFYRKLFVAFLPTAIIGFVVKDVVEHLMGSV-------QVVAWSLIIGGVILIWAD
UPPP1_CLOAB      KDVVSMWIKIIISCIPATIVGIPFDDKIDALFY-NY------QTVSITLISFGILFIMIE
UPPP_STRMU       QITWQLWAKVILSALPAAVIGLIFDDWLDAHFQ-NF------FSVALMLILYGIAFIYVE
UPPP_FUSNN       VLKFRLWLKIIVGVLPAMVIGLLLDDIIDKYFLDNV------LIVAITLIAYGVIFIGIE
UPPP_BACSU       --HKLSIAQIAVGLVPAAVLGFLFEDYIDEYLFSV-------KTVAIGLIAGAILMLFAD
UPPP_STAES       KPRRLNLIHVLVGMVPAGILGFLFDDLIEKYLFSV-------PTVLIGLFIGAIYMIIAD
UPPP_ECOLI       --GRLTLIHILLGMIPAVVLGLLFHDTI-KSLFNP-------INVMYALVVGGLLLIAAE
UPPP2_CLOAB      MPGFKFWTNIVVACIPAIVIGLPFQKKIDKLLFFP-------APVAAALMVGAVWMIFAE
UPPP_CLOTE       --GLRFWINIVVACIPAVIFGFSLDDYIDKYLFNP-------ITVAIGLVIGGILMIIVE
UPPP_CALS4       --GFNLWYKTFIAFLPAAIIGILTHHYIEEHLFSP-------FTVAIALIVGAIMMIVIE
UPPP_NITEU       --ANRFVINLFIAFLPAAILGLLFIKTIKHYLFHP-------MPVAIALVTGGILILWAE
UPPP2_SHEON      --AQRFAVIVMISFLPSAIIGALFIHDIKNVLFNT-------TVVATALIVGGLIILWVE
UPPP_RHOPA       --ARRFVIGVLVAFLPAAVIGAAFGGYIKHYLFNP-------WVVCFSLIVGGAILLWVD
UPPP_DEIRA       --QQRLWLGVVLACIPAVILGVLFGDTIKAYLFRP-------SVVAWALIVGGVLMWLLE
UPPP_XYLFT       -----YVMKLATAFLITAVVGLAVRKANWQLPETI-------QPIAWALIIGGIWILIAE
UPPP_LEPIN       FHFLIQICIGAFPILIAGFIAKKFLDTIKARPDLL-------EILSGAWIFGGVLILVAE
UPPP_BUCAP       -------IHVLISILPTMFLGLIFYNKIKSLFNPT--------NVMYALILGGFFLIIAE
UPPP_BUCBP       ----LIYHHIILGNIPIIFIGLCIYQYIKYLSNFY--------SIIYALIFGTILLILTE
UPPP_WIGBR       ----LILFNLVLSCIPISILGFMFYKKLEEFYSPK--------YISYFLILGSIFFILSE
UPPP_TROWT       NEYTRLGLLLVTGTIPVVLLGFLLVRFVPDGFFSAA---RNLFTMGVALIVFGLLLGFAD
                                     .                                       

UPPP_BIFLO       AKARQN---------------------KTMNDMTYRDAFLFGLGQSMALI-PGVSRSGGT
UPPP2_STRAW      RLAARDETGGKHRAAKER---------KKLQDLNIRDGLVFGACQAMALI-PGVSRSGAT
UPPP_CHLTE       KHTANRARDGRRG--------------KSINELSWTDAIIIGLAQAMALI-PGSSRSGVT
UPPP1_STRAW      QMGRHK---------------------RGEDDTSFKDAMLVGSSQILALLFPGFSRSGAT
UPPP_CORDI       KWGSKR---------------------RSFDQLTMRDAVIMGCAQCLALI-PGVSRSGGT
UPPP2_RHILO      IFARHK---------------------RTIAEASLADALLVGVAQIGALI-PGVSRSGST
UPPP_GLOVI       SLGKRT---------------------RTMKGIRVIDGILIGCAQALALV-PGVSRSGST
UPPP_SYNPX       RMGPRR---------------------KQLSDVSGRDGLVVGLAQVLALI-PGVSRSGST
UPPP_THEEB       QWGSRK---------------------RTYQDIGILDGFLVGCGQMIALL-PGASRSGST
UPPP2_CHRVO      LKKKTAS--------------------HELSELSFAGAIKIGAGQALALL-PGFSRSGAT
