CLUSTAL format seed alignment for MF_01010

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RLMD_CHRSD      -----MAMLGKRRPPR--TANERVRRE----RGSAT------------------------
RLMD_HALED      -----MTGLGKRRPARSRSGVSGLRER----RQPAS------------------------
RLMD_CELJU      MAYKKPGFLGKKPVPHGKGAGRDPYVRDDSPRLTAP------------------------
RLMD_MARPP      -----------------------------MRRRTAT------------------------
RLMD_MARMS      -----------------------------MRRRTSP------------------------
RLMD_MARM1      -----------------------------MRKRTGR------------------------
RLMD_HYDCU      ------------------------------------------------------------
RLMD_AERHH      -----------------------------MAQFFKP------------------------
RLMD_AERS4      -----------------------------MAQFFKP------------------------
RLMD_TOLAT      -----------------------------MVQFFQP------------------------
RLMD_PSEHT      -----------------------------MAQIFKA------------------------
RLMD_SHEB9      -----------------------------MAQFFKA------------------------
RLMD_SHEB2      -----------------------------MAQFFKA------------------------
RLMD_SHEB8      -----------------------------MAQFFKA------------------------
RLMD_SHEB5      -----------------------------MAQFFKA------------------------
RLMD_SHEPC      -----------------------------MAQFFKA------------------------
RLMD_SHESW      -----------------------------MAQFFKA------------------------
RLMD_SHESM      -----------------------------MAQFFKA------------------------
RLMD_SHESR      -----------------------------MAQFFKA------------------------
RLMD_SHESA      -----------------------------MAQFFKA------------------------
RLMD_SHEON      -----------------------------MAQFFKA------------------------
RLMD_SHESH      -----------------------------MAQFFKA------------------------
RLMD_SHEWM      -----------------------------MAQFFKA------------------------
RLMD_SHEHH      -----------------------------MAQFFKA------------------------
RLMD_SHEPA      -----------------------------MAQFFKA------------------------
RLMD_SHEPW      -----------------------------MAQFFKA------------------------
RLMD_SHEDO      -----------------------------MAQFFKE------------------------
RLMD_SHEFN      -----------------------------MAQFFQA------------------------
RLMD_SHEAM      -----------------------------MAQFFKA------------------------
RLMD_FERBD      -----------------------------MAQFYSA------------------------
RLMD_ALIF1      -----------------------------MAQFFKP------------------------
RLMD_ALIFM      -----------------------------MAQFFKP------------------------
RLMD_ALISL      -----------------------------MAQFFKP------------------------
RLMD_PHOPR      -----------------------------MARFFKP------------------------
RLMD_VIBCH      -----------------------------MARFFQP------------------------
RLMD_VIBCM      -----------------------------MARFFQP------------------------
RLMD_VIBC3      -----------------------------MARFFQP------------------------
RLMD_VIBCB      -----------------------------MARIFQP------------------------
RLMD_VIBPA      -----------------------------MARIFQP------------------------
RLMD_VIBVU      -----------------------------MARFFQP------------------------
RLMD_VIBVY      -----------------------------MARFFQP------------------------
RLMD_VIBTL      -----------------------------MARFFQP------------------------
RLMD_SHIFL      -----------------------------MAQFYSA------------------------
RLMD_SHIF8      -----------------------------MAQFYSA------------------------
RLMD_ECOLI      -----------------------------MAQFYSA------------------------
RLMD_ECOUT      -----------------------------MAQFYSA------------------------
RLMD_ECOK1      -----------------------------MAQFYSA------------------------
RLMD_ECOL6      -----------------------------MAQFYSA------------------------
RLMD_ECOL5      -----------------------------MAQFYSA------------------------
RLMD_ECO57      -----------------------------MAQFYSA------------------------
RLMD_SHIBS      -----------------------------MAQFYSA------------------------
RLMD_SHIDS      -----------------------------MAQFYSA------------------------
RLMD_SHISS      -----------------------------MAQFYSA------------------------
RLMD_CITK8      -----------------------------MAQFYSA------------------------
RLMD_SALCH      -----------------------------MAQFYSA------------------------
RLMD_SALTY      -----------------------------MAQFYSA------------------------
RLMD_SALPA      -----------------------------MAQFYSA------------------------
RLMD_SALTI      -----------------------------MAQFYSA------------------------
RLMD_KLEP3      -----------------------------MAQFYSA------------------------
RLMD_KLEP7      -----------------------------MAQFYSA------------------------
RLMD_ENT38      -----------------------------MAQFYSA------------------------
RLMD_CROS8      -----------------------------MAQFYSA------------------------
RLMD_ERWT9      -----------------------------MAQFYSA------------------------
RLMD_PECAS      -----------------------------MAQFYSP------------------------
RLMD_PECCP      -----------------------------MAQFYSP------------------------
RLMD_YERE8      -----------------------------MAQFYSP------------------------
RLMD_PHOLL      -----------------------------MVQFYSP------------------------
RLMD_EDWI9      -----------------------------MAQFYTP------------------------
RLMD_PROMH      -----------------------------MVQFYSP------------------------
RLMD_HAEIN      -----------------------------MVLLYTP------------------------
RLMD_HAEI8      -----------------------------MVLLYTP------------------------
RLMD_HAEP3      -----------------------------MALLYAP------------------------
RLMD_HAES1      -----------------------------MVLLYQP------------------------
RLMD_MANSM      -----------------------------MVLLYTPP-----------------------
RLMD_PASMU      -----------------------------MVLHYTP------------------------
RLMD_HAEDU      -----------------------------MAIFYSEKT----------------------
RLMD_COLP3      -----------------------------MANYFKAAV----------------------
RLMD_PSYIN      -----------------------------MAQFFKAAP----------------------
RLMD_IDILO      -----------------------------MAQFFKP------------------------
RLMD_ALTMD      -----------------------------MANLFKQSRAKQKNKTTPSQTQTSTKGSARA
RLMD_ALTNA      -----------------------------MAIFYKPSKGKNK---------SNVKGRVRG
RLMD_DICNV      ------------------------------------------------------------
RLMD_PSEAE      ------------------------MARNKGGLRFQP------------------------
RLMD_PSEAB      ------------------------MARNKGGLRFQP------------------------
RLMD_PSEE4      ----------------------MSRKKSNGGLRFQP------------------------
RLMD_PSEPK      ----------------------MSKKKSNSGLRFQP------------------------
RLMD_PSEF5      ------------------------MAKHDRGLRFQP------------------------
RLMD_PSEPF      ------------------------MAKHERGLRFQP------------------------
RLMD_PSE14      ------------------------MAKHERGLRFQP------------------------
RLMD_PSEU2      ------------------------MAKHERGLRFQP------------------------
RLMD_PSESM      ------------------------MAKHERGLRFQP------------------------
RLMD_ACIF2      ------------------------------------------------------------
RLMD_ACIF5      ------------------------------------------------------------
RLMD_ACIAC      ----------------------------------------------------------MS
RLMD_ACISJ      ----------------------------------------------------------MS
RLMD_VEREI      ----------------------------------------------------------MS
RLMD_RHOFT      ----------------------------------------------------------MT
RLMD_POLNA      ----------------------------------------------------------MI
RLMD_POLSJ      ----------------------------------------------------------MT
RLMD_RUBGI      ------------------------------------------------------------
RLMD_BORBR      ------------------------------------------------------------
RLMD_BORPA      ------------------------------------------------------------
RLMD_BORPE      ------------------------------------------------------------
RLMD_BORA1      ------------------------------------------------------------
RLMD_BURCA      ---------------------------------------------------------MSE
RLMD_BURCH      ---------------------------------------------------------MSE
RLMD_BURL3      ---------------------------------------------------------MSE
RLMD_BURCM      ---------------------------------------------------------MSE
RLMD_BURMA      ---------------------------------------------------------MSE
RLMD_BURPS      ---------------------------------------------------------MSE
RLMD_BURP1      ---------------------------------------------------------MSE
RLMD_BURTA      ---------------------------------------------------------MSE
RLMD_PARXL      ---------------------------------------------------------MSR
RLMD_CUPNH      ------------------------------------------------------------
RLMD_CUPMC      ------------------------------------------------------------
RLMD_CUPPJ      ------------------------------------------------------------
RLMD_RALPJ      ------------------------------------------------------------
RLMD_RALSO      ------------------------------------------------------------
RLMD_POLNS      ------------------------------------------------------------
RLMD_AZOSB      ------------------------------------------------------------
RLMD_AROAE      ------------------------------------------------------------
RLMD_CHRVO      ------------------------------------------------------------
RLMD_METFK      ------------------------------------------------------------
RLMD_NITMU      ------------------------------------------------------------
RLMD_DECAR      ------------------------------------------------------------
RLMD_THIDA      ------------------------------------------------------------
RLMD_NEIL0      ------------------------------------------------------------
RLMD_ACIB3      ------------------------------------------------------------
RLMD_ACIBY      ------------------------------------------------------------
RLMD_ACIB5      ------------------------------------------------------------
RLMD_ACIBC      ------------------------------------------------------------
RLMD_ACIBS      ------------------------------------------------------------
RLMD_ACIAD      ------------------------------------------------------------
RLMD_PSYA2      --------------------------------------MQPTDSKTSTS-DTTEQPNETQ
RLMD_PSYCK      --------------------------------------MQPTDSKTLTNVDATEQANETQ
RLMD_ALCBS      ------------------------------------------------------------
RLMD_MARHV      ------------------------------------------------------------
RLMD_HAHCH      ------------------------------------------------------------
RLMD_ALKEH      ------------------------------------------------------------
RLMD_METCA      ------------------------------------------------------------
RLMD_NITOC      ------------------------------------------------------------
RLMD_STRMK      ------------------------------------------------------------
RLMD_STRM5      ------------------------------------------------------------
RLMD_XANAC      ------------------------------------------------------------
RLMD_XANC5      ------------------------------------------------------------
RLMD_XANOR      ------------------------------------------------------------
RLMD_XANOM      ------------------------------------------------------------
RLMD_XANCP      ------------------------------------------------------------
RLMD_XANC8      ------------------------------------------------------------
RLMD_XYLFA      ------------------------------------------------------------
RLMD_XYLFT      ------------------------------------------------------------
RLMD_FRATH      ------------------------------------------------------------
RLMD_FRATO      ------------------------------------------------------------
RLMD_FRATT      ------------------------------------------------------------
RLMD_FRAT1      ------------------------------------------------------------
RLMD_FRATN      ------------------------------------------------------------
RLMD_LEGPC      ------------------------------------------------------------
RLMD_LEGPA      ------------------------------------------------------------
RLMD_LEGPH      ------------------------------------------------------------
RLMD_LEGPL      ------------------------------------------------------------
RLMD_VESOH      ------------------------------------------------------------
                                                                            

RLMD_CHRSD      ------------RRDDAT----ADG---LSIERLAHDGRGVARDPHGK------------
RLMD_HALED      ------------VERSAG----SEGRRELVIQGLAHDGRGVARDVDGK------------
RLMD_CELJU      ------------RREQPQPLQRNKRLGELLIDRFSHDGRGLA-SLDGK------------
RLMD_MARPP      ------------RRP--AKKAPLGPMQTYLVEGLTHEAKGVA-RLNGK------------
RLMD_MARMS      ------------RRTTTSKPQPIGPIQTFEVDGLTHEAKGVA-RLQGK------------
RLMD_MARM1      ------------RPPQKNNKFPI-YTKEFLVEGLTHDAKGVA-RDEGK------------
RLMD_HYDCU      -----------------------MKTVTVKIETLSHDGRGVG-RLNGK------------
RLMD_AERHH      -------------QKKSTQ----PQRIEFTVDSLDHHCVGIGRHQGK-------------
RLMD_AERS4      -------------QKKSTQ----PQRIEFTVDSLDHHCVGIGRHQGK-------------
RLMD_TOLAT      -------------KPKALP----TQAVEITIDNLDHHLTGVGRYQGK-------------
RLMD_PSEHT      -------------TKKPLK----QQSLVLDITAMDHHGRGIAKHNNK-------------