UPPP_MYCPA       LRRRVAPVADEPAVPDAEQQHGDEASDNRLAQLPLRRGVLIGAAQILALL-PGISRSGIT
UPPP_VIBVY       KNASLLD---------------------DEYQAGWKKALFIGIAQALAMI-PGTSRSGAT
UPPP_GEOSL       TTGPKRW---------------------RMDRVDLRGALLIGLAQCLALI-PGVSRSGIT
UPPP_PROMP       ISTKKSI---------------------NLNNHKYPNNLYIGIAQAFAIV-PGVSRSGAT
UPPP_SACS2       KNYFPRKG---------------------LHDLKLRDIIIVGIAQGLAAL-PGVSRSGMT
UPPP_SULTO       ---IKIRS---------------------FKDLSLKNIILIGIAQGLAAL-PGVSRSGMT
UPPP_PYRAE       -FSAGLKA---------------------FDNMSLRDMAIVGIAQAVSVL-PGLSRSGAT
UPPP_PYRIL       -SVAGLKT---------------------FDDMTLGHMALVGLAQALSVL-PGISRSGIT
UPPP_METBU       ---RDESL---------------------SRVPGMSDSLVSGVAQGFAAI-PGISRSGIT
UPPP_METTP       ---SSTKD---------------------MEEISTKDMVLLGLAQGFSIL-PGVSRSGTT
UPPP_THEMA       YSSSGEKR---------------------MENMSFLDALLVGIAQLFALF-PGISRSGIT
UPPP_METMP       NLNKNLKT---------------------IKSIPYWDALIIGVFQAFSVL-PGISRSGTT
UPPP1_BACHD      RHLNGRKQ---------------------DGDITLKDALLVGLAQTAALI-PGISRSGAT
UPPP_OCEIH       RNLRGRKI---------------------EGDLSTKDAVIVGLAQAVAVT-PGISRSGAT
UPPP2_BACHD      FFVYKDRT---------------------VKDMTLKDSIIVGLGQTLAVF-PGISRSGAT
UPPP3_BACCR      KQKNGRKK---------------------MDDITYKDALIIGSFQAAAIF-PAISRSGMT
UPPP_BACTN       YYKPRQK-----------------------DKISMKDAFIIGLAQACAVL-PGLSRSGST
UPPP_BORBU       EFNFLKVD---------------------FKGNILLAGIFMGLMQGLGAL-PGISRSGIT
UPPP_TREDE       SKIKHNKQ---------------------AKNVTLLTAAITGLAQGIGVI-PGISRSGST
UPPP_RHOBA       RLTPKSGT---------------------YDRLGLGAAFLVGCFQAFAIL-PGISRSGST
UPPP_AQUAE       TYC------------------EKFCYLGDVRELPLRKAFMIGVFQSIAV-IPGVSRSGST
UPPP_WOLSU       WLHK-----------------DKEYKINSVESIGYKEALAIGFFQALAM-IPGTSRSGST
UPPP_PORGI       KLFA-----------------S-----SDRGEITYPKAFVIGLFQCLAIFLPGLSRSMAT
UPPP_BDEBA       KAFA-----------------HLTMMGRKTDDLTYKDSVKLGLFQAIAM-IPGVSRSGAT
UPPP1_CLOAB      NHNK-----------------GKHPRITSISEITYTTAVLIGIFQLIAAVFPGTSRSGAT
UPPP_STRMU       RRHQ-----------------GVEPQVTHLVSLPYKTAFFIGLFQVLSLI-PGTSRSGAT
UPPP_FUSNN       VVYKLK---------------NIKPKVKRFAGLKYRTAFLIGFFQCLAMI-PGTSRSGAT
UPPP_BACSU       WVN------------------KRKTATDTLDRISYKQAIAVGLFQCLSLW-PGFSRSGST
UPPP_STAES       KYS------------------KTVQHPQTVDQINYFQAFVIGISQAIAMW-PGFSRSGST
UPPP_ECOLI       CLK------------------PKEPRAPGLDDMTYRQAFMIGCFQCLALW-PGFSRSGAT
UPPP2_CLOAB      NKY------------------RKRAKIKSVDEITIKQAIVIGCFQCLALW-PGMSRSAST
UPPP_CLOTE       NKY------------------RRRSKTKNIYDMKLRQSIFVGMFQCLALW-PGMSRSAST
UPPP_CALS4       DIF------------------GKKYKIDNMDKVSTSKAFWIGVAQVMSLF-PGMSRSAST
UPPP_NITEU       RRE-------------------HRIEAETVDDMSWKQALQVGCAQCLALI-PGTSRSGAT
UPPP2_SHEON      NRKD-----------------SEKFKIENIEKIGFKQAIIIGIAQCIAMI-PGTSRSGAT
UPPP_RHOPA       QLD-------------------LKPRYHDATAFPLLTYFYIGCAQCTAMI-PGVSRSGAS
UPPP_DEIRA       SRK-------------------ATPDTHDIENISAGKALAIGAAQCLALLWPGFSRSASS
UPPP_XYLFT       SVAKH--------------------LPE-RENVTWSVAIAVGLAQVVAGVFPGTSRSAST
UPPP_LEPIN       WYFHQ--------------------RPEEKKSIGFKDSILIGIFQCMA-LIPGMSRSAAT
UPPP_BUCAP       KFKP------------------KKPKTNSIKEINLVQSLIIGCFQTLCLY-PGFSRSGAS
UPPP_BUCBP       ISKT------------------KIS---SNKNIETPQILIIGIFQCLALW-PGFSRSCAT
UPPP_WIGBR       FISL------------------KKIKIDNFKKISFLKYFIIGSSQCFSLL-PGVSRLGIT
UPPP_TROWT       ALFRRKKG--------------------NIFQITFIESVLIGAAQVFAII-PGVSRSGIT
                                                          *  *      *. **   :

UPPP_BIFLO       ITVGRALGYTRE-AAVRLSFLMAIPAVFGSGLLEAIKAVKNYKTDAMFPGWGPTLVAMVI
UPPP2_STRAW      ISGGLLIGYTRE-SAARYSFLLAIPAVLASGVFELKDAAASGHV-----AWGPTVFATVI
UPPP_CHLTE       ITGGLFRNLDRE-TAARFSFLLSLPSVFAAGMLELYQTRQEIMSSTH--NMLNLAVATIA
UPPP1_STRAW      MSTALILDLDRV-AATRLSFFLGIPALTGAGLYELKDALGTGVGVAP------LAVGTIV
UPPP_CORDI       VSAGLFVGLDRE-VATRFSFLLAIPAVLASGLFSLPDAFAPDAGQAAS--GMQLAVGTGI
UPPP2_RHILO      LTAALGLGFKRA-EAARFSFLLGLPAIALAGLKELWELHKVHLDAH---GWSVLATGLVV
UPPP_GLOVI       LTAALFLGFQRA-DGARFSFLLAIPAIFLSGLLELKVLVDEGFSG----GIGPIVAGFVS
UPPP_SYNPX       LTASLLDGWQRA-DAARFSFLLGIPAITIAGIVELKDALAATADA----GPLPLVIGILA
UPPP_THEEB       LAAALALGLERP-TAARFSFLLGIPTLTIATLVQAKDVFDEGTLL------IPLVIATLS
UPPP2_CHRVO      LVAGLAHGLDYA-SSARFSFLLATPIITAAGLLEIPKLAHRGNGSA---EWGLLLACGAV
UPPP_MYCPA       IVAGLWRGLSHE-DAARFSFLLATPIILAAGVYKIPELFGP-LGAG---IGGQVLAGSIA
UPPP_VIBVY       ITAALYLGFTRE-AAARFSFLMSIPIITLAGSYLGLKLVTSGEPV----HVGFLLTGIVT
UPPP_GEOSL       ITAALFLGFTRD-TAARFSFLLSLPIVAGAGILKMGELARHGIPAG---ELAPLLAGMAT
UPPP_PROMP       ISMALLSGWNRK-DAAKFSFLLGIPSISLAAFVEFFSAVNQFSTFP----FLPLFAGLIT
UPPP_SACS2       TSALILLGVKPE-EAFKLSFISLIPAALGAISVTVLFSKHEVSQAVHSVSLSGLLISIVV
UPPP_SULTO       VSTMLFLGIKPD-DAFRYSYLAYIPAAVGAVGTTILFSKTNISYVISLIGIGGVLISVIS