RLMD_SHEB9      -------------KPNSSKQL--SAKLSLSVNQLDHLGAGIAQHQGK-------------
RLMD_SHEB2      -------------KPNSSKQL--SAKLSLSVNQLDHLGAGIAQHQGK-------------
RLMD_SHEB8      -------------KPNSSKQL--SAKLSLSVNQLDHLGAGIAQHQGK-------------
RLMD_SHEB5      -------------KPNSSKQL--SAKLSLSVNQLDHLGAGIAQHQGK-------------
RLMD_SHEPC      -------------KPNSSKQL--SAKLSLNVDQLDHLGAGIAQYQGK-------------
RLMD_SHESW      -------------KPNSSKQL--SAKLSLNVDQLDHLGAGIAQYQGK-------------
RLMD_SHESM      -------------KPNSSKQL--SAKQSFSVHQLDHLGAGIAQHQGK-------------
RLMD_SHESR      -------------KPNSSKQL--SAKQSFSVHQLDHLGAGIAQHQGK-------------
RLMD_SHESA      -------------KPNSSKQL--SAKQSFSVHQLDHLGAGIAQHQGK-------------
RLMD_SHEON      -------------KPNSSKQL--SAKQSFSVQQLDHLGAGIAQHQGK-------------
RLMD_SHESH      -------------KPNSSKQL--SAKVTLEVTKLDHLGAGMAQHQGK-------------
RLMD_SHEWM      -------------KPNSSKQL--SAKVSLQVTRLDHLGAGIAQHNGK-------------
RLMD_SHEHH      -------------KPNTSKQL--SSKLSLKVTQLDHLGAGIAHHDGK-------------
RLMD_SHEPA      -------------KPNRSKQL--SSKLSLKVTQLDHLGAGIAHHDGK-------------
RLMD_SHEPW      -------------KPNRSKQL--SSKLSLNVTQLDHLGAGIAHHQGK-------------
RLMD_SHEDO      -------------KANKSKQL--SPKLSLNVTQLDHLGAGMAQHQGK-------------
RLMD_SHEFN      -------------KPNKSKQL--SAKLSLSVTQLDHLGAGIAQHQGK-------------
RLMD_SHEAM      -------------KPNQAKKL--SQKIALKVQRLDHLGAGIAEHQGK-------------
RLMD_FERBD      -------------KSNKTKHL--SQKISLTPTALDHQGQAVAEHQGK-------------
RLMD_ALIF1      ------------KKKASVNTK----HQSVDVVRLDHNGAGIAFVDKK-------------
RLMD_ALIFM      ------------KKKASVNTK----HLSVDVVRLDHNGAGIAFVDKK-------------
RLMD_ALISL      ------------KKKASVNTK----HLSVDVVRLDHNSAGIAFVDKK-------------
RLMD_PHOPR      ------------QKRKITDTK----HKEIVINRLDHLGAGIGHLNNK-------------
RLMD_VIBCH      ------------KKHSTLDTK----HQPVTIERLDHQGSGLAFLHKK-------------
RLMD_VIBCM      ------------KKHSTLDTK----HQPVTIERLDHQGSGLAFLHKK-------------
RLMD_VIBC3      ------------KKHSTLDTK----HQPVTIERLDHQGSGLAFLHKK-------------
RLMD_VIBCB      ------------KKKTQLNTR----HQAVQVERLDHHGAGIAYLKKK-------------
RLMD_VIBPA      ------------KKKTQLNTR----HQAVQVERLDHHGAGIAYLKKK-------------
RLMD_VIBVU      ------------KKKLQPESK----HQQVLVEKLDHQGAGIAYLNKK-------------
RLMD_VIBVY      ------------KKKLQPESK----HQQVLVEKLDHQGAGIAYLNKK-------------
RLMD_VIBTL      ------------KKKTQLETK----HQSVLVERMDHNGAGIAYQKNK-------------
RLMD_SHIFL      ------------KRRTTTRQI-----ITVSVNDLDSFGQGVARHNGK-------------
RLMD_SHIF8      ------------KRRTTTRQI-----ITVSVNDLDSFGQGVARHNGK-------------
RLMD_ECOLI      ------------KRRTTTRQI-----ITVSVNDLDSFGQGVARHNGK-------------
RLMD_ECOUT      ------------KRRTTTRQI-----ITVSVNDLDSFGQGVARHNGK-------------
RLMD_ECOK1      ------------KRRTTTRQI-----ITVSVNDLDSFGQGVARHNGK-------------
RLMD_ECOL6      ------------KRRTTTRQI-----ITVSVNDLDSFGQGVARHNGK-------------
RLMD_ECOL5      ------------KRRTTTRQI-----ITVSVNDLDSFGQGVARHNGK-------------
RLMD_ECO57      ------------KRRTTTRQI-----ITVSVNDLDSFGQGVARHNGK-------------
RLMD_SHIBS      ------------KRRTTTRQI-----ITVSVNDLDSFGQGVARHNGK-------------
RLMD_SHIDS      ------------KRRTTTRQI-----ITVSVNDLDSFGQGVARHNGK-------------
RLMD_SHISS      ------------KRRTTTRQI-----ITVSVNDLDSFGQGVARHNGK-------------
RLMD_CITK8      ------------KRRVTTRQI-----ITVTVNDLDPFGQGVARHNGK-------------
RLMD_SALCH      ------------KRRVTTRQI-----ITVKVNDLDSFGQGVARHNGK-------------
RLMD_SALTY      ------------KRRVTTRQI-----ITVKVNDLDSFGQGVARHNGK-------------
RLMD_SALPA      ------------KRRVTTRQI-----ITVKVNDLDSFGQGVARHNGK-------------
RLMD_SALTI      ------------KRRVTTRQI-----ITVKVNDLDSFGQGVARHNGK-------------
RLMD_KLEP3      ------------KRRVTTRQI-----ITVTVNDLDPFGQGVARHQGK-------------
RLMD_KLEP7      ------------KRRVTTRQI-----ITVTVNDLDPFGQGVARHQGK-------------
RLMD_ENT38      ------------KRRVTTRQI-----ITVEATDLDPFGQGVARHNGK-------------
RLMD_CROS8      ------------KRRVTTREI-----ITVTTDGLDAFGQGVARHHGK-------------
RLMD_ERWT9      ------------KRRVTTRQT-----ITVKVHDLDSFGQGVAHHNGK-------------
RLMD_PECAS      ------------NRRVTTRKAVPAKNLTVTVASLDPFGQGVARHEGK-------------
RLMD_PECCP      ------------NRRVTTRKAIPAKNLTVTVTSLDPFGQGVARHEGK-------------
RLMD_YERE8      ------------NRRVTTKQT-----LTVTVNSLDPFGQGVAHHQGK-------------
RLMD_PHOLL      ------------NRRTVNRHI-----ITVTADNLDAQGQGVARHQGK-------------
RLMD_EDWI9      ------------GRRTATRKI-----LIVTATDLDAFGQGVAREQGK-------------
RLMD_PROMH      ------------KKRPAKKQV---KNLAVTANALDANGQGIAHAEGK-------------
RLMD_HAEIN      ------------KQKTKNVQT-----ITADILDLDYQGLGVAKINGK-------------
RLMD_HAEI8      ------------KQKTNNVQT-----ITADILDLDYQGLGVAKINGK-------------
RLMD_HAEP3      ------------QKKQKTTQK-----IVAEIQDLDYQGLGVAKIQGK-------------
RLMD_HAES1      ------------KKQKKLRAA-----FTTIVQDLDYQGLGVAKIQGK-------------
RLMD_MANSM      ------------QKINKLQRE-----MEVEILDLDYQGLGVAKIQGK-------------
RLMD_PASMU      ------------HQSAPRNTT-----FVAEILDLDYQGRGVAKVQGK-------------
RLMD_HAEDU      -------AKQTAKNCCKTTAR-----QIVNIHSLDYQGLDVAKINGK-------------
RLMD_COLP3      ------------KPKTSNQRL------TVTVDKLDMNGVGVARWQNK-------------
RLMD_PSYIN      ------------TNSIKNHILK-----NIKVEKLDHRGRGLAYFQNK-------------
RLMD_IDILO      ------------QKRNKSVSK----TLKGQVSALDHQARAVVRAAVKGQS----------
RLMD_ALTMD      NAQVAGLRFKKSKQSKEHNTAQDANNNAITIQELDWMGQGVAR-GATMY-----------
RLMD_ALTNA      AGSGEKQHIVKTKQSWPSVDDINAANEAVTIDGMDWQGQGVAR-GDTLY-----------
RLMD_DICNV      ----------------------MEKFPAVTVFDLDYQGRGVAKIDGQVV-----------
RLMD_PSEAE      ------------SGGARGPAIPVGKKQRLTIERLAHDGRGIAHEAGM-------------
RLMD_PSEAB      ------------SGGARGPAIPVGKKQRLTIERLAHDGRGIAHEAGM-------------
RLMD_PSEE4      ------------AGGNRATQIPVGKKQRLLIERVAGDGRGIAFIEGR-------------
RLMD_PSEPK      ------------AGGNRTPQVPVGKKQRLDIERLAGDGRGIAFLDGR-------------
RLMD_PSEF5      ------------AGGSRAPQIPVGKKQRLTIQRLANDGRGIAFVEGR-------------
RLMD_PSEPF      ------------TGGSKAPQIPTGKKQRLSIERLANDGRGIAFFEGK-------------
RLMD_PSE14      ------------AGGVKTVQIPAGKKQRLTIERLSDDGRGIAFLEGK-------------
RLMD_PSEU2      ------------AGGVKTVQIPAGKKQRLTIERLSDDGRGIAFLEGK-------------
RLMD_PSESM      ------------TGGVKSVQIPAGKKQRLSIERLSDDGRGIAFLEGK-------------
RLMD_ACIF2      --------------MSRPKPIHNAQPEQVFIESLDTEGRGIARV---------------E
RLMD_ACIF5      --------------MSRPKPIHNAQPEQVFIESLDTEGRGIARV---------------E
RLMD_ACIAC      DPTEHPEILQDPSSSAPVQGRTDLPPGWLEVTSMDMDAQGVARRP--------------D
RLMD_ACISJ      DPTEF---------SPPPPTSTDLPPGWLEVTAMDMDAQGVARKP--------------D
RLMD_VEREI      EPKEPS-----PALACAAQDGSGLPEGWLQVQSMDLDAQGVARRA--------------D
RLMD_RHOFT      D---------------DMHKTENFPPDWLLVESLDLEAQGVAHRA--------------D
RLMD_POLNA      EETQTPSP------PAPAPAPAEYPIDLLTVESLDIEAQGIAHRA--------------D
RLMD_POLSJ      DEKLNDH----------TVKAPEYLPDILTVESLDMEAQGIAHRA--------------D
RLMD_RUBGI      ---------------------MSSGMDWLQVESLDLEAQGVAHRA--------------D
RLMD_BORBR      -----------------------MVD-VLNIESLDLEARGIAHR---------------D
RLMD_BORPA      -----------------------MVD-VLNIESLDLEARGIAHR---------------D
RLMD_BORPE      -----------------------MVD-VLNIESLDLEARGIAHR---------------D
RLMD_BORA1      -----------------------MVDEVLKIESLDLEARGIARR---------------D
RLMD_BURCA      AVPTSARKSKN-------APVAPGPAPVLEIESLDMEARGVGRTMTED---------GEP
RLMD_BURCH      AVPTSARKSKN-------APVAPGPAPVLEIESLDMEARGVGRTMTED---------GEP
RLMD_BURL3      AVPTSARKSRN-------APVAPGPAPVLEIESLDMEARGVGRTITED---------GEP
RLMD_BURCM      AVPTSARKSKN-------APVAPGPAPVLEIESLDMEARGVGRTVTED---------GTP
RLMD_BURMA      AVPLSTRRASS-------AGDAPGRAPVLDIDSLDMEARGVGRVVDEN---------GEP
RLMD_BURPS      AVPLSTRRASS-------AGDAPGRAPVLDIDSLDMEARGVGRVVDEN---------GEP
RLMD_BURP1      AVPLSTRRASS-------AGDAPGRAPVLDIDSLDMEARGVGRVVDEN---------GEP
RLMD_BURTA      AVPLSTPGASH-------AGAATDRAPVLDIDSLDMEARGVGRAVDEN---------GEP
RLMD_PARXL      TAPHRRAPKRYKTPPPAPAHVVTGNEPVIEIISLDMEARGVGRTETED---------GTP
RLMD_CUPNH      ----------------------------MSIDSLDMEARGVGRLLNED---------GTP
RLMD_CUPMC      ---MSSQPNPTSHPEAASAASAASNDPVVKIDSLDMEARGVGRLENED---------GTP
RLMD_CUPPJ      ------MPAAPRAASASPAAVAPGSDPVVSIDSLDMEARGVGRLVNED---------GTP
RLMD_RALPJ      ----------------------MPVAGPLDIVSLDGEARGIGRLTNED---------GTP
RLMD_RALSO      ----------------------MPVAGPLEIVSLDNEARGVGRLSNED---------GTP
RLMD_POLNS      ----MHRGDKP---------VNIEVAEPITVEVLDLDAQGIARLAPSE----EEAAQDQS
RLMD_AZOSB      -------------------------MPTAVIESLDHEGRGIARV---------------E
RLMD_AROAE      -------------------------MPVAVIESLDHEGRGVAHV---------------D
RLMD_CHRVO      ---------------------MTHPQTIALVESLDHEGRGVAHV---------------D
RLMD_METFK      -----------------------MSTPIALVESLDQEGRGVAHV---------------E
RLMD_NITMU      ------------------------MTAPVLIESLDQEGRGVAHA---------------E
RLMD_DECAR      -------------------------MPIGKIESLDHEARGITRQ---------------E
RLMD_THIDA      ------------------------MNPVVDILSLDHEGHGVARL---------------D
RLMD_NEIL0      ---------------------METEVNVAEISALDYEGRGVTKV---------------G
RLMD_ACIB3      --------MKQQAKS----RKPQQPEYIFQVETLSHEGRGIAHYG----SHP-DHPADKH
RLMD_ACIBY      --------MKQQAKS----RKPQQPEYIFQVETLSHEGRGIAHYG----SHP-DHPADKH
RLMD_ACIB5      --------MKQQAKS----RKPQQPEYIFQVETLSHEGRGIAHYG----SHP-DHPADKH
RLMD_ACIBC      --------MKQQAKS----RKPQQPEYIFQVETLSHEGRGIAHYG----SHP-DHPADKH
RLMD_ACIBS      --------MKQQAKS----RKPQQPEYIFQVETLSHEGRGIAHYG----SHP-DHPADKH
RLMD_ACIAD      --------MKKHASS----RSKSATVYTFRIESFSHEGRGIAHFG----EFA-EHPQTKH
RLMD_PSYA2      TITIPPSKKKSKPSSKTRRRLKDAEPLPFAIDGLSHDGRGVAVYGNGFVEAD-GHITDKH
RLMD_PSYCK      TITIPPNKKKSKPSSKTRRRLKDAEPLPFTIDGLSHDGRGVAVYGNGFGETD-GHITDKH
RLMD_ALCBS      --------------MARRRKQLPETPEPASIETLSHDGRGIARRDG--------------
RLMD_MARHV      -------------MSKRRRKVLPKEPVRCEIETLSHDGRGIARADG--------------
RLMD_HAHCH      --------------MSRRRKKLPQESITCEIESLSHEGRGVSHKDG--------------
RLMD_ALKEH      ------------MGRRRRR--LPREPFEIAITGLSHEGRGIAHHDE--------------
RLMD_METCA      ------------MGHRGKRKPLPAEPIAAHIESFAHDGKGIAHVDG--------------
RLMD_NITOC      ------------MAHHPKRKPLSQEPQKASIEALTHEGRGIAHVAG--------------
RLMD_STRMK      --------------MARSRSRIDRTPFQTEILDLSHDGRGVARREGE------------G
RLMD_STRM5      --------------MARSRSRIDRTPFQTEILDLSHDGRGVARREGE------------G
RLMD_XANAC      --------------MARTRNRLDRTPFQTAVTDLSHDGRGVARRDGE------------G
RLMD_XANC5      --------------MARTRNRLDRTPFQTAVTDLSHDGRGVARRDGE------------G
RLMD_XANOR      --------------MARTRNRFDRTPFQTAITDLSHDGRGVARRDGE------------G
RLMD_XANOM      --------------MARTRNRFDRTPFQTAITDLSHDGRGVARRDGE------------G
RLMD_XANCP      --------------MARSRNRFDRTPFQTAITDLSHDGRGVARRDGE------------G
RLMD_XANC8      --------------MARSRNRFDRTPFQTAITDLSHDGRGVARRDGE------------G
RLMD_XYLFA      --------------MAR-QNRFDRTSFQTQIIDLSHDGRGVARPHGE------------G
RLMD_XYLFT      --------------MAR-QNRFDRTSFQTQIIDLSHDGRGVARPHGE------------G
RLMD_FRATH      ------------MGRSRYHNKLKEGIFEAEITALSHDGRGIAKVDG--------------
RLMD_FRATO      ------------MGRSRYHNKLKEGIFEAEITALSHDGRGIAKVDG--------------
RLMD_FRATT      ------------MGRSRHHNKLKEGIFEAEITALSHDGRGIAKVDG--------------
RLMD_FRAT1      ------------MGRSRHHNKLKEGIFEAEITALSHDGRGIAKVDG--------------
RLMD_FRATN      ------------MGRSRHHNKLKEGIFEAEITALSHDGRGIAKVDG--------------
RLMD_LEGPC      --------------MRKVKPKLNLTSQTARIVNLSHDGRGIARVNG--------------
RLMD_LEGPA      --------------MRKVKPKLNLTSQTARIVNLSHDGRGIARVNG--------------
RLMD_LEGPH      --------------MRKVKPKLNLTSQTARIVNLSHDGRGIARVNG--------------
RLMD_LEGPL      --------------MRKVKPKLNLTSQTARIVNLSHDGRGIARING--------------
RLMD_VESOH      ---------------MRRRRKLEHKTYKLNIESFSHEGRGIAHFED--------------
                                                 .      :                   

RLMD_CHRSD      --TVFVDQALPGERVRVAVHRQRKRFDEAHVVERLA-TSPERATPPCAYYGR----CGGC
RLMD_HALED      --TVFVEGALPGERVQASVHRRRKRFDEAHVSEVIA-ASASRVAPPCRHYGS----CGGC
RLMD_CELJU      --TLFVDGAIAGETVTARLLEDHPRFAEARVEDVIL-ASPDRVEPPCAHYAT----CGGC
RLMD_MARPP      --VTFIEGALPGETVTAQVNKPGRRFDEAVLNAVIE-TSVDRVSPACQHFGD----CGGC
RLMD_MARMS      --VTFIEGALPGETVEAQVNKAGRRFDEAVLVNIIE-PSVYRVEPSCQHFNL----CGGC
RLMD_MARM1      --VIFIEGALPGERVEAQVVKQGRRFDEAKTKKVLI-ESSSRVAPACAHFVE----CGGC
RLMD_HYDCU      --AIFVEEAVPGDVAEIRITGRQPSYEEAKIVRLID-SSEDRVEAFCPHYET----CGGC
RLMD_AERHH      --AIFIEGALPGELVKARILEDKKQYAHAALQQVVT-PAANRIAPFCSHYRE----CGGC
RLMD_AERS4      --AIFIEGALPGEQVKARILDDKKQYAHAALQQVVT-PAANRIAPFCNHYRE----CGGC
RLMD_TOLAT      --ACFVEGVLPGEKVSVQITEQKKQYAHARLRQVIE-PSADRCEPFCPAFKQ----CGGC
RLMD_PSEHT      --VCFVSNALPNEQVKATIIADKARYSEAQTHKVLQ-ASEYRVAPFCEHYNQ----CGGC
RLMD_SHEB9      --VVFIPGALPDETVTVQLTEQKKNYARAKLIKVDT-PSSERVEPECPHYHT----CGGC
RLMD_SHEB2      --VVFIPGALPDETVTVQLTEQKKNYARAKLIKVDT-PSSERVAPECPHYHT----CGGC
RLMD_SHEB8      --VVFIPGALPDETVTVQLTEQKKNYARAKLIKVDT-PSSERVEPECPHYHT----CGGC
RLMD_SHEB5      --VVFIPGALPDETVTVQFTEQKKNYARAKLIKVDT-PSSERVEPECPHYHT----CGGC
RLMD_SHEPC      --VVFIPGALPDETVTVQLTEQKKNYARAKLIKVDA-QSPERVEPECPHYHT----CGGC
RLMD_SHESW      --VVFIPGALPDETVTVQLTEQKKNYARAKLIKVDA-QSPERVEPECPHYHT----CGGC
RLMD_SHESM      --VVFIPGALPSETVQAQLTEQKKNYARAKLIKVET-PSAERVTPLCPHYQS----CGGC
RLMD_SHESR      --VVFIPGALPSETVQAQLTEQKKNYARAKLIKVET-PSAERVTPLCPHYQS----CGGC
RLMD_SHESA      --VVFIPGALPNETVQAQLTEQKKNYARAKLIKVET-PSAERVTPLCPHYQS----CGGC
RLMD_SHEON      --VVFIPGALPNETVQAQLTEQKKNYARAKLIKVET-PSTERVSPLCPHYHT----CGGC
RLMD_SHESH      --IVFIPGALPNEKVTVQLTEQKKRHARAKLLKIES-DSNDRVEPKCPHYQQ----CGGC
RLMD_SHEWM      --VVFIPGVLPGEKAMVQLTEQKKRYSRAKLLNLET-HSIDRVEPKCAHYHQ----CGGC
RLMD_SHEHH      --IVFINGALPGETVSVQLTEQKKKFARAKLLKIDK-ASAQRVSPLCPHFDK----CGGC