UPPP_PYRAE       VTALLLLGYKPE-EAFRASFVLVPVAGLGATALAYLSEG-------GAVATAEALLAMAI
UPPP_PYRIL       TTTLLLLGYRPD-EAFKSSFVLVPIAGLGATALAYLSEG-------GAVATPEVITAMLI
UPPP_METBU       MSALLLRKFDAA-DAIRLSFLMSIPAVLVAEIGVGLMG--------MVELDINSIVGLFF
UPPP_METTP       LTVLLMRGVKQD-DALMVSFIISVPAVLGAIALDCLAGSP------LSIRSLPGAVMLAS
UPPP_THEMA       VSSLLFMKYRSE-DALQYSFLMSIPVVLGAGILGLGK---GNV----------TILAPIF
UPPP_METMP       LFAALFLGMNKE-DAVKYSFLMSLPVTFGAGILELQKITFSSE----------QLFGFVI
UPPP1_BACHD      IVAAMGLGWRQE-TALRFSFFLYIPISLGSGVLAISDIVQDPH--FTALW-IPYTIAFIG
UPPP_OCEIH       LVASMLMGMKQD-TALRFSFLLYIPVSLGSSILEIPNIVRDPN--VQELW-IPYLVAFIT
UPPP2_BACHD      LITALFSGLNKE-TAVRYSFLLSIPVILGTSVLAIGDLLDGTL--VEQVGGLPLIISFIV
UPPP3_BACCR      IVAALWRKLDRE-TAAYFSFLLSTPAIVGAIILQFVDVFQGK---AESISSTSLIVGTLS
UPPP_BACTN       IATGLLLGDNKA-KLAQFSFLMVIPPILGEALLDSVKMMKGEDV-VGDIPALSLIVGFLA
UPPP_BORBU       IFSASVIGFNRK-SAFEISFLSLIPIVFGAILLKHKEFYDIFM----VLNFFEINLGALV
UPPP_TREDE       ISASLFAGLDRE-KAGEFSFLLSIPAILAAFILEIKSADNLLA----GVSPISLISGMIS
UPPP_RHOBA       ILGGRLMGLDRD-DSVTFSFLLAIPAILGATVLAIKDLLEDGS--SGETSIEVLSIGAAV
UPPP_AQUAE       IIGGMLMGLNRK-VAAEFSFLLAIPTMFAATTYDLIKSGGS----FNAQEWNILIIGFIT
UPPP_WOLSU       IVGGLILGLNRK-VAAEFSFLLALPTMFIATGYDLYKNSHT----LSIENLSALGVGFVV
UPPP_PORGI       IVGGQQQKLSRK-AAAEFSFFLAVPTMLGATLLKAYKLYKEGGIEIFREHMTVLLVGNIV
UPPP_BDEBA       IMGGLTLGMNKK-EAAEFSFFLAVPTMAAATLYKLLKIYKT----IEPAQINLLLVGCAV
UPPP1_CLOAB      IVGALLIGVSRT-VAAEYTFFLAIPVMFGASLLKLFKF----GLHFTSTEITILFIGMLS
UPPP_STRMU       ILGGILLGTSRQ-VATEFTFFLGIPIMFGASLVKVLKFIVS-GTILTGSQLFILLVAMLV
UPPP_FUSNN       IIGALLLGLSRP-LAAEFSFYLAIPTMFGATALKLFKN----GLAFTEMEWSYLALGSAI
UPPP_BACSU       ISGGVILGLNHR-AAADFTFIMAMPIMMGASFLSLVKHWDS----LSSDLMPFFIVGFIC
UPPP_STAES       ISTGVLMKLNHK-AASDFTFIMSVPIMLAASGLSLLKHYEY----IHLAHIPFYILGFLA
UPPP_ECOLI       ISGGMLMGVSRY-AASEFSFLLAVPMMMGATALDLYKSWGF----LTSGDIPMFAVGFIT
UPPP2_CLOAB      IIGAWIVGVATV-AGAEFSFFLAIPMMLGASLLFLIKNSVV----LSSVQILGLAVGFIV
UPPP_CLOTE       IMGGWIAGLSPV-VAAEFSFFLAIPVMVGASGLKLVKSGFY----MTNIEFIALIVGFVG
UPPP_CALS4       IMGGMLVGLSVR-AAAEFSFFLAIPTMLAATGFELVKNITS----MSLLEWEALAVGFIM
UPPP_NITEU       IIGGLLFGLSRK-AAAEFSFFLAIPVMFAATFYDVYKHREF----LYIDDLGMFATGSVA
UPPP2_SHEON      IVGGMLSGVSRK-AATEYSFFLAIPTMLGAAIYDASKNYHL----LNTDDILAILIGFSA
UPPP_RHOPA       IVAAMLLGTDKR-SAAEFSFFLAIPTMLGAFVYDLYKNHAD----MTADNLIIVAIGFVV
UPPP_DEIRA       ILGGMLLGLDRP-TATKFSFYLGVPTLGGAALLDFIKSREI----LAQIGVVNVAIGAVT