RLMD_SHEPA      --IVFINGALPDETVSVQLTEQKKKFSRGKLLKIEK-RSTERVTPPCPHFDK----CGGC
RLMD_SHEPW      --IVFINGALPGETVQVQLTEQKKKFSRAKLLKVET-ASGERVSPLCIHYEK----CGGC
RLMD_SHEDO      --VVFIPQALPGERVSVQLTDQKKSFAKAKLIKIEQ-QSPERADASCPHYGH----CGGC
RLMD_SHEFN      --IVFIPGVLPGETATVQFVEQKKSYAKAKLISIES-ASVNRIKPHCPHYQQ----CGGC
RLMD_SHEAM      --VVFIPGALPGETVEVQLTEQKKNYARAKLQRVSE-ASPDRQTPPCPWYGK----CGGC
RLMD_FERBD      --VVFVPGLLPGESAQVQLVENKARFARAKVLKRTS-DHPQRIAPPCPHFAR----CGGC
RLMD_ALIF1      --PVFIEGALPGEKAIIQFIEQKKQFSRAKLIKLAQ-KSEKRQTPICQHYHE----CGGC
RLMD_ALIFM      --PVFIEGALPGEKAIIQFIEQKKQFSRAKLIKLAQ-KSEKRQTPICQHYHE----CGGC
RLMD_ALISL      --PVFIEGALPEEQAIIQFIEQKKQYSRAKLIKLTK-KSSKRQAPICQHYDD----CGGC
RLMD_PHOPR      --SIFVDGLLPGEKALVQITDDKKQYARAKVIKRLI-DSPARIKPHCPIYDQ----CGGC
RLMD_VIBCH      --PLFVDGALPGEEVLIQLTENKSKYARGQLIKVLK-PSAERVAPFCAHYAQ----CGGC
RLMD_VIBCM      --PLFVDGALPGEEVLIQLTENKSKYARGQLIKVLK-PSAERVAPFCAHYAQ----CGGC
RLMD_VIBC3      --PLFVDGALPGEEVLIQLTENKSKYARGQLIKVLK-PSAERVAPFCAHYAQ----CGGC
RLMD_VIBCB      --PLFIDGALPGEEVVTQLVEEKSKFARGKLIKILK-PSEARVEPFCSHYHE----CGGC
RLMD_VIBPA      --PLFIDGALPGEEVVTQLVEEKSKFARGKLIKILK-PSDARVEPFCPHYHE----CGGC
RLMD_VIBVU      --PLFIDGTLPGEEVVTQLTESKSKFARGKLIKLLK-PAAERVEPFCSHFNQ----CGGC
RLMD_VIBVY      --PLFIDGTLPGEEVVTQLTESKSKFARGKLIKLLK-PAAERVEPFCSHFNQ----CGGC
RLMD_VIBTL      --PVFIDGALPGEKVVIQLTESKSKFSRAKLIKLLQ-PSELRLKPFCKHFNQ----CGGC
RLMD_SHIFL      --TLFIPGLLPQENAEVAVTEDKKQYARAKVVRRLS-DSPERETPRCPHFGV----CGGC
RLMD_SHIF8      --TLFIPGLLPQENAEVAVTEDKKQYARAKVVRRLS-DSPERETPRCPHFGV----CGGC
RLMD_ECOLI      --TLFIPGLLPQENAEVTVTEDKKQYARAKVVRRLS-DSPERETPRCPHFGV----CGGC
RLMD_ECOUT      --TLFIPGLLPQENAEVTVTEDKKQYARAKVVRRLS-DSPERETPRCPHFGV----CGGC
RLMD_ECOK1      --TLFIPGLLPQENAEVTVTEDKKQYARAKVVRRLS-DSPERETPRCPHFGV----CGGC
RLMD_ECOL6      --TLFIPGLLPQENAEVTVTEDKKQYARAKVVRRLS-DSPERETPRCPHFGV----CGGC
RLMD_ECOL5      --TLFIPGLLPQENAEVTVTEDKKQYARAKVVRRLS-DSPERETPRCPHFGV----CGGC
RLMD_ECO57      --TLFIPGLLPQENAEVTVTEDKKQYARAKVVRRLS-DSPERETPRCPHFGV----CGGC
RLMD_SHIBS      --TLFIPGLLPQENAEVTVTEDKKQYARAKVVRRLS-DSPERETPRCPHFGV----CGGC
RLMD_SHIDS      --TLFIPGLLSQENAEVTVTEDKKQYARAKVVRRLS-DSPERETPRCPHFGV----CGGC
RLMD_SHISS      --TLFIPGLLPQENAEVTVTEDKKQYARAKVVRRLS-DSPGRETPRCPHFGV----CGGC
RLMD_CITK8      --ALFIPGLLPQEKGDVVITEDKKQFARAQVKRRLN-DSPERETPRCPHFGV----CGGC
RLMD_SALCH      --ALFIPGLLPEESAEVIITEDKKQFARARVSRRLN-DSPERETPRCPHFGV----CGGC
RLMD_SALTY      --ALFIPGLLPEESAEVIITEDKKQFARARVSRRLN-DSPERETPRCPHFGV----CGGC
RLMD_SALPA      --ALFIPGLLPEESAEVIITEDKKQFARARVSRRLN-DSPERETPRCPHFGV----CGGC
RLMD_SALTI      --ALFIPGLLPEESAEVIITEDKKQFARARVSRRLN-DSPERETPRCPHFGV----CGGC
RLMD_KLEP3      --ALFVSGVLPQEQAEVVLVEDKKQYARAQVKRRLT-DSPQRQAPRCPHFGV----CGGC
RLMD_KLEP7      --ALFVSGVLPHEQAEVVLVEDKKQYARAEVKRRLT-DSPQRQAPRCPHFGV----CGGC
RLMD_ENT38      --ALFIPGLLPNERAEVTLTEDKSKYSRGQVKRRLN-DSPERVAPRCPHFGV----CGGC
RLMD_CROS8      --ALFIAGLLPGERAEVVLSEDKKQFARGDVKKRLS-ESPERETPRCPHFGV----CGGC
RLMD_ERWT9      --ALFVQGALPDEVAEVSIIEDKRHFSRGVATRIVT-ASPQRVEPRCPHYSR----CGGC
RLMD_PECAS      --TVFVTGVLPGEQAEVQLTEEKRQFSHAKLKRLLT-PSPQRVEPPCPHFTR----CGGC
RLMD_PECCP      --TVFVTGVLPGEQAEVQLTEDKRQFSHAKLKRLLT-HSPQRVEPQCPHFTR----CGGC
RLMD_YERE8      --AIFIPGALPGEQAEIELTEQKRQYSRGKLKRLLN-RCNERVVPACPHFGI----CGGC
RLMD_PHOLL      --TIFVAGLLPGEQAQVQLTEEKRQFAKAKLVKRLS-DSPYRVNPRCPHFGV----CGGC
RLMD_EDWI9      --TLFISGLLPGEQAEVILSEEKRHFARGRVTRLIS-HSPQRVAPRCPHAGV----CGGC
RLMD_PROMH      --TIFVKGLLPQETARIRLTEEKRQFAKGEVITRLT-TNPERVTPPCQYYQH----CGGC
RLMD_HAEIN      --TWFIENALPHEKVECRILEDKRQYGHAIVKKWRV-KSPERLEPKCAHFMR----CGGC
RLMD_HAEI8      --TWFIENALPHEKVECRILEDKRQYGHATAKKWRV-KSSERLEPKCAHFMR----CGGC
RLMD_HAEP3      --TWFIENALPTEKVEAVVTDEKRQYGLATAQKWLQ-ESSQRVEPQCRYYGR----CGGC
RLMD_HAES1      --TWFIENALPQEQVQVQVIEEKRQYGLGRVQKILQ-ASPLRQTPRCAYYQI----CGGC
RLMD_MANSM      --TWFVENALPGEKVRIKIKEEKRQFGLATTKKILE-ASAQRQTPKCQYASR----CGGC
RLMD_PASMU      --TWFIENALPQEKVEVRIVDEKRHYGHGISCKILT-PHPDRQSAKCAYYAQ----CGGC
RLMD_HAEDU      --TWFIENALPNEQVLIHVIEEKRQYGRAKANKILQ-ASPLRQQPSCISYPQ----CGGC
RLMD_COLP3      --PIFIAGVLPDEIVDVKVIEQKSKYARAKLISIDK-QSASRVIPQCQHFGL----CGGC
RLMD_PSYIN      --PLFIDGALAGELLEVQIVESKKRYSKGKIKKIIK-ASELRITAACPHYQE----CGGC
RLMD_IDILO      --TRFIMGALPGEVIEYKTAGKHS----GHLERILE-PSSDRREVPCEYYAS----CGGC
RLMD_ALTMD      ----FVEGALPGETCDIEVVSSKKKVVSAKTISIQG-PSELRQPPFCPVFEA----CGGC
RLMD_ALTNA      ----FVDGALPGETVEIKALSSNKQIVNAKVTKVNT-PSEHRQKPFCGVANQ----CGGC
RLMD_DICNV      ----FIEGALPDETVTFCKTSAKKQFIEAVVDEIIE-PSPQRVAPRCPFYDR----CGGC
RLMD_PSEAE      --TWFVSGGLPGEELEARVLGARSKVVDARSERLFS-SSDLRRREPCTVAGR----CGGC
RLMD_PSEAB      --TWFVSGGLPGEELEARVLGARSKVVDARSERLFS-SSDLRRREPCTVAGR----CGGC
RLMD_PSEE4      --TWFVSGALGGEEVEARVLGARGKVVEARLERVFQ-ASPERREAPCRHYAR----CGGC
RLMD_PSEPK      --TWFVSGALAGEAVEARVLNARGKVVEARLERLLQ-AAPERREAPCRYYDR----CGGC
RLMD_PSEF5      --TWFVSGALAGEEVEARVLGSHGKVVEARAERIFN-ASDLRRPAACAHAGR----CGGC
RLMD_PSEPF      --TWFVLGALAGEEVEARVLGAHGKVVEARTERVFS-ASELRRPAPCQHAGR----CGGC
RLMD_PSE14      --TWFVAGSLAGEEVEARVLNARGKVVEARTERVFT-ASTMRRAPACEYFGR----CGGC
RLMD_PSEU2      --TWFVAGSLAGEEVEARVLNARGKVVEARTERVFT-ASAMRRAPACEYFGR----CGGC
RLMD_PSESM      --TWFVAGSLAGEEVEARVLNARGKVVEARTERVFV-ASDLRRAPACDYFGR----CGGC
RLMD_ACIF2      GKVLFVDGALPGERVWARRTQNHKSFDRAELLQVDK-ASSLRVSPPCPHFGV----CGGC
RLMD_ACIF5      GKVLFVDGALPGERVWARRTQNHKSFDRAELLQVDK-ASSLRVSPPCPHFGV----CGGC
RLMD_ACIAC      GKVVFIDGALPFEWVSASTHRKKNNWEQASLTAIHR-ESPQRVRPGCPHFGLHAGACGGC
RLMD_ACISJ      GKVVFIDGALPTELVSANTHRKKNNWEQASLTEVHR-QSSQRVQPGCPHFGLHAGACGGC
RLMD_VEREI      GKVVFIDGALPSEWVSASTYRKKNHWEQANLTAIHR-ESAQRVRPGCPHFGLHAGACGGC
RLMD_RHOFT      GKVVFIKGALPFELVSANVHRKKNNWEQGVVTAIHR-ESSQRVQPGCPHFGLHEGACGGC
RLMD_POLNA      GKVVFIEGALPFEQVTANVYRKKSSFEKATLTAIYR-ESSQRVTPACPHFGMHTGACGGC
RLMD_POLSJ      GKVVFIEGALPFERVTANVYRKKSSFEKAVVMAIHR-ESSQRVRPACPHFGLHTGACGGC
RLMD_RUBGI      GKVVFIEGALPGETVQVQVSRRKNQWEQGVLSALAR-ESSQRVRPGCPHFGLHAGACGGC
RLMD_BORBR      GKVLFVEGALPGERVTVQTVRRKPSYEIAKVEEILR-PSSQRVAPRCPHFGV----CGGC
RLMD_BORPA      GKVLFVEGALPGERVTVQTVRRKPSYEIAKVEEILR-PSSQRVAPRCPHFGV----CGGC
RLMD_BORPE      GKVLFVEGALPGERVTVQTVRRKPSYEIAKVEEVLR-PSSQRVAPRCPHFGV----CGGC
RLMD_BORA1      GKVVFVEGALPGERVYAATVRRKPSYEIARVETVLT-PSSQRVEPRCPHFGV----CGGC
RLMD_BURCA      GKVIFVEGALPGERVTYSSYRRKPSYEQATVVDILR-PSVMRTQPKCTFFGT----CGGC
RLMD_BURCH      GKVIFVEGALPGERVTYSSYRRKPSYEQATVVDILR-PSVMRTQPKCTFFGT----CGGC
RLMD_BURL3      GKVIFVEGALPGERVTYSSFRRKPSYEQATVVDILR-PSVMRTKPKCAFFGT----CGGC
RLMD_BURCM      GKVIFVEGALPGERVTYSSYRRKPSYEQATVVDILR-PSVLRTQPKCAFFGT----CGGC
RLMD_BURMA      GKVIFVEGALPGERVTYSSFRRKPTYEQAQVVDILR-PSVMRTQPKCAFFGT----CGGC
RLMD_BURPS      GKVIFVEGALPGERVTYSSFRRKPTYEQAQVVDILR-PSVMRTQPKCAFFGT----CGGC
RLMD_BURP1      GKVIFVEGALPGERVTYSSFRRKPTYEQAQVVDILR-PSVMRTQPKCAFFGT----CGGC
RLMD_BURTA      GKVIFVEGALPGERVTYSSFRRKPTYEQAQVVDILR-PSVMRTRPKCAFFGT----CGGC
RLMD_PARXL      GKVIFVEGVLPGERVSYSTHRSKPKFEQAEVVQVLR-ESVMRTKPKCTYFDI----CGGC
RLMD_CUPNH      GKVIFVEGALPGETVSYRSFRRKPSYEQAHLVEVRQ-ESVMRVKPGCQHFGV----CGGC
RLMD_CUPMC      GKVIFVEGALPGETVAYRSYRRKPSYEQAHLVEVKQ-ASVMRVKPGCQHFGV----CGGC
RLMD_CUPPJ      GKVIFVEGALPGETVSYKSFRRKPSYEQAHLLEVRR-ESVMRVKPGCKHFGV----CGGC
RLMD_RALPJ      GKVVFVEGALPGERVMYRSHRVKPSYEQAGVVNILR-QSASRVTPQCKFFGV----CGGC
RLMD_RALSO      GKVVFVEGALPGERVTYRSHRAKPSYEQATLVDILR-QSASRVTPQCRFFGT----CGGC
RLMD_POLNS      GKVIFIKGALPTELVTYTVTSDKSRFSKAKVREILK-PAVFRAEPKCAAFGI----CGGC
RLMD_AZOSB      GKAVFIEGGLPGETVEYRVLRSKPNYEQAEATRIVR-RSALRVAPRCPHFGV----CGGC
RLMD_AROAE      GKVVFVEGALAGEQVEYTVYRQRPSYDLAEATRIIK-ASAQRVRPRCEHFGV----CGGC
RLMD_CHRVO      GKTLFIDGALPYEKVIYSSYRKKPSYENAQTSAVLK-ESFMRADPRCPHFGV----CGGC
RLMD_METFK      GKTIFIDGALPGEQVTYKVRRRKERYEVADVLDVLQ-ASHLRTQPGCEHFGV----CGGC
RLMD_NITMU      GKVIFIEGALPGEVVTYNAYRRKPSFELAQVGQILK-PAFSRVTPECHHFGI----CGGC
RLMD_DECAR      GKAIFVDGALPGETVEYASFRRKSKFELAHLVHVIK-PSTARVEPCCPHFGV----CGGC
RLMD_THIDA      GKVTFVDGALAGERAEIAIFRKHAKYNSANAVAILA-PSAQRAEPRCRYFGR----CGGC
RLMD_NEIL0      GKTVFIKGALPSERVGFRIVRQKKQFDEAEAVAIFK-VSDERTVPQCRYFER----CGGC
RLMD_ACIB3      GKKVFIRYALPGETVKAQITHEAKRLEEAEMVELLAEPSANRVEAVCPHYGI----CGGC
RLMD_ACIBY      GKKVFIRYALPGETVKAQITHEAKRLEEAEMVELLAEPSANRVEAVCPHYGI----CGGC
RLMD_ACIB5      GKKVFIRYALPGETVKAQITHEAKRLEEAEMVELLAEPSANRVEAVCPHYGI----CGGC
RLMD_ACIBC      GKKVFIRYALPGETVKAQITHEAKRLEEAEMVALLAEPSANRVEAVCPHYGI----CGGC
RLMD_ACIBS      GKKVFIRYALPGETVKAQITHEAKRLEEAEMVALLAEPSANRVEAVCPHYGI----CGGC
RLMD_ACIAD      GKKVFVRYALPGEVVRAKITHETKRFEEGELIEILDQPSIDRIVPVCPHFGV----CGGC
RLMD_PSYA2      GKKIFVSFALPGESALVKITNSRTSFEEGDAVNITANPNPERVVPPCPHFGV----CGGC
RLMD_PSYCK      GKKIFVSFALPGESALVKITNSRTSFEEGDAVRITANPNPERVVPPCPHFGV----CGGC
RLMD_ALCBS      -KTTFIDNALPGEEVMFKFTYMRRKFDEGKAVEIVT-ASPDRVTPPCEHSTL----CGGC
RLMD_MARHV      -KTQFVDGALPGETVMAKMVRTRSRFDELRTTEVLE-AAPDRQQPPCEFADL----CGGC
RLMD_HAHCH      -KTLFVEGALPGETVTARYVNSRRSYDELAVEEVLT-QHPQRIEPDCQFSKL----CGGC
RLMD_ALKEH      -RTLFVHGALPGERVRAVYTKRRRSVAEARVVEVVS-PAPERIAPHCPHFGV----CGGC
RLMD_METCA      -RVVFVDGALPGEDVTFVYTEIKRDYAAGRVVEIVT-ASPDRVPARCRHFAL----CGGC
RLMD_NITOC      -KTVFIDGALPGETVWFHYLRRRGKFDEGRVLEVLQ-PAPSRVEPRCRHFGV----CGGC
RLMD_STRMK      GKVTFVSGALPGEVVMAEQTARSRHFDEARTVEVLQ-ASPQRVTPKCPHFGT----CAGC
RLMD_STRM5      GKVTFVSGALPGEVVMAEQTARSRHFDEARTVEVLK-ASPQRVTPKCPHFGT----CAGC
RLMD_XANAC      GKVTFISGALPGELVRAEPTARSRHFDEAKTVGVLE-ASPQRVTPRCPHFGV----CAGC
RLMD_XANC5      GKVTFISGALPGELVRAEPTARSRHFDEAKTVEVLE-ASPQRVTPRCPHFGV----CAGC
RLMD_XANOR      GKVTFISGALPGELVRAEPTARSRHFDEAKTVEVLE-ASPQRVAPRCPHFGV----CAGC
RLMD_XANOM      GKVTFISGALPGELVRAEPTARSRHFDEAKTVEVLE-ASPQRVAPRCPHFGV----CAGC
RLMD_XANCP      GKVTFISGALPGEVVVAEPTARSRHFDEAKTVEVLQ-ASPQRVAPRCPHFGV----CAGC
RLMD_XANC8      GKVTFISGALPGEVVVAEPTARSRHFDEAKTVEVLQ-ASPQRVAPRCPHFGV----CAGC
RLMD_XYLFA      DKVTFVTGALPGEVVIVEPVARNRHFDEARVVEVLQ-ASPQRVIPRCSHFGV----CSGC
RLMD_XYLFT      GKVTFVTGALPGEVVIVEPVARNRHFDEARVVEVLQ-ASPQRVIPRCSHFGV----CSGC
RLMD_FRATH      -KTTFIPFTLPGEVVKFEYTFTKAKFDEAKVVEYVK-KSLNRVNPPCDHFQI----CGGC
RLMD_FRATO      -KTTFIPFTLPGEVVKFEYTFTKAKFDEAKVVEYVK-KSLNRVNPPCDHFQI----CGGC
RLMD_FRATT      -KTTFIPFTLPGEVVKFEYTFTKAKFDEAKVVEYVK-KSSNRVNPPCDHFQI----CRGC
RLMD_FRAT1      -KTTFIPFTLPGEVVKFEYTFTKAKFDEAKVVEYVK-KSSNRVNPPCDHFQI----CRGC
RLMD_FRATN      -KTTFIPFTLPGEVVKFEYTFTKAKFDEAKVVEYVK-KSSNRVNPPCEHFQI----CGGC
RLMD_LEGPC      -KATFIQGALPGEVVEFQYTRIKKDFDEGKLLSIVE-PSTLRVEPKCPHYQM----CGGC
RLMD_LEGPA      -KATFIQGALPGEVVEFQYTRVKKDFDEGKLLSIVE-PSTLRVEPKCPHYQM----CGGC
RLMD_LEGPH      -KATFIQGALPGEMVEFQYTRVKKDFDEGKLLSIIE-PSTLRVEPKCPHYQM----CGGC
RLMD_LEGPL      -KATFIQGALPGEVVEFQYTRVKKDFDEGKLLSIVE-PSTLRVEPKCPHYQM----CGGC
RLMD_VESOH      -KIIFVSDALPGELVIANRTFSCAKFEEADAKEILK-PADNRMKPKCDVFGI----CGGC
                    *:   :  :                            *    *         * **

RLMD_CHRSD      DLQHLDLEAQREHKRRTLDELFTRQGLTLP-----------------EIEVLAGEGLAYR
RLMD_HALED      DLQHLSLEAQRDHKREVLRELLARQGIELPG----------------ASSLLADAGEGYR
RLMD_CELJU      QLQHLKPEAQLLMKQQVVLEQVHRWGGLTPK---------------RVLPPLRSESLGYR
RLMD_MARPP      SFQHLEESAQRLAKADWLAGQLRNLLSKEQI---------------EC---LFDVGSGYR
RLMD_MARMS      SFQHLANEQQLSAKADWLQGQLRNLITTQEL---------------ET---LSDTPTGYR
RLMD_MARM1      QFQHLIYPDQVEAKTEWLSGQFRKLA-IGDI---------------EL---LSDHSEAYR
RLMD_HYDCU      QLQHLSIDAQRKWKASHFYTALSKAVNMKAC---------------QIEAPLVGHDHAYR
RLMD_AERHH      SAQHLAEADQRAAKEAGLVSLFERLGNI---------------QPPALEPVLGGESRAYR
RLMD_AERS4      NAQHLGEADQQAAKEAGLVSLFERLGQI---------------KAPVLEPVLTGESRAYR
RLMD_TOLAT      NAQMMPQAMQCQAKQQGVQRLFRQLAKI---------------DLPAPLWIESSAPQAYR
RLMD_PSEHT      QLQHLDSSQQVVEKQIAVSKLFEKFAKL---------------DELNWQAPLLSKATHYR
RLMD_SHEB9      DLQHMSLSGQREHKEAALLDIMAKFAGA---------------EGGALSPALTGEGWHYR
RLMD_SHEB2      DLQHMSLSGQREHKEAALLDIMAKFAGA---------------EGGTLSPALTGEGWHYR
RLMD_SHEB8      DLQHMSLSGQREHKEAALLDIMAKFAGA---------------EGGTLSPALTGEGWHYR
RLMD_SHEB5      DLQHMSLSGQREHKEAALLDIMAKFAGA---------------EGGTLSPELTGEGWHYR
RLMD_SHEPC      DLQHMSLSGQREHKEAALLDIMAKFAGT---------------EGGALSPALTGEGWHYR
RLMD_SHESW      DLQHMSLSGQREHKEAALLDIMAKFAGT---------------EGGALSPALTGEGWHYR
RLMD_SHESM      DLQHMSLAGQREHKSAALVDIMAKFAGA---------------EGNS-VPALTGEGWHYR
RLMD_SHESR      DLQHMSLAGQREHKSAALVDIMAKFAGA---------------EGNS-VPALTGEGWHYR
RLMD_SHESA      DLQHMSLAGQREHKSAALVDIMAKFAGA---------------EGNS-VPALTGEGWHYR
RLMD_SHEON      DLQHMSLTAQREHKSAALVDIMAKFAGA---------------EGSL-APALSGEGWHYR
RLMD_SHESH      DLQHLSIDKQRSYKQSALVDLMAKLSHT---------------EAESLAPALIGQEWDYR
RLMD_SHEWM      DLQHLSLEKQRLHKESALVSLMAKLSHT---------------EAEALVPAIIGEQWHYR
RLMD_SHEHH      DLQHLDIDAQRKHKASTLVDLVNKFAQT---------------QAGEVCDTLSDNAWHYR
RLMD_SHEPA      DLQHLDIEAQRKHKANTLVDLVNKFAQT---------------QASEVCAPLSGDAWHYR
RLMD_SHEPW      DLQHLNVESQRAHKAKALQELVAKFAQT---------------TASQVCETLSDSPWHYR
RLMD_SHEDO      DLQHLALDAQQNHKQQSLNELMVKFSGSPVI------------DPQVQAAPLVSPPWHYR
RLMD_SHEFN      DLQHMDTNAQREHKQTALVDLISKLSSAKAI------------DADIVADPIVGEAWHYR
RLMD_SHEAM      DLQHLSLPRQLEYKRQALGDIVSRSAAQ---------------TVTVNTDEVSGDSWHYR
RLMD_FERBD      QLQFAPTGLQRDLKQQALAQVVSKLSGL---------------TPEQWAEPLLGPDWHYR
RLMD_ALIF1      NLQHLQHEEQIVAKNEKLQELMKKQGVSQ----------------GEMVQPIMGEELSYR
RLMD_ALIFM      NLQHLQHEEQIVAKNEKLQELMKKQGVSQ----------------GEMVQPIMGEELSYR
RLMD_ALISL      NLQHLQHAEQIIAKNDKLQELMKKQGVDA----------------CDVAEPILANEHDYR
RLMD_PHOPR      NLQHLSHQGQVLAKQQALSDLMVKFAGDQQVAVDKQRAGDQQRALFEQVTPIIAAEHHYR
RLMD_VIBCH      DLQHLDRAGQIHHKQQALSQLMVKFAGQS----------------LALSAPVCSDDQGYR
RLMD_VIBCM      DLQHLDRAGQIHHKQQALSQLMVKFAGQS----------------LALSAPVCSDDQGYR
RLMD_VIBC3      DLQHLDRAGQIHHKQQALSQLMVKFAGQS----------------LALSAPVCSDDQGYR