UPPP_XYLFT       IFLAMLLGLSKRSAAAEFSFLVGIPTMFSASSYACFELFKRGE--LLHENWLEVSVAFVA
UPPP_LEPIN       IITARFLGKDTK-SSAEFSFFLAVPVLLAAGIYKLIKY--RSI--LNGNTIPVLMFGFLV
UPPP_BUCAP       IAIATLLGFKRS-VAVNFSFIISIPLIAGASVLDLIKNIQNVNM----LNIPYLFSGFTI
UPPP_BUCBP       ISAGILSGLKQS-KSVEFSFILSVPIFFGASVLDVINNFYDISI----NNIPMLFSGFLS
UPPP_WIGBR       ISIGLILNIDRY-VLFKFSMILFSSIMPAVLILEVYKNFFYLK-----ENIFFVIIGVMS
UPPP_TROWT       ITTARFLNFDRQ-LAVRFSFLLSLPVTFIGGMYGLVAGPDTDYY-----SLGYSLIGAIV
                                   :                                         

UPPP_BIFLO       SFVLGYIVIIGFLKFVSN---FSYKAFAIYRIGLAVVVALLLIVGVLPAIDPSVVAAA--
UPPP2_STRAW      AFVSGYAVIAWFMKFISN---KSFMPFVWYRIALGIAIIALVATGALSPHAAESAG----
UPPP_CHLTE       AFIFGYLSIAFLLNYLKR---HTTGIFIAYRLILGIGLIVMIGTGHLLP-----------
UPPP1_STRAW      SFVVAYGSISWLLKFVAK---HSFNAFVIYRIVIGVLLLGLLGTGVLS------------
UPPP_CORDI       AFALGYASIAWLLKFVGS---HSFSWFAAYRIPVGLLVMALLATGMLTA-----------
UPPP2_RHILO      ASISAFFAIWGLMRVLER---FSAWPFVIYRGLLGVVLLLGLAMGWLA------------
UPPP_GLOVI       STVFSYLAIAWLLKFLQT---RSTLVFVIYRFFFGALLLGLLAAGLLPDIEPVRQALNLP
UPPP_SYNPX       ATVVSWLAIDWLLKFLQR---HSTWLFVAYRLLFGVGLLAWWSIHGAH------------
UPPP_THEEB       SMVFSYLAIAWLLQFLQR---HSTWVFIWYRIGLGSALWGAIALGSLQS-----------
UPPP2_CHRVO      SGLCAYASTWFLMRYFKKTEIESLRPFGFYCLLVGVVGLLFKLV----------------
UPPP_MYCPA       SFVCAYLAVRYLTRYFQT---RTLTPFAIYCAVAGGASLVWLALR---------------
UPPP_VIBVY       SFISAYLCIHLFLKMISR---MGMTPFVIYRLILGVGLFAYLLMA---------------
UPPP_GEOSL       SAVSGYLGVALLLRLVQR---YSLYPFVWYRLLAGGAVLAYLFAR---------------
UPPP_PROMP       AFFSSLLAINFLIKYVSS---HGLKIFVYYRLIFGILILFNL------------------
UPPP_SACS2       ATFVSIFFINALLRFART---NKVVLLVIILGIMAIISGILSDIAKGFY-----------
UPPP_SULTO       AFIIGMLTIDLLLRFAKR---RNIYIIDFTLGGIAIVVSVLTILI---------------
UPPP_PYRAE       GIVISIITIKALLEFAKS---KHVVLVNVVIGLLAIAGGLLRIIF---------------
UPPP_PYRIL       GLVVSLVTIKALLEFAKS---KHVTLVNIVVGTLAIAGGITRILLSS-------------
UPPP_METBU       AFAFGLVTIDLFLKVAKK---VDFSYFCIGLGVLSVLTMFL-------------------
UPPP_METTP       SFITGYATMDVLMRFSRN---VSFSWFCITMGMITLALTALPEVQ---------------
UPPP_THEMA       AFLSGLFALYVLSRSVRS---GKIWQFSYYCLFVAILSYLAG------------------
UPPP_METMP       SFLTGLLGLYLVKKMVIG---GKLKIFGYYCFLASFFVIMFL------------------
UPPP1_BACHD      SFIASYVSLLWFMNIMRH---GKLIYFALYCWLAGLIVLSLLS-----------------