RLMD_VIBCB      DLQHLNYDQQLTHKQQTLRQLMRKFAGSD----------------IELGAPVLGESLGYR
RLMD_VIBPA      DLQHLNYDQQLTHKQQTLRQLMRKFAGSD----------------IDLDAPVLGESLGYR
RLMD_VIBVU      DMQHMDYQAQLAYKQRTLLQLMKKFSGSE----------------ILLSPPVTGLEKAYR
RLMD_VIBVY      DMQHMDYQAQLAYKQRTLLQLMKKFSGSE----------------ILLSPPVTGLEKAYR
RLMD_VIBTL      HLQHLGYSSQVEHKSQSLTHLMSKYQTAN----------------TEVALPIVGDESGYR
RLMD_SHIFL      QQQHASVDLQQRSKSAALARLMKH----------------------DVSEVIADVPWGYR
RLMD_SHIF8      QQQHASVDLQQRSKSAALARLMKH----------------------DVSEVIADVPWGYR
RLMD_ECOLI      QQQHASVDLQQRSKSAALARLMKH----------------------DVSEVIADVPWGYR
RLMD_ECOUT      QQQHASVDLQQRSKSAALARLMKH----------------------EVSEVIADVPWGYR
RLMD_ECOK1      QQQHASVDLQQRSKSAALARLMKH----------------------EVSEVIADVPWGYR
RLMD_ECOL6      QQQHASVDLQQRSKSAALARLMKH----------------------EVSEVIADVPWGYR
RLMD_ECOL5      QQQHASVDLQQRSKSAALARLMKH----------------------EVSEVIADVPWGYR
RLMD_ECO57      QQQHASVDLQQRSKSAALARLMKH----------------------EVSEVIADVPWGYR
RLMD_SHIBS      QQQHASVDLQQRSKSAALARLMKH----------------------EVSEVIADVPWGYR
RLMD_SHIDS      QQQHASVDLQQRSKSAALARLMKH----------------------EVSEVIADVPWGYR
RLMD_SHISS      QQQHASVDLQQRSKSAALARLMKH----------------------EVSEVIADVPWGYR
RLMD_CITK8      QQQHASVALQQRSKSAALSRLMKC----------------------DVAEVIADTPWGYR
RLMD_SALCH      QQQHVSIALQQRSKSAALARLMKH----------------------EVKDIIAGAPWGYR
RLMD_SALTY      QQQHVSIALQQRSKSAALARLMKH----------------------EVNDIIAGAPWGYR
RLMD_SALPA      QQQHVGIDLQQRSKSAALARLMKH----------------------EVNDIIAGAPWGYR
RLMD_SALTI      QQQHVGIDLQQRSKSAALARLMKH----------------------EVNDIIAGASWGYR
RLMD_KLEP3      QQQHASVALQQQSKRAALARLMKR----------------------EVDEVIAGVPWGYR
RLMD_KLEP7      QQQHASVPLQQQSKRAALGRLMKR----------------------EVDDVIAGAPWGYR
RLMD_ENT38      QQQHASVALQQSSKSTALARLMKH----------------------EVNEIISGEPWGYR
RLMD_CROS8      QQQHASVALQQRSKAQALCRMMKR----------------------EVDEVISGPAWGYR
RLMD_ERWT9      QQQHASPTLQQESKAKALSRLLSKPRGET----------------VEVDDIIASRPWGYR
RLMD_PECAS      QQQHAEITLQQSSKTAALMRMMTRETGIE----------------LSAASLIAGTPYAYR
RLMD_PECCP      QQQHADITLQQSSKTAALMRLMTRETGAE----------------LPDASLIAGTPYAYR
RLMD_YERE8      QQQHANSQLQQMSKADSLQRLIMREAGAC----------------PQLDPVICGSEYGYR
RLMD_PHOLL      QQQHVAPDLQRESKASVLEHLIRRETGVT----------------VSAKPVILGPEYGYR
RLMD_EDWI9      QQQHAAIALQQQSKSQALQRLMARETGVD-----------------IAPQVIAGEPYGYR
RLMD_PROMH      QQQHVPIDWQRTTKAEVLSHLIKRETNVV----------------ISAQPVIAGAEYGYR
RLMD_HAEIN      QGQHIPIEMQRKAKESALFKRLSKLQSEP----------------ISFQPMICGDAWAYR
RLMD_HAEI8      QGQHIPIEMQRKAKQSALFKRLSKLQSEP----------------ISFQPMICGDAWAYR
RLMD_HAEP3      QGQHIPVEMQRKAKEKALFSRLSKLQAEP----------------IQLMPMICGEQWAYR
RLMD_HAES1      QSQHIPIHLQRETKQKALFQRLTKLQKEA----------------IEFMPMISGEAWHYR
RLMD_MANSM      QNQHIPVEMQREAKQKALFRRLLKLQPEG----------------IEFMPMIVGEAFGYR
RLMD_PASMU      QSQHIPIDMQRQAKQQALFQRLQQLQPQ-----------------ATFMPMIVAAPWHYR
RLMD_HAEDU      QMQHIKLDVQRQTKQQAFFKQLQRLQTEP----------------IDWQPMISGQDKHYR
RLMD_COLP3      DLQMLALEEQLLFKQQKITDLFSRSFSTQNITPE------INTAHLPWQAAIKSSPWHYR
RLMD_PSYIN      DLQHLNQAAQIQIKSDGLLSLFQRF---------------AKKVPQQLEKPIIDKAWEYR
RLMD_IDILO      DFQHIDEQKQLAHKRQVVEELFQKFGVFNPQ-----------TSSLPWQEPLVSEPMRYR
RLMD_ALTMD      QLQHIDADAALAYRDNALKIMMERQLSIG---------------SGVWQAPLVGPRPQYR
RLMD_ALTNA      QLQHVEPQEALALRDDALKSMFQRKLGFN---------------EGAWQAPVSGNRPRYR
RLMD_DICNV      ALQHWHSQEQLLGKQKLWLTQLQRLGGAQ---------------PEHVLLPLAGKEWRYR
RLMD_PSEAE      TLQHLEHGEQLALKQRTLQEQLQRFAGIE---------------PEEWAAPLVGPEFGYR
RLMD_PSEAB      TLQHLEHGEQLALKQRTLQEQLQRFAGIE---------------PEEWAAPLVGPEFGYR
RLMD_PSEE4      NLQHLPHDGQLALKQRLLAEQLQRVAGVQ---------------PEEWAAPLCGPEFGYR
RLMD_PSEPK      NLQHLPHEAQLALKQRTLAEQLQRVAGVQ---------------PEAWAAPLSGPEFGYR
RLMD_PSEF5      SVQHLPHDEQLALKQRMLAEQLSKVAGVE---------------PEAWAAPLSGPEFGYR
RLMD_PSEPF      SVQHLPHNEQLALKQRMLAEQLSRVAGAE---------------PEEWAAPLTGPEFGYR
RLMD_PSE14      SVQHVPHEEQLALKQRMLAEQLLRVANVV---------------PDEWAAPLSGAELAYR
RLMD_PSEU2      SVQHVPHEEQLALKQRMLAEQLLRVANVV---------------PDEWAAPLSGAELAYR
RLMD_PSESM      SVQHVPHEEQLALKQRMLAEQLLRVANVV---------------PDEWAAPLSGAELAYR
RLMD_ACIF2      SLQHLEPAAQVAIKQRQLEDHLWRIGKVR--------------PERVLPPIHGP-SLGYR
RLMD_ACIF5      SLQHLEPAAQVAIKQRQLEDHLWRIGKVR--------------PERVLPPIHGP-SLGYR
RLMD_ACIAC      KMQHLHVGAQVAVKQRVLEDNLWHLGKVK--------------AETVLRPIEGP-AWGYR
RLMD_ACISJ      KMQHLHVAAQVAVKQRVLEDNLWHLGKVK--------------AETILRPIEGP-AWGYR
RLMD_VEREI      KMQHLHMGGQVAVKQRVLEDNLWHLGRVK--------------PAMVLRPIEGP-AWGYR
RLMD_RHOFT      KMQHLHVGAQVAVKQRVLEDNLWHLGKVK--------------ADTILRPIEGP-AWGYR
RLMD_POLNA      KMQHLHIGAQVAVKQRVLEDNLRFIGKVK--------------ADNLLRPIEGP-AWHYR
RLMD_POLSJ      KMQHLHVGAQVAVKQRVLEDNLWHIGKVK--------------ADNLLRPIEGP-AWGYR
RLMD_RUBGI      KMQHLHPAAQVAVKQRVLEDNLWHLGKVK--------------PERLLRPIHGP-AWGYR
RLMD_BORBR      AMQHLAPAAQVAIKQRALEDTFWHVGKLK--------------PARILPPLYGP-TWGYR
RLMD_BORPA      AMQHLAPAAQVAIKQRALEDTFWHVGKLK--------------PARILPPLYGP-TWGYR
RLMD_BORPE      AMQHLAPAAQVAIKQRALEDTFWHVGKLK--------------PARILPPLYGP-TWGYR
RLMD_BORA1      AMQHLEPTSQVAIKQRALEDTFWHVGKIR--------------PQRVLPPLHGP-TWGYR
RLMD_BURCA      SMQHLDMRAQVAVKQRVLEDNLWHLAKLR--------------AETMFAPIHGP-SWGYR
RLMD_BURCH      SMQHLDMRAQVAVKQRVLEDNLWHLAKLR--------------AETMFAPIHGP-SWGYR
RLMD_BURL3      SMQHLDMRAQVAVKQRVLEDNLWHLAKLR--------------AETMFAPIHGP-SWGYR
RLMD_BURCM      SMQHLDMRAQVAIKQRVLEDNLWHLAKLR--------------AETVFAPIHGP-SWGYR
RLMD_BURMA      SMQHLDMRAQVAIKQRVLEDNLWHLAKLR--------------AEAMFAPIHGP-SWGYR
RLMD_BURPS      SMQHLDMRAQVAIKQRVLEDNLWHLAKLR--------------AEAMFAPIHGP-SWGYR
RLMD_BURP1      SMQHLDMRAQVAIKQRVLEDNLWHLAKLR--------------AEAMFAPIHGP-SWGYR
RLMD_BURTA      SMQHLDMRAQVAIKQRVLEDNLWHLAKLR--------------AEAMFAPIHGP-SWGYR
RLMD_PARXL      SMQHLDIRAQVAVKQRVLEDNLQHLAKLR--------------PETVFRPIHGP-SWGYR
RLMD_CUPNH      SMQHLDSRAQLAIKQRVLEDNLWHLSKVK--------------PDVVFRPIAGP-DWGYR
RLMD_CUPMC      SMQHLDSRAQLAIKQRVLEDNLWHLSKVK--------------PDVVFRPIAGP-DWGYR
RLMD_CUPPJ      SMQHLDSRAQLAIKQRVLEDNLWHLSKVR--------------PEVMFRPIAGP-DWGYR
RLMD_RALPJ      SMQHLDSRAQVAIKQRVLEDDLWHLAKLR--------------PDVVFRPIAGP-DWGYR
RLMD_RALSO      SMQHLDSRAQIAIKQRVLEDDLWHLAKLR--------------PDVVFRPIAGP-DWGYR
RLMD_POLNS      TMQHLDIRAQVAMKQRVLEDDLQHIAKVK--------------SEEILCPMGGP-TWEYR
RLMD_AZOSB      SMQHLDTLAQAATKQRVLEDALWRIGKVK--------------PGIIYSAIQGP-AWGYR
RLMD_AROAE      SMQHLDSVAQAAAKQRVLEDALWHVGKVR--------------PDIIYAAIHGP-SWGYR
RLMD_CHRVO      SMQHVEFTAQVAIKQRVLEDNLKRIGKVK--------------AERVLTPIAGP-AWHYR
RLMD_METFK      AIQHLEFSGQVAAKQRMLESNLWHIGKTR--------------SERMLPPIYGP-AWGYR
RLMD_NITMU      SMQHMDVRTQVAAKQRVLEDNLKHIGKVA--------------PELVLPAVYGS-PWGYR
RLMD_DECAR      AMQHMEPSAQVAAKQRVLEDSLWHIGRIR--------------PETMLPPIQGE-PWGYR
RLMD_THIDA      SMQHLEPSAQVAAKQRVLEENLARIGKVR--------------PSVLLPALHGP-SWGYR
RLMD_NEIL0      SLQHISPAAQVAFKQRMMEEQLERIGKVK--------------PKQILLPIYGH-VWHYR
RLMD_ACIB3      SMQHIHPDEQIHLKQNVLQSHLQHFAGIQ--------------PEQWLEPIRSL-QSDYR
RLMD_ACIBY      SMQHIHPDEQIHLKQNVLQSHLQHFAGIQ--------------PEQWLEPIRSL-QSDYR
RLMD_ACIB5      SMQHIHPDEQIHLKQNVLQSHLQHFAGIQ--------------PEQWLEPIRSL-QSDYR
RLMD_ACIBC      SMQHIHPDEQICLKQNVLQSHLQHFAGIQ--------------PEQWLEPIRSL-QSDYR
RLMD_ACIBS      SMQHIHPDEQIRLKQNVLQSHLQHFAGIQ--------------PEQWLEPIRSL-QSDYR
RLMD_ACIAD      SMQHITPNQQIQIKQHVLASHLQHFAGLT--------------VNEWLTPVRSL-RADYR
RLMD_PSYA2      NLQHWQPEAQINFKQSVLAEMLVHQANVA--------------PDHWLEPVVGD-RLGYR
RLMD_PSYCK      NLQHWQPDAQITFKQSVLAEMLVHQANVA--------------PDHWLEPVVGD-RLGYR
RLMD_ALCBS      SLQHMSPEVQVSRKQAVLREQLAHFGGLE--------------PEEWLAPLTGP-VTGYR
RLMD_MARHV      SLQHMSADAQIRFKENTLREHFAHFGGIE--------------PEQWVAPMRSPDSLGYR
RLMD_HAHCH      SMQHVDLGFQINHKESVLLDHLRHFGDLK--------------PEQVVPPLVGA-GRGYR
RLMD_ALKEH      SLQHLTPERQVELKQSVLMEQFHHMGGVQ--------------PERVLAPLTGA-PWGYR
RLMD_METCA      SLQYLSEDAQIALKEDLLLDQFRRIGKVE--------------PAAQFPPLRGP-HWGYR
RLMD_NITOC      SLQHLSTAAQLQLKQVTVREQFRHFGGVE--------------PEQWLPPLVGGGYWGYR
RLMD_STRMK      VLQHLDEDQQIVAKQRVLMDNLERIGHVK--------------PGKVLAPLVGE-SWGYR
RLMD_STRM5      VLQHLDEDQQIVAKQRVLMDNLERIGHVK--------------PGTVLAPLVGE-SWGYR
RLMD_XANAC      VLQHLEESQQIVAKQRVLMDNLERIGHVT--------------PQAVLPALTGD-NWGYR
RLMD_XANC5      VLQHLEESQQIVAKQRVLMDNLERIGHVT--------------PQAVLPALTGD-NWGYR
RLMD_XANOR      VLQHLEESQQIVAKQRVLMDNLERIGHVT--------------PQAVLPALSGD-NWGYR
RLMD_XANOM      VLQHLEESQQIVAKQRVLMDNLERIGHVT--------------PQAVLPGLTGD-NWGYR
RLMD_XANCP      VLQHLEESQQIVAKQRVLMDNLERIGHVT--------------PQTVLPALVGD-TWGYR
RLMD_XANC8      VLQHLEESQQIVAKQRVLMDNLERIGHVT--------------PQTVLPALVGD-TWGYR
RLMD_XYLFA      VLQHLAEDAQVVSKQRVLLESLERIGRVS--------------PERVLPALAAE-SWGYR
RLMD_XYLFT      VLQHLAEDAQVVSKQRVLLESLERIGCVS--------------PERVLPALAAE-SWGYR
RLMD_FRATH      SLQHMSTDAQIEHKQQTLINQLKYIGNGVE-------------PENILPPLRTSNTEGYR
RLMD_FRATO      SLQHMSTDAQIEHKQQTLINQLKYIGNGVE-------------PENILPPLRTSNTEGYR
RLMD_FRATT      SLQHMSTDAQIEHKQQTLINQLKYIGNGVE-------------PENILPPLRTSNTEGYR
RLMD_FRAT1      SLQHMSTDAQIEHKQQTLINQLKYIGNGVE-------------PENILPPLRTSNTEGYR
RLMD_FRATN      SLQHMSTDAQIEHKQQTLINQLKYIGNGVE-------------PENILPPLRTSNTEGYR
RLMD_LEGPC      SLQHMSAEEQIRFKQSHLLDLLSRYGHTE--------------PQSVLSPL-TSHHWNYR
RLMD_LEGPA      SLQHMSAEEQIRFKQSHLLDLLSRYGHTE--------------PQSVLSPL-TSHHWNYR
RLMD_LEGPH      SLQHMSAEEQIRFKQSHLLDLLSRYGHTE--------------PQSMLSPL-TSHHWNYR
RLMD_LEGPL      SLQHMSAEEQIRFKQSHLLDLLSRYGHTA--------------PQTVLSPL-TSHPWNYR
RLMD_VESOH      SFQNLSSEDQIQIKSRWLKKVFARQAKVE--------------PETWLKSL-QFQSWGYR
                  *          :       .                                    **

RLMD_CHRSD      RRARLGVKCD--AEGTPHLGFRARGS-EHLIDIDSCVVLEPVLSRLIAPLRACLVQLEAP
RLMD_HALED      RRARIGVRVD--SNGQVRLGFRARHS-HRLVDLDDCPVLLPALSSLLRPLREQVESLEAP
RLMD_CELJU      SRARLGVWYE--ADSSVTLGFRQQQR-KTLTNIESCSVLLPALNRLIGPLRQWLQARVAN
RLMD_MARPP      RRARIAIDHK---KNALVLGFRSKAS-NRVVDVEQCHVLTPSLQTLFVSLKVCLKQHPIL
RLMD_MARMS      RRARLAIDIK---KGRMVLGFRGKAS-KEIISIDQCVVLTPNLQSTFLLLKLKLLENDLA
RLMD_MARM1      RRARLSVFTK---GGEHQIGFRARSS-KDIVNIANCLVLTESLQSVFVALKERLHESSLT
RLMD_HYDCU      RRARLVLGKNK-TDKEARFGFRAKGS-NEIVDIEQCPLLTPALNEALNQKR---------
RLMD_AERHH      RVCRLAIKFDK-NGRCTRVGFRRRQS-NDLVEIGGCPVLAEPLSVLITPLRECLNRLKSQ
RLMD_AERS4      RVCRLAIKFDK-NGRCTRVGFRRRQS-NDLVEIEGCPVLAEPLSALIAPLRECLNRLKSQ
RLMD_TOLAT      RVCRLAVKYDK-NKRCVLVGFRQKQS-QALVEINSCPVLTAALSALIVPLRTLINELSSA
RLMD_PSEHT      RSARLAVMFDK-KAKKMHVGYRASGS-KSIISINECPVLSEVFANVFTVFDNLINQHKAL
RLMD_SHEB9      RRARLATLFDK-NTKHLSLGFRAASS-SNVVPISQCQVLAKPLSDLIVPFAKLLNQLSAK
RLMD_SHEB2      RRARLATLFDK-NTKHLSLGFRAASS-SNVVPISQCQVLAKPLSDLIVPFAKLLNQLSAK
RLMD_SHEB8      RRARLATLFDK-NTKHLSLGFRAASS-SNVVPISQCQVLAKPLSDLIVPFAKLLNQLSAK
RLMD_SHEB5      RRARLATLFDK-NTKHLSLGFRAASS-SNVVPISQCQVLAKPLSDLIVPFAKLLNQLTAK
RLMD_SHEPC      RRARLATLFDK-NTKHLSLGFRAASS-SNVVPISQCQVLAKPLSDLIVPFAKLLNQLSAK
RLMD_SHESW      RRARLATLFDK-NTKHLSLGFRAASS-SNVVPISQCQVLAKPLSDLIVPFAKLLNQLSAK
RLMD_SHESM      RRARLATLFDK-NTKQLSLGFRASSS-NQVVPIDSCLVLAKPLSDLIAPFAKLLNQLAAK
RLMD_SHESR      RRARLATLFDK-NTKQLSLGFRASSS-NQVVPIDSCLVLAKPLSDLIAPFAKLLNQLAAK
RLMD_SHESA      RRARLATLFDK-NTKQLSLGFRASSS-NQVVPIDSCLVLAKPLADLIAPFAKLLNQLAAK
RLMD_SHEON      RRARLATLFDK-NTKQLSLGFRASSS-SHVVSITECLVLAKPLSDLIAPFAKLLNQLAAK
RLMD_SHESH      RRARLATHYNK-ESKQITLGFRASAS-KQVINIDVCPVLAKPLSDLIAPLSLLLNQLSGK
RLMD_SHEWM      RRARLATFYHQ-ETKRTTLGFRAQSS-KEVIDISSCPVLAKSLSELISPLSKLLNQLASR
RLMD_SHEHH      RRARLATWFDK-NTKHISLGFRASSS-SDVVEIQSCAVLAEPLSALIPDLAFMLNQLSGK
RLMD_SHEPA      RRARLATWFDK-NTKHISLGFRASSS-SDVVEIQSCAVLAEPLSALIPDLAFMLNQLSGK
RLMD_SHEPW      RRARLATWFDK-KTKHISLGFRASSS-SDVVEIQSCVVLAKPLSALIPELAFLLNQLSGK
RLMD_SHEDO      RRARLATYFNN-NDKSLKLGFRALSS-KQIVPIKQCPVLAEPLSALINPFSLLLARLKAK
RLMD_SHEFN      RRARLATLFDK-NTQRLQLGFRAGNS-NKIVSIQQCPVLSESLSALITPLAANLNQLKAK
RLMD_SHEAM      RRARLATLLDK-ETNQLALGFREEGS-KSVVGIDSCAVLARPLSELISPFATLLNRLKGK
RLMD_FERBD      RRARLGCRYD---AGELVLGFRQEGS-NRLTAIDHCPVLAEPLSELITPLQQLLAPLKLA
RLMD_ALIF1      RRARISLMLNK-QTNQLDFGFRKKQS-KAIVNVRHCPVLVQELDQHLESLFTLLNQLKGK
RLMD_ALIFM      RRARISLMINK-QTNQLDFGFRKKQS-KAIVNVRHCPVLVQELDQHLESLFTLLNQLKGK
RLMD_ALISL      RRARISLIMNK-QTNQLDFGFRKKQS-KEIVNVRHCPVLVKELDQHLESLYTLLNQLKGK
RLMD_PHOPR      RCARFSVLLGK-D-GQLQFGLRKKQS-KDIVNVKQCPVLAESLNELLPPLRSLLSTLKGQ
RLMD_VIBCH      RRARLSLMWDK-KTQQLQLGFRRKQS-KAIVNVTHCPVLEPSLNALLPDLNALLSEWSQP
RLMD_VIBCM      RRARLSLMWDK-KTQQLQLGFRRKQS-KAIVNVTHCPVLEPSLNALLPDLNALLSEWSQP
RLMD_VIBC3      RRARLSLMWDK-KTQQLQLGFRRKQS-KAIVNVTDCPVLEPSLNALLPDLNALLSEWSQP
RLMD_VIBCB      RRARVSLFVDK-KTRQLHFGFRKKQS-KQIAQVTDCPVLAPELNVLLPEIYSTLKAFKKP
RLMD_VIBPA      RRARVSLFVDK-KTRQLHFGFRKKQS-KQIAQVTDCPVLAPELNVLLPEIYSVLKAFKKP
RLMD_VIBVU      RRARVSLMWDK-KSRQLQFGFRRKQS-KQIENVTQCPVLVAELECLLPELKAILSHFQHP
RLMD_VIBVY      RRARVSLMWDK-KSRQLQFGFRRKQS-KQIENVTQCPVLVAELECLLPELKAILSHFHHP
RLMD_VIBTL      RRARISLFVDK-KTQLLQFGFRKKQS-KQIENITDCAVLDPRLNVLLPKLKSLLNTFSSL
RLMD_SHIFL      RRARLSLNYLP-KTQQLQMGFRKAGS-SDIVDVKQCPILAPQLEALLPKVRACLGSLQAM
RLMD_SHIF8      RRARLSLNYLP-KTQQLQMGFRKAGS-SDIVDVKQCPILAPQLEALLPKVRACLGSLQAM
RLMD_ECOLI      RRARLSLNYLP-KTQQLQMGFRKAGS-SDIVDVKQCPILAPQLEALLPKVRACLGSLQAM
RLMD_ECOUT      RRARLSLNYLP-KTQQLQMGFRKAGS-SDIVDVKQCPILVPQLEALLPKVRACLGSLQAM
RLMD_ECOK1      RRARLSLNYLP-KTQQLQMGFRKAGS-SDIVDVKQCPILVPQLEALLPKVRACLGSLQAM
RLMD_ECOL6      RRARLSLNYLP-KTQQLQMGFRKAGS-SDIVDVKQCPILVPQLEALLPKVRACLGSLQAM
RLMD_ECOL5      RRARLSLNYLP-KTQQLQMGFRKAGS-SDIVDVKQCPILVPQLEALLPKVRACLGSLQAM
RLMD_ECO57      RRARLSLNYLP-KTQQLQMGFRKAGS-SDIVDVKQCPILVPQLEALLPKVRACLGSLQAM
RLMD_SHIBS      RRARLSLNYLP-KTQQLQMGFRKAGS-SDIVDVKQCPILVPQLEALLPKVRACLGSLQAM
RLMD_SHIDS      RRARLSLNYLP-KTQQLQMGFRKAGS-SDIVDVKQCPILVPQLEALLPKVRACLGSLQAM
RLMD_SHISS      RRARLSLNYLP-KTQQLQMGFRKAGS-SDIVDVKQCPILVPQLEALLPKVMACLGSLQVM
RLMD_CITK8      RRARLSLNYLP-KTQQLQMGFRKAGS-SDIVDVRQCPILVPQLEALLPRVRACLESLQGN
RLMD_SALCH      RRARLSLNCPP-D-KPLQMGFRKAGS-SDIVNVEQCPVLAPQLAALLPRIRACLASLHGT
RLMD_SALTY      RRARLSLNCPP-D-KPLQMGFRKAGS-SDIVNVEQCPVLAPQLAALLPRIRACLASLHGT
RLMD_SALPA      RRARLSLNCPP-D-KPLQMGFRKAGS-SDIVNVEQCPVLAPQLAALLPRIRACLASLHGT
RLMD_SALTI      RRARLSLNCPP-D-KPLQMGFRKAGS-SDIVNVEQCPVLAPQLEALLPRIRACLASLHGT
RLMD_KLEP3      RRARLSLNYQP-KTQQLQMGFRQANA-KAIVDVVQCPVLAPQLEALLPAVRECLSALSAL
RLMD_KLEP7      RRARLSLNYQP-KTQQLQMGFRQANA-KAIVDVVQCPVLVPQLEALLPAVRECLSALSAL
RLMD_ENT38      RRARLSLSYEP-KTQKLAMGFRKAAS-SDIVDVKQCPVLVPHLEALLPHLRNCLSDLQGA
RLMD_CROS8      RRARLSLNFTP-RKPGLQMGFRKAGS-NDLVDVHRCPVLVPRLEALLPKLRDCLSSLDGV
RLMD_ERWT9      RRARLGLSFQP-KSQTLHMGFREKSS-SELVNISQCPILKPELNALLQPLHAVLSSLQAV
RLMD_PECAS      RRARLALYFQA-KEQRLLMGYRQSNS-HDLVDIKACPVLRPELEALLQPLRDCLSQLSAV
RLMD_PECCP      RRARLALYFQA-KEQRLLMGYRQSNS-HDLVDIKACPVLRPELEALLQPLRDCLSRLKAV
RLMD_YERE8      RRARLGLLYQP-KQHRLQMGFRQTES-HDLVCIKHCPVLRPELERLLLPLYQCLSGLQAV
RLMD_PHOLL      RRARLGLHYQI-KQRQLVIGFRQNQS-NELVAIKECPVLRPELEQLLQPLSQCLNSLKAV
RLMD_EDWI9      RRARFGLQFNV-KTQRVVLGFRQAAS-NDLVALKACPVLAPALEALLLPLGECLSALRAR
RLMD_PROMH      RRARLGLRYHP-K-KGLVMGFRQALS-NDLVMVTQCPVLKPQLNVLLLPLWQCLKQLSVV
RLMD_HAEIN      RRVRLSLWFNP-STKQIEMGFRQKNT-NDLIPVQSCEVAEPAINYLLPKLTALLEKFSAP
RLMD_HAEI8      RRVRLSLWFNP-NTKQIDMGFRQKNT-NDLIPVQSCEVAEPAINYLLPKLTALLEKFSTP
RLMD_HAEP3      RRVRLSLLWNA-KSKTVEMGFRQKNS-NQLVSIQQCLVAEQAINDLIPKLTSLLAQYSAP
RLMD_HAES1      RRVRLSLYWDA-KSKNLKIGFRQKNS-QQIVNIRQCDVLDPLLNELLPKLHELLSTWSKP
RLMD_MANSM      RRVRLSMLFDG-KLKRLEIGFRQKNS-AQIVHIEQCEVIEPALNKILSKLTALLSRFSQP
RLMD_PASMU      RRVRLSVRFHP-KSKQLAMGLRQRNT-QQIVNLQHCDVLEIPLSQLLPKLHLLFSTWSLP
RLMD_HAEDU      RRTKLSMAIQR-N--QLVIGFRQQNT-HQIIPLTDCEVLEQPLSTLLPKLQHLFAGWKMK
RLMD_COLP3      RKARIGVQFDK--NAQATIGFRQKST-NQLAAIKSCPVLVEPLSAIFPLLKKLLAQLTVK
RLMD_PSYIN      RTARFGLQFDK-KNKQLKMGLRRAQS-NELIDQKVCPVLLPELECLIPPLKILLNSLQCK
RLMD_IDILO      RRVRLATRWLG-KEQKLLIGFREAQS-HHIVPIEDCLVADEILLHCVNTLYPLLNTSTVA
RLMD_ALTMD      RKARLAIDARN-P-DNIKLGFREANS-NKVVNLDTCPILVNPLSTAIGPLRNALEGYDSA
RLMD_ALTNA      RKARLAIDARN-P-DKIKLGFRENAG-KNIVDIEGCPVLVESLSQLIAPLKSAITGYASA
RLMD_DICNV      RRARLAVHYEN---DVIAVGFKAKRS-HDVVAVNDCLILQEHLAAALPLLPDFLRALLPV
RLMD_PSEAE      RRARIAVRWDA-RARRLDVGFRASAS-QEIVAFDECLVLVPPLQTIARALPALLQDFRKP
RLMD_PSEAB      RRARIAVRWDA-RARRLDVGFRASAS-QEIVAFDECLVLVPPLQTIARALPALLQDFRKP
RLMD_PSEE4      RRARVAVRWDV-KQRQLDVGFRAEAS-QDIVAIDDCPVLVQPLQAIMRHLPTVLRSLSKP
RLMD_PSEPK      RRARVAVRWDV-KARQLEVGFRAEAS-QDIIAIDDCAVLVQPLQSILRHLPTVLRSLSKP
RLMD_PSEF5      RRARVAVRWDA-KGKQLEVGFRAAGS-QDIVAIDDCPVLVQALQPVMNRLPAMLRRLSKP
RLMD_PSEPF      RRARIAVRWDS-KAKKLEVGFRAAGS-QDIVAISECPVLVQPLQPIMTRLPEMLRRLSKP
RLMD_PSE14      RRARVAVRWDA-KAKRLDVGFRAAAS-QDIVSIEHCPVLVQALQPIMNELPGMLKNFSKP
RLMD_PSEU2      RRARVAVRWDA-KAKRLDVGFRAAAS-QDIVSIEHCPVLVQALQPIMNELPGMLKSFSKP
RLMD_PSESM      RRARVAVRWDA-KAKRLDVGFRAAAS-QDIVSIEECPVLVQALQPIMSQLPAMLKSFSKP
RLMD_ACIF2      SKARLSVRTPK--TRGAMVGFRERNS-SYVVDMGQCLTLDPRVGQRILSLRTLIGQMQSP
RLMD_ACIF5      SKARLSVRTPK--TRGAMVGFRERNS-SYVVDMGQCLTLDPRVGQRILSLRTLIGQMQSP
RLMD_ACIAC      YRARLAVRHVE-KKGKVLVGFHERKS-RYIADMEVCPVLPPHVSAMLLPLRALIASMDAR
RLMD_ACISJ      YRARLSVRYVP-KKDKVLVGFHERKS-RYIADMETCKILPPHVDAMLMPLRALIGSMAAR
RLMD_VEREI      YRARLSVRHVI-KKGVVLVGFHERKS-RYVADMAQCPVLPPHAAALLMPLRSLIAALDAH
RLMD_RHOFT      YRARLSVRYVR-KKGELLIGFHERKS-GYVADMKECPVLPPHVSDLLLPLRALISAMEAM
RLMD_POLNA      YRARLSVRYVR-KKGTALVGFHERKS-AYVADMTECHVVPQHVSDMLVPLRGLISSMDAR
RLMD_POLSJ      YRARLSVRYVR-KKNAVLVGFHERKS-SYVADMTECHVVPRHVSDMLVPLRELIAGMDAR
RLMD_RUBGI      WRARLSVRYVP-KKGVVLVGFHERKS-RYVADMLECPVLPAKVSAMLPALRELIGAMEQR
RLMD_BORBR      YRARLSVRVVP-KKGGVLVGFHERKS-SYVADMRECHVLPPAVSRLLLPLRAMIAAMSAP
RLMD_BORPA      YRARLSVRVVP-KKGGVLVGFHERKS-SYVADMRECHVLPPAVSRLLLPLRAMIAAMSAP
RLMD_BORPE      YRARLSVRVVP-KKGGVLVGFHERKS-SYVADMRECHVLPPAVSRLLLPLRAMIAAMSAP
RLMD_BORA1      YRARLSVRVVP-KKGGVLVGFHERKS-SYVADMRECHVLPRHVSDLLLPLRAMIAALSRP
RLMD_BURCA      YRARLTVRNVA-KKGGVLVGFHEKKS-SYVADMTSCEVLPPHVSAMLVPLRRLVEGLSIR
RLMD_BURCH      YRARLTVRNVA-KKGGVLVGFHEKKS-SYVADMTSCEVLPPHVSAMLVPLRRLVEGLSIR
RLMD_BURL3      YRARLTVRNVA-KKGGVLVGFHEKKS-SYVADMTSCEVLPPHVSAMLVPLRRLVEGLSIR
RLMD_BURCM      YRARLTVRNVA-KKGGVLVGFHEKKS-SYVADMTSCEVLPPHVSAMLVPLRRLVEGLSIR
RLMD_BURMA      YRARLTVRHVA-KKGGVLVGFHEKKS-SYVADMTSCEVLPPHVSAMLVPLRRLVEQLSIR
RLMD_BURPS      YRARLTVRHVA-KKGGVLVGFHEKKS-SYVADMTSCEVLPPHVSAMLVPLRRLVEQLSIR
RLMD_BURP1      YRARLTVRHVA-KKGGVLVGFHEKKS-SYVADMTSCEVLPPHVSAMLVPLRRLVEQLSIR
RLMD_BURTA      YRARLTVRHVA-KKGGVLVGFHEKKS-SYVADMTSCEVLPPHVSAMLVPLRRLVEQLSIR
RLMD_PARXL      YRARLAVRFLP-EKGGMRIGFHEKKS-SYIADMKTCEVLPPHVSAMLMPLRFMVRKLSIY
RLMD_CUPNH      YRARLTVRHVA-KKGGVLVGFHERKS-SYVADMTRCEILPPHVSAMLVPLRELVGGLSIR
RLMD_CUPMC      YRARLTVRHVV-KKGGVLVGFHERKS-SYVADMTHCEILPPHVSAMLVPLRELVGGLSIH
RLMD_CUPPJ      YRARLTVRYVA-KKGGVLVGFHERKS-SYVADMTSCEILPPHISAMLVPLRELVTGLSIR
RLMD_RALPJ      YRARLTVRHVA-AKGGVLVGFHERKS-SYVADMTSCEVLPPHVSALLVPLRELVGRLSIV
RLMD_RALSO      YRARLTVRHVA-AKGGVLVGFHERKS-SYVADMTSCEVLPPHVSALLVPLRELVGRLSIV
RLMD_POLNS      HRARLSAVNRSIKKGTVLIGFHEGKS-GYVADMLACEILPKHVSDLLPEMRKLVMGLSIV
RLMD_AZOSB      YRARLGVRLVP-AKGGVLIGFHERRS-SYIADLGVCPVLPAHVSALLPALKVLVASLSIA
RLMD_AROAE      YRARIGVRVVP-KKGGVLIGFHERRS-SYIADMRSCPILPPHVSGMLPALHELVGGLSIA
RLMD_CHRVO      HRARLSARMVA-KKGGVLVGFHEKSS-SYIAEMRECHILPKHISDLIMPLREMIATLSIS
RLMD_METFK      HKARLRVRHVA-KKGGVLVGFNEKSS-SFVADMDSCRVLPPHVSNLIVPMKELVGQLSIR
RLMD_NITMU      YRARLSVRYVA-KKGGVLVGFHEKRS-SFIADMQACRIMPPRISALIMPLRKLVESLSIR
RLMD_DECAR      HRARLAVRRVS-KSGGMLIGFHEWRS-SYIADIRSCAILPPHVSALLMPMRELFAALSIA
RLMD_THIDA      GRARLSVRRVE-KKGGVLVGFHEKRS-SFIADMASCEVLAPGVSALIQPLRELIGRLSNA
RLMD_NEIL0      DRARFSVSLDK--LCRLKLGFQAKKT-NDVVDISSCMLLPKPVSDKLSAIRGLLQDLAEE
RLMD_ACIB3      RRARIGVRYLP-KQDRLILGFREHHS-NRLTSIHTCSVLDKKLSDNLPELRNLLQSLKGK
RLMD_ACIBY      RRARIGVRYLP-KQDRLILGFREHHS-NRLTSIHTCSVLDKKLSDNLPELRNLLQSLKGK
RLMD_ACIB5      RRARIGVRYLP-KQDRLILGFREHHS-NRLTSIHTCSVLDKKLSDNLPELRNLLQSLKGK
RLMD_ACIBC      RRARIGVRYLP-KQDRLILGFREHHS-NRLTSIHTCSVLDKKLSDSLPELRNLLQSLKGK
RLMD_ACIBS      RRARIGVRYLP-KQDRLILGFREHHS-NRLTSIHTCSVLDKKLSDSLPELRNLLQSLKGK
RLMD_ACIAD      RRARVGVRYIP-AKQKLIMGFREHGS-NRLTPIQSCAVLDQRLSQALPELYDVLNRLVAK
RLMD_PSYA2      TKARLGVRYVA-KKETALVGFRERSS-NFLAELNECHILDPRIGFEIENLKTLISTLESR
RLMD_PSYCK      TKARLGVRYVV-KKETALVGFRERSS-NFLAELNECHILDPRIGFEIENLKTLISTLDSR
RLMD_ALCBS      SKARMGVKYVE-AKGETLVGFREKRN-SFIAQLHTCEVLIPDVGHRIDELRTLMHGLESR
RLMD_MARHV      RKARLGVRYVK-ARESVLVGFREKRN-SFLTDIDRCVVLDPRIGERIEPLRELLHGMAAF
RLMD_HAHCH      TKARLGVRYVA-KRDEVLVGFRERYS-NFLTAIDECPILIESVGGRIPELKALVRSLSGY
RLMD_ALKEH      RKARLAVKHVP-RKGGVLVGFREKHS-PFVAEMDRCPVLDPRVGERLTELGRLIEGLSIP
RLMD_METCA      SRARLGARYVA-KKGRELVGFREHAS-AKIVDMTDCPVLHPALGERIQAFAELIEGLSLR
RLMD_NITOC      YKARLGVKFVK-KKDRVLVGFREKGS-SLIAALEGCEVLHPSVGYLLPALGELIASLSCY
RLMD_STRMK      RKGRFSVRRVE-KKDKTLVGFREQDP-RFVADLSQCLTVIPEIGTKVEALSTFIESLDGK
RLMD_STRM5      RKGRFSVRRVE-KKDKTLVGFREQDP-RFVADLSQCLTVIPEIGTKVEALSTFIESLDGK
RLMD_XANAC      RKGRFSVRRVE-KKDKTLVGFRELDP-RFVADLSVCYTVIPQIGEKIPLLAALIEGMDGK
RLMD_XANC5      RKGRFSVRRVE-KKDKTLVGFRELDP-RFVADLSICYTVIPQIGEKIPLFAALIEGMDGK
RLMD_XANOR      RKGRFSVRRVE-KKAKTLVGFRELDP-RFVADLSVCYTVIPQIGENIPLLAALVEGMDGK
RLMD_XANOM      RKGRFSVRRVE-KKAKTLVGFRELDP-RFVADLSVCYTVIPQIGEKIPLLAALVEGMDGK
RLMD_XANCP      RKGRFSVRRVE-KKDKTLVGFRELDP-RFVADLSVCYTVIPQIGEKIPQLAALVEGMDGK
RLMD_XANC8      RKGRFSVRRVE-KKDKTLVGFRELDP-RFVADLSVCYTVIPQIGEKIPQLAALVEGMDGK
RLMD_XYLFA      RKGRFSVRWVE-KKGRTLVGFREHDP-RFVADVSVCHTVVPQVGEKIALLATLLNSLDGR
RLMD_XYLFT      RKGRFSVRWVE-KKGRTLVGFREHDP-RFVADVSVCHTVVPQVGEKIALLATLLDSLDGR
RLMD_FRATH      NKARLGVRYVS-KKGKILVGFRERNG-RFLADIDKCIVLNPLVGDKITEISSFIETLSIY
RLMD_FRATO      NKARLGVRYVS-KKGKILVGFRERNG-RFLADIDKCIVLNPLVGDKITEISSFIETLSIY
RLMD_FRATT      NKARLGVRYVS-KKGKILVGFRERNG-RFLADIDKCIVLNPLVGDKITEISSFIETLSIY
RLMD_FRAT1      NKARLGVRYVS-KKGKILVGFRERNG-RFLADIDKCIVLNPLVGDKITEISSFIETLSIY
RLMD_FRATN      NKARLGVRYVS-KKGKILVGFRERNG-RFLADIDKCIVLNPLVGDKITEISSFIETLSIY
RLMD_LEGPC      NKARLSTRFVE-KKQSTMVGFRERNNPRFITEINQCPILNSKIDTDIVHLRKLIDTMEDK
RLMD_LEGPA      NKARLSTRFVE-KKQSTMVGFRERNNPRFITEINQCPILNSKIDTDIVHLRKLIDTMEDK
RLMD_LEGPH      NKARLSTRFVE-KKQSTMVGFRERNNPRFITEINQCPILNSKIDTDIVHLRKLIDTMEDK
RLMD_LEGPL      NKARLSTRFVE-KKQSTMVGFRERNNPRFITEINQCPILNSKIDTDIVHLRKLIDTMEDK
RLMD_VESOH      RKARLGIRYVA-KKDKVLIGFRERKS-SFITNMSRCEVLHPSIGEHLEVLANCIERLSIK
                   :.             .* .       :     *                        

RLMD_CHRSD      RRVGHIELIATAEGAC-------------VVVRQLREVPGDE---ARWRRFAAEHDV---
RLMD_HALED      RHVGHLELLASDGAVT-------------LVVRQLREHVADQ---RRWRAFAEAQGL---
RLMD_CELJU      KAVTHIELVAAQSGPA-------------VIVRHTKPLVALQ---RQALAELAQRES---
RLMD_MARPP      SSLGHIELLEDTKGLS-------------VVLRLVSNITPVQ---QQAYLDWAQQQD---
RLMD_MARMS      GVLGHVELLEDTKGVS-------------ALFRLTSPISDEL---KNAWEDWAEKGR---
RLMD_MARM1      SRIGHVELLEDESGSS-------------ITIRLSREISATD---ESDWMVWASEVG---
RLMD_HYDCU      -----------TAVLP-------------HASRALKEISVVD---ADNGIFWSDQA----
RLMD_AERHH      RELGHVELIQAE-------------QGILMLLRHTGRPTEAD---RAQLIEFAKTQG---
RLMD_AERS4      RELGHAELIQAE-------------QGIMMLLRHTGRPNEAD---RALLVAFAKSQG---
RLMD_TOLAT      RDVGHIELYETE-------------SGLAMLLRHNGRPPVKD---KELLLAFALQHD---
RLMD_PSEHT      HSVSHLQLCQGD-------------EQNFVIIRHTKPISEDI---KALVAQSAAEQQ---
RLMD_SHEB9      ASLGHLELIAAD-------------NGHFAVLRITKALNDKD---LAKLSAFAEQHQ---
RLMD_SHEB2      ASLGHLELIAAD-------------NGHFAVLRITKALNDKD---LAKLSAFAEQHQ---
RLMD_SHEB8      ASLGHLELIAAD-------------NGHFAVLRITKALNDKD---LAKLSAFAEQHL---
RLMD_SHEB5      ASLGHLELIAAD-------------NGHFAVLRITKALNDKD---LAKLSAFAEQHQ---
RLMD_SHEPC      ASLGHLELIAAD-------------NGHFAVLRITKALNDKD---LAKLSAFAEQHQ---
RLMD_SHESW      ASLGHLELIAAD-------------NGHFAVLRITKALNDKD---LAKLSAFAEQHQ---
RLMD_SHESM      SSLGHLELIDAD-------------NGHFAVIRITKSLNDKD---MAKLAQFAEHHQ---
RLMD_SHESR      SSLGHLELIDAD-------------NGHFAVIRITKSLNDKD---MAKLAQFAEQHQ---
RLMD_SHESA      SSLGHVELIDAD-------------NGHFAVIRITKPLNDKD---MAKLAQFAEQHQ---
RLMD_SHEON      SSLGHLELIAAD-------------NGHFAVIRITKSLNDKD---MAKLAQFAEQHQ---
RLMD_SHESH      KALGHLELIDAD-------------NGYFAVLRMTKALSDKD---AKKLTAFANEKS---
RLMD_SHEWM      RALGHVELIDVD-------------NGQFVVVRATKELSDKD---KEKLLSFAQEHK---
RLMD_SHEHH      KALGHVELTQAD-------------NGNFVVLRVTKALSDKD---KARLVEFANKHQ---
RLMD_SHEPA      KALGHVELTQAD-------------NGNFVVLRVTKVLSDKD---KARLVEFANKHE---
RLMD_SHEPW      KALGHVELTLAD-------------NGIFVVLRVTKALSDKD---RQRLAEFGASHS---
RLMD_SHEDO      ASLGHLELTQAD-------------NGTFAVLRVTKVLPAAD---IRALASFALTQG---
RLMD_SHEFN      ASLGHVELTQAD-------------NGNFAVLRVTKVLPASD---IRWLTGFAEKHQ---
RLMD_SHEAM      QRLGHLELTQAA-------------NGLFAVLRVTAPLAQSD---KKLLSAFADERQ---
RLMD_FERBD      RHVGHLDLMLAS-------------EGPVVVVRLLRPLREEE---REALAAFGQSRG---
RLMD_ALIF1      KHLGHVELVQAD-------------NGSVLLIRHVADFNEKD---QQALVNYCEERN---
RLMD_ALIFM      KNLGHVELVQAD-------------NGSVLLIRHVADFNEKD---HQALVNYCEERN---
RLMD_ALISL      RHLGHVELVQAD-------------NGSVLLIRHVAAFNEKD---QQALLHYCEERD---
RLMD_PHOPR      RHLGHIELIEAD-------------NGRVVLIRHLKPFSDKD---MTLILNFAQEQN---
RLMD_VIBCH      ERLGHVELVKGD-------------NTRVLVLRHLGALIEQD---QQRLTDFASQNQ---
RLMD_VIBCM      ERLGHVELVKGD-------------NTRVLVLRHLGALIEQD---QQRLTDFASQNQ---
RLMD_VIBC3      ERLGHVELVKGD-------------NTRVLVLRHLGALIEQD---QQRLTDFASQNQ---
RLMD_VIBCB      EQLGHVELVLGD-------------NAPCITLRHLNKLTEKE---TNTLVELAKRHQ---
RLMD_VIBPA      DQLGHVELVLGD-------------NGPCITLRHLSNLADDE---VSALVELATRHQ---
RLMD_VIBVU      EHLGHVELVAAD-------------NGAVITLRHTGPLLDED---VAKLRQCAEQHQ---
RLMD_VIBVY      EHLGHVELVAAD-------------NGAVITLRHTGPLLDED---VAKLRQCAEQHQ---
RLMD_VIBTL      TSLGHVELVLGD-------------TGPVMVLRHLKPLVEKDEQALMTLMTLAKEEG---
RLMD_SHIFL      RHLGHVELVQAT-------------SGTLMILRHTAPLSSAD---REKLERFSHSEG---
RLMD_SHIF8      RHLGHVELVQAT-------------SGTLMILRHTASLSSAD---REKLERFSHSEG---
RLMD_ECOLI      RHLGHVELVQAT-------------SGTLMILRHTAPLSSAD---REKLERFSHSEG---
RLMD_ECOUT      RHLGHVELVQAT-------------SGTLMILRHTAPLSSAD---REKLECFSHSEG---
RLMD_ECOK1      RHLGHVELVQAT-------------SGTLMILRHTAPLSSAD---REKLECFSHSEG---
RLMD_ECOL6      RHLGHVELVQAT-------------SGTLMILRHTAPLSSAD---REKLECFSHSEG---
RLMD_ECOL5      RHLGHVELVQAT-------------SGTLMILRHTAPLSSAD---REKLECFSHSEG---
RLMD_ECO57      RHLGHVELVQAT-------------SGTLMILRHTAPLSSAD---REKLERFSHSEG---
RLMD_SHIBS      RHLGHVELVQAT-------------SGTLMILRHTAPLSSAD---REKLERFSHSEG---
RLMD_SHIDS      RHLGHVELVQAT-------------SGTLMILRHTAPLSSAD---REKLERFSHSEG---
RLMD_SHISS      RHLGHVELVQAT-------------SGTLMILRHTAPLSSAD---REKLERFSHSEG---
RLMD_CITK8      RHFGHVELVQAG-------------NGTLMVLRHTAPLNATD---REKLERFSHSEG---
RLMD_SALCH      RHLGHVELVQAG-------------SGTLMILRHTAPLSAAD---KEKLERFSHSEG---
RLMD_SALTY      RHLGHVELVQAG-------------SGTLMILRHTAPLSAAD---KEKLERFSHSEG---
RLMD_SALPA      RHLGHVELVQAG-------------SGTLMILRHTAPLSAAD---KEKLERFSHSEG---
RLMD_SALTI      RHLGHVELVQAG-------------SGTLMILRHTAPLSAAD---KEKLERFSHSEG---
RLMD_KLEP3      RHLGHVELVQAD-------------NGPLMVLRHTAALPAGD---REKLERFSQTHG---
RLMD_KLEP7      RHLGHVELVQAD-------------NGPLMVLRHTAALPATD---REKLERFSQTHG---
RLMD_ENT38      RALGHVELVLAD-------------NGPLMVLRHTAPLSAPD---REKLERFSHSHE---
RLMD_CROS8      RHLGHVELVDVT-------------SGPLMVLRHLKPLSAAD---REKLECFSHSEG---