UPPP_OCEIH       AFIASYFALKWFMNIMRH---GNLKYFAYYCVIVGVLVLIFL------------------
UPPP2_BACHD      TFFFSWLGIIWLIDFLKR---SKLIYFAFYCFALAIFVFFYFDHNMTIDLE---------
UPPP3_BACCR      AAFFGYIAVSWMIQYLKR---HSLKVFAYYVWGLGILILMLQFTDVF-------------
UPPP_BACTN       AFVAGCLACKWMINIVKK---GKLIYFAIYCAIAGLAVIITQL-----------------
UPPP_BORBU       AFVVGIFSINFFFKMLNN---KKLYYFSIYLFALSI-IVCYFVRI---------------
UPPP_TREDE       AFVVGYFSLRFLLKLIKN---GKLMYFAFYLIPLGLGLSIYFWGFAG-------------
UPPP_RHOBA       AFAVGIVALKWLIRWSRE---DRLHWFAYWCIPAGLLVVLLNLR----------------
UPPP_AQUAE       SFITALIVVKWFLNFLKS---HSLKIFGFYRILIGLVYAAFFLF----------------
UPPP_WOLSU       AFIFAMIAVKGFLKFISR---FNFVPFGIYRIILGIIFLFYLDLI---------------
UPPP_PORGI       AFIVALAAIKFFIGFLTR---YGFKAFGYYRILVGGLLIVLMLSGVSLAV----------
UPPP_BDEBA       AFVVAMIAIKFFIGIVSR---YGFRGFGYYRIVLGLVILILLYTGHDLQMV---------
UPPP1_CLOAB      AFIVSILAIKFLMIYIKR---HDFKAFGWYRIILGCAVLVYFLIV---------------
UPPP_STRMU       AFAVSLYVIRFLTDYVKN---HDFTFFGKYRIGLGILLLFYGLMKVLFG-----------
UPPP_FUSNN       AFVVAYIVIKWFMDFIKK---RSFASFGLYRIILGIIVIVLLY-----------------
UPPP_BACSU       AFVVALFVVRFFLRLINK---IKLVPFAIYRIILGVILLLIMM-----------------
UPPP_STAES       AFIVGLIAIKTFLHLINK---VKLVPFAIYRIVLVIFIAILYFGFGIGKGI---------
UPPP_ECOLI       AFVVALIAIKTFLQLIKR---ISFIPFAIYRFIVAAAVYVVFF-----------------
UPPP2_CLOAB      AFIVALVVVDRFISFLKK---KPMRIFAVYRLAIGIIVLVLGFTKVIS------------
UPPP_CLOTE       AFLVSLVVIEKFIKFLQK---KPMRIFAIYRIFIGAILLILAIFKIVTI-----------
UPPP_CALS4       SFITALIVVDKFLAYLKR---HVLKPFAYYRLLVGVLMLFLIAQKIVK------------
UPPP_NITEU       AFISALIAIRGFIRYISH---HDFTLFAWYRIGFGLIVLLTAYSGLVDWSVD--------
UPPP2_SHEON      AFISALIVVNALIRFVAK---HSLSVFAWYRIALGLIIFSVN------------------
UPPP_RHOPA       SFITAIIVVKTFLTYVTR---HGFELFAWWRVIVGTLGLIALALGL--------------
UPPP_DEIRA       SFVVAYFAIGWLLRFVST---NNFKGFAVYRVVVGVLILVLIARGVLQNGSLA-------
UPPP_XYLFT       AMLTGFAVVKWLLGYIKN---HSFAPFAYYRIALGLVLLTWLT-----------------
UPPP_LEPIN       SFLLCTLVIRWFLRYIQK---HSFSVFGVYRILLGVGVLVLTKLI---------------
UPPP_BUCAP       SFIISFLLIKKFITILNK---VSLTFFGIYRFLIAGIIYFI-------------------
UPPP_BUCBP       AFITSNIVIKRCLNTMKN---CSLIPFIIYRSILSIIIYLFFMH----------------
UPPP_WIGBR       SFLTSLIFGRTAIKIMKN---TSLIIFAIYRIFIACIILFTCN-----------------
UPPP_TROWT       SFVVGLLVVSALLRIISK---TTFVLFVYYRVLFGLFLVIVSFF----------------
                                           .