RLMD_ERWT9      RRLGHVELVQAD-------------SGSLLVLRHLDALTAED---RQKLERFSHQYR---
RLMD_PECAS      KRLGHVELVQAE-------------NGPLLVLRHLDPLHPAD---EQALRDFAQRQG---
RLMD_PECCP      KRLGHVELVQAE-------------NGPLLVLRHLDPLHPAD---EQALRDFAEQQG---
RLMD_YERE8      RRLGHVELVLAD-------------NGPLMVLRHLDTLKEVD---RAALIDFAKREQ---
RLMD_PHOLL      KRLGHVELVLAD-------------NGPLMILRHLDPLKRED---KEKLGTFSVQHN---
RLMD_EDWI9      RRLGHLELVLAD-------------NGPLMVLRHLDPLSLSD---REALSAFARQRG---
RLMD_PROMH      RDLGHVELVLAD-------------NGPLVILRHLSPLSEGD---KQLLDDFSHHAQ---
RLMD_HAEIN      KQLGHIELVAAD-------------NGVAMLLRYTKNLAEID---RTLLLKFAEQEK---
RLMD_HAEI8      KQLGHIELVAAD-------------NGVAMLLRYTKNLAEID---RTLLLKFAEQEK---
RLMD_HAEP3      KQLGHIELVSAE-------------NGVAMLLRYKGNLAETD---RTLLLEFARVNA---
RLMD_HAES1      KTLGHIELVAAD-------------NGVAMLLRVTEKLAEHD---RTLLLDFAFNHQ---
RLMD_MANSM      KNLGHIELVAAD-------------NGVAMLLRYSGKLTEND---RTLLLDFAVREE---
RLMD_PASMU      KNLGHVELVHAD-------------NGIAMLLRHTGNLAQTD---RTLLTNFAQQEN---
RLMD_HAEDU      KALGHIELVNAD-------------NTRAMLVLHIGKINAQD---QHMLLNFAKAEQ---
RLMD_COLP3      SAIGHIEVIQADISDTSSADKIQKDNQVVVVVRQLKPMNDTD---IGLWQLYAQRHC---
RLMD_PSYIN      AHLGHVELLYAD-------------QGAVVLLRHMKTLTSPD---LQLITAFSALQK---
RLMD_IDILO      SKLGHIEAINTN--------------TPVILLRITEALPGDA---MQALQEWQTVNK---
RLMD_ALTMD      RHIGHISLIAGD-------------NRAQVVIKHTKALEDAL---IETVDAFAKALG---
RLMD_ALTNA      RLVGHVSLLAGE-------------NAVQVTVKHTRSLANDF---IASLSQFAVEQN---
RLMD_DICNV      K-VDEILLTAGE-------------KVAALTLRTKKRALSPA---WGEKWANLAGAH---
RLMD_PSEAE      ESIGHVELFHGT--------------ASALLLRHTTALVDED---RQRLAAFCSAHQ---
RLMD_PSEAB      ESIGHVELFHGT--------------ASALLLRHTTALVDED---RQRLAAFCSAHQ---
RLMD_PSEE4      QTLGHVELFSGT--------------AEAVLVRHVAALPAED---LARLEAFCREAG---
RLMD_PSEPK      QALGHVELFSGT--------------AEAVLVRHVAPLPAED---QARLQAFCEQAN---
RLMD_PSEF5      QALGHVELFSGS--------------ALAVLLRHMAPLSDSD---LTILKDFCDFHQ---
RLMD_PSEPF      QALGHVELFSGS--------------SLAVLLRHMAPLSEAD---LTILKDFCAFHE---
RLMD_PSE14      QALGHVELFSGV--------------ATAVLLRHTAPLAEAD---LALLQAFCSKHG---
RLMD_PSEU2      QVLGHVELFSGV--------------ATAVLLRHTASLVEAD---LALLQAFCSRHG---
RLMD_PSESM      QVLGHVELFSGS--------------STAVLLRHTAPLAEAD---LATLQAFCKTHG---
RLMD_ACIF2      QDFPQIEVAATPD-------------AVALVFRHMRPLAESD---LQHLRAFGEQHD---
RLMD_ACIF5      QDFPQIEVAATPD-------------AVALVFRHMRPLAESD---LQHLRAFGEQHD---
RLMD_ACIAC      DTCPQIELACGDD-------------VTALVLRHLEPLSEAD---LGRLRSFAAAH----
RLMD_ACISJ      DTCPQIELACGDT-------------VTALVLRHLEPLSPED---KDKLRAFAAVH----
RLMD_VEREI      DSCPQIELACGDS-------------VTALVLRHLQPLSVGD---HARLRAFAAEH----
RLMD_RHOFT      ETCPQIELACGDS-------------VTALVLRHMEPLTHGD---LALLRGFAAQHA---
RLMD_POLNA      ETIPQIELACGDD-------------LTAMVLRHMEPLSVAD---LARLRAFAAANA---
RLMD_POLSJ      ETLPQIELACGDT-------------VTAMVLRHMEPLSSGD---LARLRAFAVSHP---
RLMD_RUBGI      DRLPQIELAAGDE-------------VIALVLRHLEPLSAGD---AARLRAFGAEH----
RLMD_BORBR      DRMPQIEVALGDE-------------AIVLVLRHLLPLTDGD---IAVLRAFAAEH----
RLMD_BORPA      DRMPQIEVALGDE-------------AIVLVLRHLLPLTDGD---IAVLRAFAAEH----
RLMD_BORPE      DRMPQIEVALGDE-------------TIVLVLRHLLPLTDGD---IAVLRAFAAEH----
RLMD_BORA1      ERIPQIEVALGEG-------------VTALVLRHIEPLNDHD---ITVLRDFAARH----
RLMD_BURCA      DRMPQIELAVGST-------------VTALVLRVLEPINADD---EALLRAFADEH----
RLMD_BURCH      DRMPQIELAVGST-------------VTALVLRVLEPINADD---EALLRAFADEH----
RLMD_BURL3      DRMPQIELAVGSE-------------VTALVLRVLEPINADD---EALLRAFADEH----
RLMD_BURCM      DRMPQIELAVGSQ-------------VTALVLRVLEPINADD---EALLRAFADEH----
RLMD_BURMA      DRMPQIELAVGAR-------------VTALVLRVLEPINAAD---EALLREFADTH----
RLMD_BURPS      DRMPQIELAVGAR-------------VTALVLRVLEPINAAD---EALLREFADTH----
RLMD_BURP1      DRMPQIELAVGAR-------------VTALVLRVLEPINAAD---EALLREFADTH----
RLMD_BURTA      DRMPQIELAVGSQ-------------VTALVLRVLEPINAAD---ETLLREFADAH----
RLMD_PARXL      DRMPQLELAVGSS-------------VTALVVRNLEPITAAD---EQVLRDFADEH----
RLMD_CUPNH      DRMPQIELAVGQE-------------VTALVLRILEPLTDAD---KDLLRAFADQH----
RLMD_CUPMC      DRMPQIELAVGAE-------------VTALVLRVLEPLNDAD---KDLLRAFADQH----
RLMD_CUPPJ      DRMPQIELAVGHE-------------VTALVLRILEPLTDAD---KDLLRAFADQH----
RLMD_RALPJ      QRMPQIELAVGQD-------------VTALVLRNLEPITAED---EAELRAFADHH----
RLMD_RALSO      QRMPQIEVAVGQD-------------VTALVLRILEPLTSAD---EAELRAFADRH----
RLMD_POLNS      DRMPQIEIAIGEPEDAQSDDPQKSKPVTALVFRNLKPLTTED---EQLLRAFADQH----
RLMD_AZOSB      DRLPQIEVAVSEA-------------TTVLVFRNLLALKKAD---EAQLRSFAETHG---
RLMD_AROAE      DRLPQIEIAIGDT-------------AIVLVFRNLLPLTPAD---EARLAAFAGEHG---
RLMD_CHRVO      QRMPQVEVAVGDK-------------LDILVFRNMDDITDAD---FAILKAFSDKHGAAE
RLMD_METFK      DRLPQIEVAVGEL-------------ATVLVLRILEPLQPQD---AAPIKAFADRYG---
RLMD_NITMU      ERLPQIEVSLGED-------------VDVLVLRILEPLTAQD---ETLLKAFADQHH---
RLMD_DECAR      ERIREVDVAVGEH-------------CTALLLRILDPLTPAD---ERLLCDFVDRND---
RLMD_THIDA      DRIPQIEVAAGEH-------------VIVLVFRLLEPWNDDD---AAHVRAFADAHH---
RLMD_NEIL0      GSVARFAEFYRGSE------------ITVLNIAFKSKLRQNE---ENRIRQWFDSELSD-
RLMD_ACIB3      AHIGHVELAKG-------------DHEISLLVRHIEKLNNAD---VNQLRQFALHKG---
RLMD_ACIBY      AHIGHVELAKG-------------DHEISLLVRHIEKLNNAD---VNQLRQFALHKG---
RLMD_ACIB5      AHIGHVELAKG-------------DHEISLLVRHIEKLNNAD---VNQLRQFALHKG---
RLMD_ACIBC      AHIGHVELAKG-------------DYETSLLVRHIEKLNNAD---VNQLRQFALHKG---
RLMD_ACIBS      VHIGHVELAKG-------------DHETSLLVRHIEKLNNAD---VNQLRQFALHKG---
RLMD_ACIAD      AEIGHIELAMG-------------DDEVSLLVRHLNTLPDSD---ITQLCDYAQHKN---
RLMD_PSYA2      NKIAQLELAMGEYLPELPDG----DQPVALIVRNLEPLSDAD---IDKLKVFFAARN---
RLMD_PSYCK      DKIAQLELAMGEHLPELPDG----DQPVALIVRNLEPLSDGD---IDKLKVFFAARN---
RLMD_ALCBS      SRIPQIELAAG-------------DDDVALIIRHLDPLSEAD---QQALLGFCQNLG---
RLMD_MARHV      DRIAQVEVACG-------------DDTAAMVFRNMDDLVPDD---REKLIAFGQAHD---
RLMD_HAHCH      QRIPQIEVAAG-------------DDMCALVIRHMDPLTEED---LQKLIAFSEQTG---
RLMD_ALKEH      DRVPQIEVALG-------------DETGALVFRNLAPLTAAD---LNRLAGFARDSG---
RLMD_METCA      ERLPQIEAAVG-------------EERTALVFRVLEDPTAED---FARLARFGKDQG---
RLMD_NITOC      DRIPQIEVAAG-------------DQSTGLVFRHLVPLTTAD---TEQLVAFGQAHK---
RLMD_STRMK      RDIPQIEFIAG-------------DQAVVLTVRHLQPLSDAD---RAAWAAFGQQHG---
RLMD_STRM5      RDIPQIEFIAG-------------DQAVVLTVRHLQPLSDAD---RAAWATFGQQHG---
RLMD_XANAC      RDIPQIEFIAG-------------DDAVALTIRHMQPLSERD---RQAWITFAQEHG---
RLMD_XANC5      RDIPQIEFIAG-------------DDAVALTIRHMQPLSERD---RQAWVAFAQEHG---
RLMD_XANOR      RDIPQIEFIAG-------------DDAVALTIRHMQPLSARD---QQAWIAFAQEHG---
RLMD_XANOM      RDIPQIEFIAG-------------DDAVALTIRHMQPLSARD---QQAWIAFAQEHG---
RLMD_XANCP      RDIPQIEFIAG-------------DDAVALTIRHLQPLSARD---EQALVEFAQAHD---
RLMD_XANC8      RDIPQIEFIAG-------------DDAVALTIRHLQPLSARD---EQALVEFAQAHD---
RLMD_XYLFA      RDVPQIEFIAG-------------DAVVALTVRHLQPLSEAD---RLALIEFGKEHG---
RLMD_XYLFT      CDVPQIEFIAG-------------DAVVALTVRHLQPLSEAD---RLALIEFGKEHG---
RLMD_FRATH      QHIAQLEIAID-------------DTRPAMIVRHLEPFTNED---LEKLRSFAQENN---
RLMD_FRATO      QHIAQLEIAID-------------DTRPAMIVRHLEPFTNED---LEKLRSFAQENN---
RLMD_FRATT      QHIAQLEIAID-------------DTRPAMIVRHLEPFTNED---LEKLRSFAQENN---
RLMD_FRAT1      QHIAQLEIAID-------------DTRPAMIVRHLEPFTNED---LEKLRSFAQENN---
RLMD_FRATN      QHIAQLEIAID-------------DTRPAMIVRHLEPFTNED---LEKLRSFAQQNN---
RLMD_LEGPC      HCIAQIEVAAG-------------DNEVALIFRNLSPLTEQD---ELKIREFAQQFQ---
RLMD_LEGPA      HCIAQIEVAAG-------------DNEVALIFRNLSPLTEQD---ELKIREFAQQFQ---
RLMD_LEGPH      QCIAQIEVAAG-------------DNEVALIFRNLTPLTEQD---ELKIRKFAEQFQ---
RLMD_LEGPL      QCIAQIEVAAG-------------DNEVALIFRNLTPLTEQD---ESKIRKFAQQFQ---
RLMD_VESOH      SSIPQFEVVIS-------------ESGIALILRHLESLSVKD---EKILADCAQELN---
                                                                            

RLMD_CHRSD      --TLAWRVGREAPTLRWLH--------APRG---------------EALHVTLVLDDTT-
RLMD_HALED      --HLGAWLGRESPRFEWLT--------PP-----------------PALHCRLTAGRRT-
RLMD_CELJU      --CQVWLEPNGNQGLTDLE--------GS------------------PVDPHLVLDVAG-
RLMD_MARPP      --VELYWQAPKASRADLTD--------EQ----------------------MRYYDVSN-
RLMD_MARMS      --VALYWQAPKVGKAEVAL--------EK----------------------MRYYDLGD-
RLMD_MARM1      --VNLYWQRADESR--IST--------AR----------------------KHYYYVDG-
RLMD_HYDCU      ----------------VDS--------ST----------------------WPSYGVNG-
RLMD_AERHH      --IDLYLQAADEQI--------------EPLHQQFA----------------PSYSLDG-
RLMD_AERS4      --IDLYLQAADERI--------------EPLHQVFQ----------------PSYSLDG-
RLMD_TOLAT      --CALYLQTTGYP---------------EPLADVKP----------------SFYQLDG-
RLMD_PSEHT      --WQLVWQSESEVI--------------EHSHLAM-----------------PFYALEE-
RLMD_SHEB9      --IHICLQDNEGQF--------------QGVGA---------------ELVLPVYQLLDD
RLMD_SHEB2      --IHICLQDNEGQF--------------QGVGA---------------ELVLPVYQLLDD
RLMD_SHEB8      --IHICLQDNEGQF--------------QGVGA---------------ELVLPVYQLLGD
RLMD_SHEB5      --IHICLQDNEGQF--------------QGVGA---------------ELVLPVYQLLDD
RLMD_SHEPC      --IYICLQDNEGQF--------------QGVGV---------------ELVLPVYQLLDE
RLMD_SHESW      --IYICLQDNEGQF--------------QGVGV---------------ELVLPVYQLLDE
RLMD_SHESM      --IHICLQDNNGEF--------------HGVNG---------------TLLLPVYQLLDD
RLMD_SHESR      --IHICLQDNNGEF--------------HGVNG---------------TLLLPVYQLLDD
RLMD_SHESA      --IHICLQDNNGEF--------------HGVNG---------------TLLLPVYQLLDD
RLMD_SHEON      --IHICLQDNEGEF--------------HGVNG---------------TLLLPVYQLLDD
RLMD_SHESH      --ISLIVQGNEGEF--------------TILGD---------------RNELPYYALD--
RLMD_SHEWM      --VNLIVQGNEGEL--------------LVIKG---------------PKELPFYTLNS-
RLMD_SHEHH      --VIVLLQDDDAQC--------------EHLNG---------------AGEQPYYGFDD-
RLMD_SHEPA      --VIVLLQDDDAQC--------------EHLNG---------------AGEQPFYALSG-
RLMD_SHEPW      --LNMLLQDDDANT--------------ESLSG---------------HGQQPFYSFND-
RLMD_SHEDO      --INLLLQDDSGAL--------------TDVMTMAPAEDEGATQVEQSALTLPEYALSQ-
RLMD_SHEFN      --LNLLLQDDAGQL--------------TQLFPLLPAGDE--------AIALPYYHLAQ-
RLMD_SHEAM      --IALLLQGNEGEL--------------EFLSS---------------GHELPYYQLDG-
RLMD_FERBD      --VQMLIQGDA--L--------------TDLSGQ--------------AVAPLHYDIGE-
RLMD_ALIF1      --LILYLMPEADVL--------------NHVRG-----------------EEPFYLIDG-
RLMD_ALIFM      --LILYLMPEADVL--------------NHVRG-----------------EEPFYLIDG-
RLMD_ALISL      --LILYLMPESDVL--------------NHVYG-----------------EEPYYVIDE-
RLMD_PHOPR      --VILFLAPTSDDI--------------ELIHG-----------------ETPYYRLDD-
RLMD_VIBCH      --LTLYLMLEAGEL--------------QHVQG-----------------EAPYCEETG-
RLMD_VIBCM      --LTLYLMLEAGEL--------------QHVQG-----------------EAPYCEETG-
RLMD_VIBC3      --LTLYLMLEAGEL--------------QHVQG-----------------EAPYCEETG-
RLMD_VIBCB      --ASLYLMPETDQL--------------DLVEG-----------------EVPFYQEAG-
RLMD_VIBPA      --ASLYLMPETDQL--------------NLVAG-----------------EVPFYQEAG-
RLMD_VIBVU      --ATLYLMPASDQL--------------ERISG-----------------EAPYYQEIG-
RLMD_VIBVY      --ATLYLMPASDQL--------------ERISG-----------------EAPYYQEIG-
RLMD_VIBTL      --ATLYSMPETDKL--------------VRLVG-----------------DAPSYSETG-
RLMD_SHIFL      --LDLYLAPDSEIL--------------ETVSG-----------------EMPWYDSNG-
RLMD_SHIF8      --LDLYLAPDSEIL--------------ETVSG-----------------EMPWYDSNG-
RLMD_ECOLI      --LDLYLAPDSEIL--------------ETVSG-----------------EMPWYDSNG-
RLMD_ECOUT      --LDLYLAPDSEIL--------------ETVSG-----------------EMPWYDSNG-
RLMD_ECOK1      --LDLYLAPDSEIL--------------ETVSG-----------------EMPWYDSNG-
RLMD_ECOL6      --LDLYLAPDSEIL--------------ETVSG-----------------EMPWYDSNG-
RLMD_ECOL5      --LDLYLAPDSEIL--------------ETVSG-----------------EMPWYDSNG-
RLMD_ECO57      --LDLYLAPDSEIL--------------ETVSG-----------------EMPWYDSNG-
RLMD_SHIBS      --LDLYLAPDSEIL--------------ETVSG-----------------EMPWYDSNG-
RLMD_SHIDS      --LDLYLAPDSEIF--------------ETVSG-----------------EMPWYDSNG-
RLMD_SHISS      --LDLYLAPDSEIL--------------ETVSG-----------------EMPWYDSNG-
RLMD_CITK8      --LSLFLAPQSDIL--------------EPLTG-----------------EAPWYDSNG-
RLMD_SALCH      --LSLFLAPFSEIL--------------ETVSG-----------------EAPWYDSHG-
RLMD_SALTY      --LSLFLAPFSEIL--------------ETVSG-----------------EAPWYDSHG-
RLMD_SALPA      --LSLFLAPFSEIL--------------ETVSG-----------------EAPWYDSHG-
RLMD_SALTI      --LSLFLAPFSEIL--------------ETVSG-----------------EAPWYDSHG-
RLMD_KLEP3      --LSLYLAPQSEIL--------------EHIHG-----------------EAPWYTSDG-
RLMD_KLEP7      --LSLYLAPQSEIL--------------EHIHG-----------------EAPWYTSDG-
RLMD_ENT38      --LTLFLAPQSEIL--------------ERVSG-----------------DDPWYLSDG-
RLMD_CROS8      --VALYLAPQSDTL--------------EHLNG-----------------EMPWYESDG-
RLMD_ERWT9      --LSLFLAAESDTL--------------EQVSG-----------------GMPHYQSHD-
RLMD_PECAS      --VSVYLAPDAESL--------------TCLHG-----------------EEPVYHVAG-
RLMD_PECCP      --VSVYLAPDADSL--------------TCLHG-----------------DEPVYLVAG-
RLMD_YERE8      --VAVYLAGDSDNV--------------EKLIG-----------------EEPYYQIEG-
RLMD_PHOLL      --VAVYLAADETSL--------------ESLNEL----------------PEPWYQVDG-
RLMD_EDWI9      --LTLYLS-DGGAP--------------QRLLG-----------------EAPYYQIDG-
RLMD_PROMH      --VMIYLAGDNGEI--------------AQLTTIE---------------KEPFYQIEG-
RLMD_HAEIN      --LMLFLQ-SDKGI--------------EQIYG-----------------DAPYYQFSDG
RLMD_HAEI8      --LMLFLQ-SDKGI--------------EQIYG-----------------DAPYYQFSDG
RLMD_HAEP3      --VNLFLQ-DDQNI--------------QLVHG-----------------EMPYYALDD-
RLMD_HAES1      --VMLFVQ-DEKEI--------------CHLQG-----------------DLPYYQLDDG
RLMD_MANSM      --LMLFLQ-DDEKT--------------EQIYG-----------------QPPFYQLADN
RLMD_PASMU      --LMLFVQ-DDQQI--------------TQLHG-----------------EAPYYILRDG
RLMD_HAEDU      --LSLYLMCDENHI--------------EHLCG-----------------EAPYYQING-
RLMD_COLP3      --WHVIIDDGNKQLP--LA--------DIKGGDSF---------------ELSYELTD-T
RLMD_PSYIN      --VNFFGQASSNQ--------------SVCLAGEA---------------NLSYRLPEWD
RLMD_IDILO      --TNIWLQSENDLQ---------------PLAGA----------------AMPFDTSIDG
RLMD_ALTMD      --LDVVLENKQGRL--------------RSVGEAQ---------------GLIMHTVDG-
RLMD_ALTNA      --VNMTIEDGNGEF--------------THLHEIA---------------PITCNTVDG-
RLMD_DICNV      --WQLWENDR------------------CLFGEPN---------------DLYYQPISG-
RLMD_PSEAE      --AQLWLQGAEQPL--------------PVEPA-----------------AELGYSLGDW
RLMD_PSEAB      --AQLWLQGAEQPL--------------PVEPA-----------------AELGYSLGDW
RLMD_PSEE4      --AQLWLQGEGDPA--------------PVDAA-----------------QRLGFALEPW
RLMD_PSEPK      --AQLWLQGEGEPA--------------PVDPA-----------------AQLGFALAPW
RLMD_PSEF5      --AQLWLHGEGEPQ--------------PFDPS-----------------QALGYRLETW
RLMD_PSEPF      --AQLWLHGEGEPQ--------------PVDDA-----------------QSLGYHLEQW
RLMD_PSE14      --AQLWLHGEGEPQ--------------PVSPG-----------------DTLGYRLEPW
RLMD_PSEU2      --AQLWLHGEGEPQ--------------PASPG-----------------DTLGYRLEPW
RLMD_PSESM      --AQLWLHGEGEPQ--------------PASPG-----------------DTLGYRLEPW
RLMD_ACIF2      --LQIWLQPRGPETLYPLWP---------------------------EQPEPLHYDLPDY
RLMD_ACIF5      --LQIWLQPRGPETLYPLWP---------------------------EQPEPLHYDLPDY
RLMD_ACIAC      -GVQWWLQPKGPDTVHLLD----------------------------EGGPQLNYALPDF
RLMD_ACISJ      -GVQWWLQPKGPETVHLLD----------------------------EGGEPLAYGLPDF
RLMD_VEREI      -GVQWWLQPRGPDTVQPLD----------------------------EGGEQLSYALPDF
RLMD_RHOFT      -GVQWWLQPNGPETAHLLD----------------------------EGGQALSYDLPEF
RLMD_POLNA      -GLQWWVQSGGLDTVKLLD----------------------------AQVAELSYGLPEF
RLMD_POLSJ      -GLQWWLQPGGLDSVKLLD----------------------------EGVPELSYDLPEF
RLMD_RUBGI      -GVQWWLQPKGPETVHRLD----------------------------EGGPQLAYSLPEY
RLMD_BORBR      -GVQWWLQSKGPDTVHPLER---------------------------EHADALAYTLPEF
RLMD_BORPA      -GVQWWLQSKGPDTVHPLER---------------------------EHADALAYTLPEF
RLMD_BORPE      -GVQWWLQSKGPDTVHPLER---------------------------EHADALAYTLPEF
RLMD_BORA1      -NVQWWLQSKGPDTVHPLDP---------------------------AHGDTLAYTMPEF
RLMD_BURCA      -KVQFWLQPKGPDTVTPFY----------------------------PLDVSLDYTLPEF
RLMD_BURCH      -KVQFWLQPKGPDTVTPFY----------------------------PLDVSLDYTLPEF
RLMD_BURL3      -KVQFWLQPKGPDTVAPFY----------------------------PLDVSLDYTLPEF
RLMD_BURCM      -KVQFWLQPKGPDTVTPFY----------------------------PLDVPLDYTLPEF
RLMD_BURMA      -RVQFWLQPKGPDTVAPFY----------------------------PLDAQLDYTLPEF
RLMD_BURPS      -RVQFWLQPKGPDTVAPFY----------------------------PLDAQLDYTLPEF
RLMD_BURP1      -RVQFWLQPKGPDTVAPFY----------------------------PLDAQLDYTLPEF
RLMD_BURTA      -RVQFWLQPKGPDTVAPFY----------------------------PLDVQLDYTLPEF
RLMD_PARXL      -KVQFWLQPGGPDTVTPFY----------------------------PLDVQLDYTLPEY
RLMD_CUPNH      -KVQFWLQPKGPDTVYPFY----------------------------PADAELAYTLPEF
RLMD_CUPMC      -QVQFWLQPKGPDTVYPFY----------------------------PAEQELAYTLPEF
RLMD_CUPPJ      -NVQFWLQPKGPDTVVPFY----------------------------PLDRELAYTLPEF
RLMD_RALPJ      -NIQFWLQPKGPDTVYPFY----------------------------PLDRTLTYTLPEF
RLMD_RALSO      -AVQFWLQPKGPDTVYPFY----------------------------PLDRALTYTLPEF
RLMD_POLNS      -EVWIWLQPKGIETIAPFY----------------------------PLTGKLCYRLPEF
RLMD_AZOSB      --VQVWLQPEGPDSIVPLHP---------------------------RSGPGLTYTLPEF
RLMD_AROAE      --VQVWLQPGAPATAHPLHP---------------------------KGAAPLAYTLPEF
RLMD_CHRVO      RPLQIWLQPKGPDTCYPIYP---------------------------LDAPKLTYSMPEF
RLMD_METFK      --VEVWTQSKGPDTVQPFYP---------------------------LQGPGLSYSLPEF
RLMD_NITMU      --VQLFLQTGGPQTAYPFYP---------------------------EDAPELSYTLPEF
RLMD_DECAR      --VVFYLQPKGPDTAFRFYP---------------------------SGGPRLSYTLPEF
RLMD_THIDA      --VQVWEQRKGPETARPFWP---------------------------DIAPELSYGLPEF
RLMD_NEIL0      -GWQVWLQIEG-GVSQPFYP---------------------------KTDKTLKYTLPEF
RLMD_ACIB3      --WQLYLQPKGPESLRRI------DEE--------------------QGAMRLHYALNAF
RLMD_ACIBY      --WQLYLQPKGPESLRRI------DEE--------------------QGAMRLHYALNAF
RLMD_ACIB5      --WQLYLQPKD-QSLRRI------DEE--------------------QGAMRLHYALNAF
RLMD_ACIBC      --WQLYLQPKGPESLRRI------DEE--------------------QGAMRLHYALNAF
RLMD_ACIBS      --WQLYLQPKGPESLRRI------DEE--------------------QGAMRLHYALNAF
RLMD_ACIAD      --WQLYLQAKGSDSLKRV------DRS--------------------GAEMRLHYAVPAF
RLMD_PSYA2      --WQLYLQPKGADSIQRIALTAADDLS--------------------EQFGRLYYQLPEY
RLMD_PSYCK      --WQLYLQSKGADSIQRIALRDTDDLS--------------------EQFGRLYYQLPEY
RLMD_ALCBS      --WHCYLQPGNESTVHRIWPQEG--------------------------EQRLYYKHPSA
RLMD_MARHV      --LHIYLQPKGPDTVHRIWPESG---G--------------------RDDERLTYRMDEF
RLMD_HAHCH      --LAIYLQPKGPDTVAKLWPKDG--------------------------QELLSYQLRDY
RLMD_ALKEH      --LAVYQQPGNEATMALVHDP---------------------------VGRRLDYALPGH
RLMD_METCA      --LDVYIQREGRDSVAPVYPE---------------------------TAHDLSYSLPEW
RLMD_NITOC      --LQIYLQGGGAETVRLLWP----------------------------AGARLSYSQFG-
RLMD_STRMK      --FVIYLQSGGVDTVQPLDGQ----------------------------GVPLSFRLAPW
RLMD_STRM5      --FVIYLQSGGVDTVQPLDGQ----------------------------GVPLSFRLAPW
RLMD_XANAC      --FAIFLQPGGVDSVQPLWPQ----------------------------EVPLSFRLPQW
RLMD_XANC5      --FAIFLQPGGVDSVHPLWPQ----------------------------DVPLSFRLPQW
RLMD_XANOR      --FAIFLQPGGVDSVHPLWPQ----------------------------EVPLSFRLPQW
RLMD_XANOM      --FAIFLQPGGVDSVHPLWPQ----------------------------EVPLSFRLPQW
RLMD_XANCP      --FAIFLQPGGVDSVHPLWPQ----------------------------EVPLSFRLPKW
RLMD_XANC8      --FAIFLQPGGVDSVHPLWPQ----------------------------EVPLSFRLPKW
RLMD_XYLFA      --IAIFLQSGGVESVRLLWPD----------------------------EVLLAFRLKPW
RLMD_XYLFT      --IAIFLQSGGVESVRLLWPD----------------------------EVLLAFRLKPW
RLMD_FRATH      --YWIYLQSKGPDTIFRLYPQG-------------------------DVEPKKLSYQPAA
RLMD_FRATO      --YWIYLQSKGPDTIFRLYPQG-------------------------DVEPKKLSYQPAA
RLMD_FRATT      --YWIYLQSKGPDTIFRLYPQG-------------------------DVEPKKLSYQPAA
RLMD_FRAT1      --YWIYLQSKGPDTIFRLYPQG-------------------------DVEPKKLSYQPAA
RLMD_FRATN      --YWIYLQSKGPDTIFRLYPQG-------------------------DVEPKKLSYQPAA
RLMD_LEGPC      --YKVFLQPGGLDSVFCFYPS--------------------------DAHAYLSYELPDY
RLMD_LEGPA      --YKVFLQPGGLDSVFCFYPS--------------------------DAHAYLSYELPDY
RLMD_LEGPH      --YKVFLQPGGLDSVFCFYPS--------------------------DAHAYLSYELPDY
RLMD_LEGPL      --YKVFLQPGGLDSVFCFYPS--------------------------DAHAYLSYELPDY
RLMD_VESOH      --ITFYTQSGGLDSV----KPL-------------------------DEPTILTYSHSNY
                                                                            

RLMD_CHRSD      ------LSLGCVPG--DFLQINADVNARLVRTALAWLAPR-----GEERVLDLFAGVGNF
RLMD_HALED      ------LVLGLEPS--DFLQANEAVNQRMVDTALSWLAPALSPVAPGTRVLDLFAGIGNF
RLMD_CELJU      ------LPLHFHPQ--DFTQVNPAVNGRMVQQALELLAPG-----TNDLVLDFFCGMGNF
RLMD_MARPP      ------LRLKYHPQ--DFIQINEFMNQKMVAQAMAWLAPQ-----KDDTVLDLFCGVGNF
RLMD_MARMS      ------LRLKYHPQ--DFIQVNAAMNQKMVVQAMDWLNPS-----KQDVILDLFCGVGNF
RLMD_MARM1      ------LNIQFHPQ--DFIQVNASMNEKMVEQAMRWLAPT-----KEDIVLDLFCGSGNF
RLMD_HYDCU      ------LTLNFPAQ--GFVQVNAEMNEQMVNKALDWLDLN-----KEQRVLDLFCGVGNF
RLMD_AERHH      ------LSLAFAPG--DFIQVNAPVNQRMVEQALSWLEAG-----KDDKVLDLFCGIGNF
RLMD_AERS4      ------LSLAFAPG--DFIQVNGPINQSMVAQALAWLGAS-----KDDKVLDLFCGIGNF
RLMD_TOLAT      ------LRLYFQPG--DFLQVNPQVNQRLVNYVREWLAPT-----ATDNVLDLFCGIGNF
RLMD_PSEHT      ------LGLKFEFGLNNFIQVNASVNQAMLKQAQNWLALK-----GDENVLDLFCGIGNF
RLMD_SHEB9      KAESDAVSLSFTPG--NFVQVNGQINKAMVAQAMDWLAPA-----PDERILDLFCGMGNF
RLMD_SHEB2      KAESDAVSLSFTPG--NFVQVNGQINKAMVAQAMDWLAPA-----PDERILDLFCGMGNF
RLMD_SHEB8      KAESDAVSLSFTPG--NFVQVNGQINKAMVAQALDWLAPA-----PDERILDLFCGMGNF
RLMD_SHEB5      KAESDAVSLSFTPG--NFVQVNGQINKAMVAQAMDWLAPA-----LDERILDLFCGMGNF
RLMD_SHEPC      NAQSDAVSLSFTPG--NFVQVNSQINKAMVAQAMDWLAPA-----PDERILDLFCGMGNF
RLMD_SHESW      NAQSDAVSLSFTPG--NFVQVNSQINKAMVAQAMDWLAPA-----PDERILDLFCGMGNF
RLMD_SHESM      KAGATPVSLTFTPG--NFVQVNAQINKAMVAQALDWLAPQ-----PGERILDLFCGMGNF
RLMD_SHESR      KADATPVSLTFTPG--NFVQVNAQINKAMVAQALDWLAPQ-----PGERILDLFCGMGNF
RLMD_SHESA      NADATPVSLTFTPG--NFVQVNAQINKTMVAQALEWLAPQ-----PGERILDLFCGMGNF
RLMD_SHEON      KTDVQPVSLTFTPG--NFVQVNAQINKAMVAQALDWLAPQ-----PGERILDLFCGMGNF
RLMD_SHESH      -----DVKLNFTPG--NFIQVNAAINESMVKQAVDWLSVK-----PNERVLDLFCGVGNF
RLMD_SHEWM      -----DIKLSFTPG--NFVQVNGEINRAMVDQAVQWLDVK-----ADERVLDLFCGVGNF
RLMD_SHEHH      ----NQVKLNFSPG--NFIQVNAQVNQAMVSQAVEWLSPK-----ADERVLDLFCGIGNF
RLMD_SHEPA      ----SDIKLNFSPG--NFIQVNGPVNQAMVSQAVEWLSPK-----AGERVLDLFCGIGNF
RLMD_SHEPW      ----SDAELKFSAG--NFIQVNASVNQAMVNQAVDWLAPQ-----ANERVLDLFCGIGNF
RLMD_SHEDO      ----GQVSCQFTPG--NFVQVNAEVNQRMVEQAVNWLDLQ-----VGERVLDLFCGVGNF
RLMD_SHEFN      ----EAVRCSFTPG--NFVQVNGAINQAMVDQAIEWLDPQ-----SGERILDLFCGVGNF
RLMD_SHEAM      ------LKLAFAPG--NFIQVNGEVNQAMVAQAMNWLDVH-----AGERVLDLFCGVGNF
RLMD_FERBD      ----GRPQPAFLPG--DFFQVNGVVNQAMISQAIEWLQPQ-----PGEKGLDLFCGGGNF
RLMD_ALIF1      ------TKIYFTPK--DFIQVNRNVNEQMVEQALSWLDLN-----ENDSVLDLFCGLGNF
RLMD_ALIFM      ------TKIYFTPK--DFIQVNRKVNEQMVEQALSWLDLN-----ENDSVLDLFCGLGNF
RLMD_ALISL      ------VKIYFTPK--DFIQVNASINDSMVNQALTWLDLN-----ADDCVLDLFCGLGNF
RLMD_PHOPR      ------LTLHFSPK--DFIQVNRDVNKKMVEQATDWLDLQ-----PSDRVLDLFCGLGNF
RLMD_VIBCH      ------SRLSFLPS--HFIQVNRAVNQHMVVQALNWLEVS-----PQERVLDLFCGLGNF
RLMD_VIBCM      ------SRLSFLPS--HFIQVNRAVNQHMVVQALNWLEVS-----PQERVLDLFCGLGNF
RLMD_VIBC3      ------SRLSFLPS--HFIQVNRAVNQHMVAQALNWLEVS-----PQEHVLDLFCGLGNF
RLMD_VIBCB      ------VTVPFTPN--NFIQVNQAVNQKMVAQAVDWLDPK-----SDERVLDLFCGLGNF
RLMD_VIBPA      ------VKIPFDPN--NFIQVNQAVNQKMVEQAIKWLDPQ-----SDERVLDLFCGLGNF
RLMD_VIBVU      ------FKVPFEPN--NFIQVNQKVNQQMVVQALEWLDPQ-----SSDRVLDLFCGLGNF
RLMD_VIBVY      ------FKVPFEPN--NFIQVNQKVNQQMVVQALEWLDPQ-----SSDRVLDLFCGLGNF
RLMD_VIBTL      ------VTLPFEPN--HFIQVNQKVNQQMVAQAIEWLEPQ-----ADERVLDLFCGLGNF
RLMD_SHIFL      ------LRLTFSPR--DFIQVNAGVNQKMVARALEWLDVQ-----PEDRVLDLFCGMGNF
RLMD_SHIF8      ------LRLTFSPR--DFIQVNAGVNQKMVARALEWLDVQ-----PEDRVLDLFCGMGNF
RLMD_ECOLI      ------LRLTFSPR--DFIQVNAGVNQKMVARALEWLDVQ-----PEDRVLDLFCGMGNF
RLMD_ECOUT      ------LRLTFSPR--DFIQVNAGVNQKMVARALEWLDVE-----PEDCVLDLFCGMGNF
RLMD_ECOK1      ------LRLTFSPR--DFIQVNAGVNQKMVARALEWLDVE-----PEDCVLDLFCGMGNF
RLMD_ECOL6      ------LRLTFSPR--DFIQVNAGVNQKMVARALEWLDVE-----PEDRVLDLFCGMGNF
RLMD_ECOL5      ------LRLTFSPR--DFIQVNAGVNQKMVARALEWLDVE-----PEDRVLDLFCGMGNF
RLMD_ECO57      ------LRLTFSPR--DFIQVNAGVNQKMVARALEWLEVE-----PEDRVLDLFCGMGNF
RLMD_SHIBS      ------LRLTFSPR--DFIQVNAGVNQKMVASALEWLDVQ-----PEDRVLDLFCGMGNF
RLMD_SHIDS      ------LRLTFSPR--DFIQVNAGVNQKMVARALEWLDVQ-----PEDRVLDLFCGMGNF
RLMD_SHISS      ------LRLTFSPR--DFIQVNAGVNQKMVARALEWLDVQ-----PEDRVLDLFCGMGNF
RLMD_CITK8      ------LRLTFSPR--DFIQVNEGVNQKMVARALEWLDIQ-----PDDRVLDLFCGMGNF
RLMD_SALCH      ------LRLAFSPR--DFIQVNEAVNQQMVARALEWLDVR-----AEDRVLDLFCGMGNF
RLMD_SALTY      ------LRLAFSPR--DFIQVNEAVNQQMVARALEWLDVR-----AEDRVLDLFCGMGNF
RLMD_SALPA      ------LRLAFSPR--DFIQVNEAVNQQMVARALEWLDVR-----AEDRVLDLFCGMGNF
RLMD_SALTI      ------LRLTFSPR--DFIQVNEAVNQQMVARALEWLDVR-----AEDRVLDLFCGMGNF
RLMD_KLEP3      ------LRLVFSPR--DFIQVNDGVNQQMVRTALEWLDLQ-----PEDRVLDLFCGMGNF
RLMD_KLEP7      ------LRLVFSPR--DFIQVNDGVNQQMVRTALEWLDLR-----PEDRVLDLFCGMGNF
RLMD_ENT38      ------LRLTFSPR--DFIQVNDGVNQQMVAKAIEWLDVQ-----PDDRVLDLFCGMGNF
RLMD_CROS8      ------LRLTFSPR--DFIQVNDAVNQQMVARALEWLEIQ-----PGERVLDLFCGMGNF
RLMD_ERWT9      ------LTLTFSPR--DFIQVNDDVNQQMVARALAWLDLQ-----PEDRVLDLFCGMGNF
RLMD_PECAS      ------LTLAFSPR--DFIQVNDAVNQQMVAQALAWLDVQ-----SQDRILDLFCGMGNF
RLMD_PECCP      ------LTLAFSPR--DFIQVNDAVNQQMVAQALAWLDVQ-----PQDRILDLFCGMGNF
RLMD_YERE8      ------LRLAFHPR--DFIQVNDTVNQQMVAQAIAWLDVQ-----PDERVLDLFCGMGNF
RLMD_PHOLL      ------LKLVFSPR--DFIQVNDQVNQQMVAQAIEWLDLQ-----PNDNVLDLFCGMGNF
RLMD_EDWI9      ------SRLDFNPQ--DFIQVNAAVNAQMVGQALAWLDVR-----ADERVLDLFCGMGNF
RLMD_PROMH      ------LKLHFAPT--DFIQVNDEINHKMVAQAIAWLDLS-----PNDRVLDLFCGMGNF
RLMD_HAEIN      ------IKLHFDIR--DFIQVNSALNEPMVNTALDWLELS-----QQDCVLDLFCGMGNF
RLMD_HAEI8      ------IKLHFDIR--DFIQVNSALNERMINTALDWLELS-----QQDCVLDLFCGMGNF
RLMD_HAEP3      ------IRLSFDIR--DFIQVNTRLNQQMVETALDWLDLN-----QDDHVLDLFCGMGNF
RLMD_HAES1      ------SILHFDIR--DFIQVNRQLNQNMVNTALDWLDLK-----KKDNVLDLFCGMGNF
RLMD_MANSM      ------LQLQFDIR--DFIQVNSLLNQRMITAALDWLDVQ-----KQDHVLDLFCGMGNF
RLMD_PASMU      ------TKLQFDIR--DFIQVNAVVNQKMIDTALEWLELT-----SNDNVLDLFCGMGNF
RLMD_HAEDU      ------LTLHFCIR--DFIQVNQPLNQKMVNKALEWLAIT-----AEDRILDLFCGIGNF
RLMD_COLP3      ------SKVYFSSN--DFIQINHQVNNAMISQALAWLNIL-----ATDNVLDLFCGLGNF
RLMD_PSYIN      ------CSLSFTPT--DFLQVNSDINKKMVSQAMQWLALE-----KNDSVLDLFCGLGNF
RLMD_IDILO      ------DKLYFQPG--DFLQVNGGINQRMVQQAMDWLKPE-----KTQRVYDFFAGIGNF
RLMD_ALTMD      ------CSISPSAN--DFIQINKVVNEKMINQALVWLDPR-----PNERIADWFSGLGNF
RLMD_ALTNA      ------FYLQPGPN--DFVQVNAEVNTKMVAQALSWLAPK-----AGERIADWFSGLGNF
RLMD_DICNV      ------VTLHFTPD--DFIQVNASVNEALIQTVLAWLAPL-----EKSEVLDLFSGLGNF
RLMD_PSEAE      -----QLTLAYRPG--DFVQVNAPVNESMIRQALDWLAPT-----ADERVLDLFCGLGNF
RLMD_PSEAB      -----QLTLAYRPG--DFVQVNAPVNESMIRQALDWLAPT-----ADERVLDLFCGLGNF
RLMD_PSEE4      -----GMELAWRPG--DFVQVNAQVNTLMIQQALAWLAPQ-----AHERVLDLFCGLGNF
RLMD_PSEPK      -----QLELAWRPG--DFVQVNAQVNTAMIEQALAWLAPQ-----ADERVLDLFCGLGNF
RLMD_PSEF5      -----DLHLAYRPG--DFVQVNAGVNEAMVAQALEWLAPQ-----ADERVLDLFCGLGNF
RLMD_PSEPF      -----DLQLAYRPG--DFIQVNAGVNEAMVAQALEWLKPT-----ADERVLDLFCGLGNF
RLMD_PSE14      -----NLQLAWRPG--DFIQVNAAVNTAMIEQALQWLAPA-----KDERVMDLFCGLGNF
RLMD_PSEU2      -----NLQLAWRPG--DFIQVNASVNTAMIEQALQWLAPA-----KDERVMDLFCGLGNF
RLMD_PSESM      -----NLQLAWRPG--DFIQVNAAVNTAMIEQALHWLAPA-----ADERVMDLFCGLGNF
RLMD_ACIF2      -----RLRLRFDPL--VFTQVNQAANQVMVRRAMALLQPQ-----PGEHILDLFCGLGNF
RLMD_ACIF5      -----RLRLRFDPL--VFTQVNQAANQVMVRRAMALLQPQ-----PGEHILDLFCGLGNF
RLMD_ACIAC      -----GITMPFKPT--DFTQVNPHINRVLVTRALRLLDAG-----RTDRVIDWFCGLGNF
RLMD_ACISJ      -----GITMPFKPT--DFTQVNPHINRVLVTRALRLLDAR-----KDERVIDWFCGLGNF
RLMD_VEREI      -----GITMPFKPT--DFTQVNPHINRVLVARALRLLAVR-----PDERVIDWFCGLGNF
RLMD_RHOFT      -----GIHMPFKPT--DFTQVNPHINRVLVSRALRLLDAK-----RHERVIDWFCGLGNF
RLMD_POLNA      -----GITMPFKPT--DFTQVNPHINQVLVSRALRLLGVQ-----PTERVIDWFCGLGNF
RLMD_POLSJ      -----GITMPFKPT--DFTQVNPHINQVLVSRALRLLAVQ-----PHERVIDWFCGLGNF
RLMD_RUBGI      -----GVTMPFKPT--DFTQVNPQINRVLVDRAVRLLAPQ-----PHERIVDWFCGLGNF
RLMD_BORBR      -----GLRMPYRPT--DFTQVNHAINRAMVSRALKLLDVQ-----PQDRVADLFCGLGNF
RLMD_BORPA      -----GLRMPYRPT--DFTQVNHAINRAMVSRALKLLDVQ-----PQDRVADLFCGLGNF
RLMD_BORPE      -----GLRMPYRPT--DFTQVNHAINRAMVSRALKLLDVQ-----PQDRVADLFCGLGNF
RLMD_BORA1      -----GLRMPYRPT--DFTQVNHAINRSMVSRALKLLEVQ-----PTDRVADLFCGLGNF
RLMD_BURCA      -----GIRMPFKPT--DFTQVNHQINRVLVGRALRLLAPS-----RDDRVLDLFCGIGNF
RLMD_BURCH      -----GIRMPFKPT--DFTQVNHQINRVLVGRALRLLAPS-----RDDRVLDLFCGIGNF
RLMD_BURL3      -----GIRMPFKPT--DFTQVNHQINRVLVGRALRLLAPS-----RDDRVLDLFCGIGNF
RLMD_BURCM      -----GIRMPFKPT--DFTQVNHQINRVLVGRALRLLAPS-----RDDRVLDLFCGIGNF
RLMD_BURMA      -----GIRMPFKPT--DFTQVNHQINRVLVGRALRLLAPE-----RGDRVLDLFCGIGNF
RLMD_BURPS      -----GIRMPFKPT--DFTQVNHQINRVLVGRALRLLAPE-----RGDRVLDLFCGIGNF
RLMD_BURP1      -----GIRMPFKPT--DFTQVNHQINRVLVGRALRLLAPE-----RGDRVLDLFCGIGNF
RLMD_BURTA      -----GIRMPFKPT--DFTQVNHQINRVLVGRALRLLAPE-----RGDRVLDLFCGIGNF
RLMD_PARXL      -----GIRMPFKPT--DFTQVNHAINRVLVSRALRLLAPA-----RTDRVLDLFCGIGNF
RLMD_CUPNH      -----GIRMPFKPT--DFTQVNHQINRVLIGRALRLLDAQ-----PQDRLLDLFCGIGNF
RLMD_CUPMC      -----GIRMPFKPT--DFTQVNHQINRVLIGRALRLLDAK-----PTDRLLDLFCGIGNF
RLMD_CUPPJ      -----GIRMPFKPT--DFTQVNHHINRVLIGRALRLLDVQ-----PQDRLLDLFCGIGNF
RLMD_RALPJ      -----GITMPFKPT--DFTQVNHQINRVLMSRALKLLDAQ-----PGDRLLDLFCGIGNF
RLMD_RALSO      -----GITMPFKPT--DFTQVNHQINRVLMSRALKLLDAR-----PGDRLLDLFCGIGNF
RLMD_POLNS      -----EIEMPFKPC--DFTQVNHMMNRALVSRAIRLLEVQ-----PTDRVLDLFCGIGNF
RLMD_AZOSB      -----DVALDFRAT--DFTQVNVHINRLLIRRAMQLLQPA-----PGERIADLFCGLGNF
RLMD_AROAE      -----DVAMAFQPT--DFTQVNIDINRLLIRRSLQLLDPR-----PGERIADLFCGLGNF
RLMD_CHRVO      -----AVEMPYYPT--EFTQVNPQINAVMVARALKFLDPQ-----PGERIADMFCGIGNF
RLMD_METFK      -----NLTYPFKPT--EFTQVNPYINRVMLRRAMQLLQPQ-----PGERIADFFCGLGNF
RLMD_NITMU      -----DVTIPFHPT--EFTQVNPMVNRILVRRALNLLDPR-----RGERIADLFCGLGNF
RLMD_DECAR      -----GLEFDFKPT--DFTQVNHAVNRVLVRRALRLLDPQ-----PSERIADMFCGLGNF
RLMD_THIDA      -----GLVMPFRPT--EFTQVNSAINRALVSRALRLLDPR-----PGERIADLFCGLGNF
RLMD_NEIL0      -----GIEMPFRPG--DFTQINTDTNRLMVSRVVKMLDIR-----RGERIADLFCGLGNF
RLMD_ACIB3      -----DVNFAFSPL--DFTQVNATVNEQMVQLACELLQLQ-----QGERVLDLFCGLGNF
RLMD_ACIBY      -----DVNFAFSPL--DFTQVNATVNEQMVQLACELLQLQ-----QGERVLDLFCGLGNF
RLMD_ACIB5      -----DVNFAFSPL--DFTQVNATVNEQMVQLACELLQLQ-----QGERVLDLFCGLGNF
RLMD_ACIBC      -----DVNFAFSPL--DFTQVNATVNEQMVQLACELLQLQ-----QGERVLDLFCGLGNF
RLMD_ACIBS      -----DVNFAFSPL--DFTQVNATVNEQMVQLACELLQLQ-----QGERVLDLFCGLGNF
RLMD_ACIAD      -----NLNFAFSPL--DFTQVNATVNQQMLKLACDLLKLQ-----KGEHVLDLFCGLGNF
RLMD_PSYA2      -----DLTFEFIPT--DFTQVNLSVNRQMTKLACDLLDLK-----AGERVLDLFSGLGNF
RLMD_PSYCK      -----DLTFEFIPT--DFTQVNLSVNRQMTKLACDLLDLK-----AGERVLDLFSGLGNF
RLMD_ALCBS      -----GVELAFHPT--DFTQVNAEINRKMVPLALDLLDIS-----PDHTVLDLFCGLGNF
RLMD_MARHV      -----DLTMAFHPM--DFTQVNAGINRNMVHRAVEWLDVQ-----PGERVLDLFCGLGNF
RLMD_HAHCH      -----GLTMQFHPM--DFTQVNRDINRRMLAQALEWLQPQ-----AGETILDLFCGLGNF
RLMD_ALKEH      -----GVRLGFRPG--DFTQVNAEINRAMVDQALDLLAVE-----PGQRVLDLFCGLGNF
RLMD_METCA      -----EVTFRFGPL--DFTQVNMAINRQMIDQVMQALDPQ-----PEERVLDLFCGLGNF
RLMD_NITOC      -----KLEMIFLPT--DFTQVNREVNTKMVRRVLELLEIK-----SGERVLDLFCGIGNF
RLMD_STRMK      -----DVELAFRPL--DFIQVNAKLNEKMIAHALDLLEPG-----EDERVLDLFCGLGNF
RLMD_STRM5      -----DVELAFRPL--DFIQVNAKLNEKMIAHALDLLEPG-----EDERVLDLFCGLGNF
RLMD_XANAC      -----DVELAFRPL--DFIQVNASLNQKMIAHAVALLEAK-----PDDRVLDLFCGLGNF
RLMD_XANC5      -----EVELAFRPL--DFIQVNASLNQKMIAHAVALLEAK-----PDDRVLDLFCGLGNF
RLMD_XANOR      -----DVDLAFRPL--DFIQVNASLNQKMIVHALALLDAK-----PDDRVLDLFCGLGNF
RLMD_XANOM      -----DVDLAFRPL--DFIQVNASLNQKMIVHALALLDAK-----PDDRVLDLFCGLGNF
RLMD_XANCP      -----DVELAFRPL--DFIQVNASLNQKMIAHALALLDAK-----PDDRVLDLFCGLGNF
RLMD_XANC8      -----DVELAFRPL--DFIQVNASLNQKMIAHALALLDAK-----PDDRVLDLFCGLGNF
RLMD_XYLFA      -----DVEFVFRPL--DFIQINGGLNEKMIAHALDLLGAG-----FGERVLDLFCGLGNF
RLMD_XYLFT      -----DVEFVFRPL--DFIQINGGLNEKMIAHALDLLGAG-----FGERVLDLFCGLGNF
RLMD_FRATH      -----GIDIGFEPN--DFTQVNNDINKKMIKRAIELLDIS-----ENDSIIDLFCGLGNF
RLMD_FRATO      -----GIDIGFEPN--DFTQVNNDINKKMIKRAIELLDIS-----ENDSIIDLFCGLGNF
RLMD_FRATT      -----GIDIGFEPN--DFTQVNNDINKKMIKRAIELLDIS-----ENDSIIDLFCGLGNF
RLMD_FRAT1      -----GIDIGFEPN--DFTQVNNDINKKMIKRAIELLDIS-----ENDSIIDLFCGLGNF
RLMD_FRATN      -----GIDIGFEPN--DFTQVNNDINKKMIKRAIELLDIS-----ENDSIIDLFCGLGNF
RLMD_LEGPC      -----QITFQFHPN--DFTQVNAELNRKMVTQAIQLMELK-----NSDIVLDLFCGLGNF
RLMD_LEGPA      -----QITFQFHPN--DFTQVNAELNRKMVTQAIQLMELK-----NSDIVLDLFCGLGNF
RLMD_LEGPH      -----QITFQFHPN--DFTQVNAELNRKMVTQAIQLMELK-----NSDIVLDLFCGLGNF
RLMD_LEGPL      -----QITFQFHPN--DFTQVNAELNRKMVKQAIQLMELK-----NSDIVLDLFCGLGNF
RLMD_VESOH      -----NIIMEFLPT--DFVQVNFKLNQQMVSLAVELLELN-----ESDKVIDLFCGLGNF
                                 * * *   *  :       :              * *.* ***

RLMD_CHRSD      TLALA-----PRVASITGIEGSPAMVERLADNAR-RAG-------LHQVGAQ------QS
RLMD_HALED      SLPLA-----TQGAEVSAVEGSTAMVERLAGNAA-RNQ-------VAVTARQA-DLN-DA
RLMD_CELJU      TLPMA-----SRVARVIGLEVVEPMVTRAQANAT-RLG-------LDNLEFLKADLS-QM
RLMD_MARPP      SLPLA-----QLAGSVIGVELQESMVQAGRHNAS-LNG-------LKNLSFVAADLT-QP
RLMD_MARMS      SLPLA-----VHAQAVIGVEVQETMVEAARENAR-VNG-------FDNLSFVAADLT-KP
RLMD_MARM1      SLPLA-----RRAGEVLGVEGLETMVEFARLNAQ-END-------LDNVQFIAADLT-KP
RLMD_HYDCU      TLPIA-----QQVKEVVGIEGETDLVQMAQHNAS-RAH-------CEQATFYQADLF-KD
RLMD_AERHH      TLPLA-----RQAREVVGVEGELAMVARAEENAR-RNG-------INNARFYKADLG--G
RLMD_AERS4      TLPLA-----RQAREVVGVEGDLAMVARAEENAR-RNG-------IDNARFYKADLS--G
RLMD_TOLAT      TLPLA-----REAASVTGIEGVDEMVQRATHNAE-QNQ-------LVNTGFHRADLTKMA
RLMD_PSEHT      SLVLA-----KQAKTVIGVEGVASAVAMATQNAH-TNS-------ITNAQFNCFDLT--N
RLMD_SHEB9      SLPLA-----KMGADVIGVEGVAEMVTQARVNAK-ANN-------LDKLTFYHGDLS--A
RLMD_SHEB2      SLPLA-----KMGADVIGVEGVAEMVTQARVNAK-ANN-------LDKLTFYHGDLS--A
RLMD_SHEB8      SLPLA-----KMGADVIGVEGVAEMVTQARVNAK-ANN-------LDKLTFYHGDLS--A
RLMD_SHEB5      SLPLA-----KMGADVIGVEGVAEMVTQARVNAK-ANN-------LDKLTFFHGDLS--A
RLMD_SHEPC      SLPLA-----KMGADVIGVEGVAEMVSQARVNAK-ANN-------LDKLTFYHGDLS--A
RLMD_SHESW      SLPLA-----KMGADVIGVEGVAEMVSQARVNAK-ANN-------LDKLTFYHGDLS--A
RLMD_SHESM      SLPLA-----KLGAEVIGVEGVPDMVSQARENAA-ANG-------LSNLTFYHGDLS--A
RLMD_SHESR      SLPLA-----KLGAEVIGVEGVPEMVSQARENAA-ANG-------LSNLTFYHGDLS--A
RLMD_SHESA      SLPLA-----KLGAEVIGVEGVPEMVSQARENAA-ANG-------LSNLTFYHGDLS--A
RLMD_SHEON      SLPLA-----RMGADVIGVEGVPEMVSQARENAV-ANG-------LSNLTFYHGDLS--A
RLMD_SHESH      SLPLA-----KSGAEVIGVEGVPEMVKQARENAA-DSG-------LDNVSFFHTDLS--A
RLMD_SHEWM      SLPLA-----KSGAEVIGVEGVPEMVAQARINAK-QSD-------LSDVTFFHTDLS--A
RLMD_SHEHH      SLPLA-----KDGAEVIGVEGVQAMVEQARINAK-QSG-------LDKVSFYHADLS--A
RLMD_SHEPA      SLPLA-----KDGAEVIGVEGVVAMVEQARVNAK-QSG-------LDKVAFYHADLS--A
RLMD_SHEPW      SLPLA-----KSGAEVIGVEGVPAMVEQATVNAK-GAA-------LDKVSFYHADLS--A
RLMD_SHEDO      SLALANRGQNLDGLEVIGVEGVPEMVQQARENAK-RNN-------LANLSFYHADLS--A
RLMD_SHEFN      SLPLA-----LKAAEVIGVEGVPEMVQQAKQNAI-DNQ-------LDNVTFYHADLS--A
RLMD_SHEAM      SLPLA-----KQGAEVVGVEGVPEMVAQAKQNAA-ING-------LDNLSFYCADLS--E
RLMD_FERBD      TLALA-----GQSAEIIGVEGVPAMVERARARAA-ELG-------LEQLRFEYADLN--G
RLMD_ALIF1      SLPLA-----KKVKTVVGIEGVDEMVQRAKLNAE-RNQ-------LSNVSFYQANLE-EE
RLMD_ALIFM      SLPLA-----KKVKTVVGIEGVDDMVQRAKLNAE-RNH-------LSNVSFYQANLE-EE
RLMD_ALISL      SLPLA-----QKVKTVVGIEGVEEMVKRAQSNAK-RNE-------LDNVTFYQANLE-EP
RLMD_PHOPR      SLPLA-----KHAKAVVGVEGIDEMVHRATENAM-CNK-------QNNATFYQANLD-ED
RLMD_VIBCH      TLPLA-----KQAQAVVGVEGVDEMVQHATHNAK-LNQ-------INNVAFYQANLE-QD
RLMD_VIBCM      TLPLA-----KQAQAVVGVEGVDEMVQHATHNAK-LNQ-------INNVAFYQANLE-QD
RLMD_VIBC3      TLPLA-----KQAQAVVGVEGVDEMVQHATHNAK-LNQ-------INNVAFYQANLE-QD
RLMD_VIBCB      SLPIA-----KRAKHVVGVEGVAEMVEKAVNNAS-LNQ-------INNARFYHANLE-QD
RLMD_VIBPA      SLPIA-----KRAKHVVGVEGVAEMVEKASNNAS-LNQ-------INNAQFYHANLE-QD
RLMD_VIBVU      SLPIA-----SKAKSVTGVEGVDEMVQKAAINAS-LNQ-------INNAQFFHANLE-QD
RLMD_VIBVY      SLPIA-----SKAKSVTGVEGVDDMVQKAALNAS-LNQ-------INNAQFFHANLE-QD
RLMD_VIBTL      SLPIA-----QQSAFVVGVEGVDEMVQQATANAA-LNQ-------LSNTEFYQANLE-ED
RLMD_SHIFL      TLPLA-----TQAASVVGVEGVPALVEKGQQNAR-LNG-------LQNVTFYHENLE-ED
RLMD_SHIF8      TLPLA-----TQAASVVGVEGVPALVEKGQQNAR-LNG-------LQNVTFYHENLE-ED
RLMD_ECOLI      TLPLA-----TQAASVVGVEGVPALVEKGQQNAR-LNG-------LQNVTFYHENLE-ED
RLMD_ECOUT      TLPLA-----TQAASVVGVEGVPALVEKGQQNAR-LNG-------LQNVTFYHENLE-ED
RLMD_ECOK1      TLPLA-----TQAASVVGVEGVPALVEKGQQNAR-LNG-------LQNVTFYHENLE-ED
RLMD_ECOL6      TLPLA-----TQAASVVGVEGVPALVEKGQQNAR-LNG-------LQNVTFYHENLE-ED
RLMD_ECOL5      TLPLA-----TQAASVVGVEGVPALVEKGQQNAR-LNG-------LQNVTFYHENLE-ED
RLMD_ECO57      TLPLA-----TQAASVVGVEGVPALVEKGQQNAR-LNC-------LQNVTFYHENLE-ED
RLMD_SHIBS      TLPLA-----TQAASVVGVEGVPALVEKGQQNAR-LNG-------LQNVTFYHENLE-ED
RLMD_SHIDS      TLPLA-----TQAASVVGVEGVPALVEKGQQNAR-LNG-------LQNVTFYHENLE-ED
RLMD_SHISS      TLPLA-----TQAASVVGVEGVPALVEKGQQNAR-LNG-------LQNVTFYHENLE-ED
RLMD_CITK8      TLPLA-----TRAASVVGVEGVPALVEKGRENAR-RNG-------LQNVTFFHENLE-ED
RLMD_SALCH      TLPLA-----TRAASVVGVEGVPALVEKGRENAI-RNG-------LHNVTFFHENLE-ED
RLMD_SALTY      TLPLA-----TRAASVIGVEGVPALVEKGRENAI-RNG-------LHNVTFFHENLE-ED
RLMD_SALPA      TLPLA-----TRAASVVGVEGVPALVEKGRENAI-RNG-------LHNVTFFHENLE-ED
RLMD_SALTI      TLPLA-----TRAASVVGVEGVQALVEKGRENAI-RNG-------LHNVTFFHENLE-ED
RLMD_KLEP3      TLPLA-----TRAAHVVGVEGVPALVEKGRENAA-LNG-------LSNVTFFHENLE-ED
RLMD_KLEP7      TLPLA-----TRAAHVVGVEGVPALVEKGRENAA-RNG-------LSNVTFFHENLE-ED
RLMD_ENT38      TLPLA-----QRAASVVGVEGVNALVEKGQQNAH-HNA-------LDNVTFFHENLE-ED
RLMD_CROS8      TLPLA-----RRAESVVGVEGVAALVEKGDYNAG-LNA-------LKNVTFFQHNLE-ED
RLMD_ERWT9      TLPMG-----KFAKNVVGVEGVAALVAKAGYNAE-LNC-------LNNVAFWQHNLE-ED
RLMD_PECAS      TLPLA-----QRAASVVGVEGVTALVEKGRENAR-RNA-------LSNVTFFHQNLE-DD
RLMD_PECCP      TLPLA-----QRAASVVGVEGVTALVEKGRENAR-RNA-------LSNVTFFHQNLE-DD
RLMD_YERE8      TLPLA-----KLAREVVGVEGVAALVANGQYNAL-NNA-------LPNVSFFHENLE-SD
RLMD_PHOLL      TLPIG-----RIVQSVVGVEGVATLVANGQYNAK-INN-------LDNISFCHENLE-AD
RLMD_EDWI9      TLPLA-----RLALRVVGVEGVPGLVATAQNNAR-NNG-------LSNVEFFHQNLE-ED
RLMD_PROMH      TLPMA-----KRVDKVVGVEGVPALVAMAKKNAE-LNQ-------LDNVQFWHADLS-AD
RLMD_HAEIN      TLPLA-----KRVKSAVGIEGVFEMVQKAAQNAE-RNQ-------IKNIEFFQADLD-QS
RLMD_HAEI8      TLPLA-----KRVKSAVGIEGVFEMVQKAAQNAA-RNQ-------IKNIEFFQADLD-QS
RLMD_HAEP3      TLPLA-----KRVKSAVGIEGVLDMVKKAQANAQ-FNH-------IENVEFYQADLD-QS
RLMD_HAES1      TLPIS-----RYVKSAVGIEGVLPMVEKARRNGE-RNH-------CHNVQFYQCDLS-QS
RLMD_MANSM      TLPLS-----RRVKSAVGIEGISAMVEKAKANAE-RNQ-------CQNVQFYRADLD-QN
RLMD_PASMU      TLPIS-----RQVNQVVGIEGVGEMVEKAKRNAE-QNQ-------CDNVQFYQANLD-QP
RLMD_HAEDU      SLPIA-----QQAGFVVGVEGVEEMVKQAKINQQ-TSG-------LNNIAFYQTNLA-ES
RLMD_COLP3      SLALA-----KHAKRVVGVEGMQTMVDKATQNSL-VNG-------LDNCQFYQADLN-SH
RLMD_PSYIN      TLPIA-----RQVESVVGIEGVQQMVDRATANAQ-LNN-------LQNARFYQADLS-GE
RLMD_IDILO      SLPLA-----RRAQSVLAVEGVYRMAEQTRINAE-SNG-------MDNLSSLSADLN---
RLMD_ALTMD      TLPIA-----KKGALVQAIEGVAEMVLRAKDNAQ-QQG-------IENVEWLHLDLA--N
RLMD_ALTNA      TLPIA-----NSGATVSAVEGVAEMVQRAKSNAL-EQG-------ITNVDWMQLDLA--D
RLMD_DICNV      SLPLA-----YKGARVTAVEGVRAMVQRGAKMAA-EQQL------SSRLEMQCMDLF--S
RLMD_PSEAE      SLPLA-----RRVARVVGVEGVAAMVERAGANAL-ANG-------LGNAHFFQADLS--K
RLMD_PSEAB      SLPLA-----RRVARVVGVEGVAAMVERAGANAL-ANG-------LGNAHFFQADLS--K
RLMD_PSEE4      ALPLA-----RQAREVVAVEGVQAMVERAEANAH-GNN-------VYNARFFQADLS--Q
RLMD_PSEPK      ALPLA-----RQAREVVAVEGVQAMVDRAAANAR-NNN-------VHNARFFQADLS--Q
RLMD_PSEF5      ALPLA-----RQVREVVAVEGVATMVARAAENAA-SNN-------LHNTRFFQADLS--Q
RLMD_PSEPF      ALPLA-----KAAREVVAVEGVQTMVDRAAANAA-SNN-------LHNTKFFQADLS--Q
RLMD_PSE14      ALPLA-----GLAREVVAVEGVATMVERAAVNAM-SND-------LHNVQFFQADLS--Q
RLMD_PSEU2      ALPLA-----GLARDVVAVEGVATMVERAAVNAM-SND-------LHNVRFFQADLS--Q
RLMD_PSESM      ALPLA-----SLAKDVVAVEGVATMVERAAVNAM-SND-------LHNVRFFQADLS--Q
RLMD_ACIF2      TLPIARL--GAQ---VLGIEGDARLVALAAENAAANGLA-------DKARYAVADLT-QA
RLMD_ACIF5      TLPIARL--GAQ---VLGIEGDARLVALAAENAAANGLA-------DKARYAVADLT-QA
RLMD_ACIAC      TLPIATQ--ARE---VVGIEGSEALVARSRENYRKNQDDRPQGQALAPATFVARNLF-EM
RLMD_ACISJ      TLPIATQ--ARE---VLGIEGSEALVARSRENYQSNQAQRQDGSALAATSFVARNLF-EM
RLMD_VEREI      TLPLATQ--ARA---VLGVEGNAALVARARANHGLNQALAQNHRVLAATDFVACNLF-AM
RLMD_RHOFT      TLPIATQ--ARE---VLGVEGSEALVARSRQNFKLNQALAPVNKSLAATNFVARNLF-EM
RLMD_POLNA      TLPLATR--ARE---VLGIEGSEVLVARSRENYERNKASSHVRPALEATKFVARNLF-EM
RLMD_POLSJ      TLPLATC--ARE---VLGIEGSEALVARSCQNFKKNQPASQSRSALSATEFVARNLF-EM
RLMD_RUBGI      TLPLARR--AAA---VHGIEGSETLVQRARENAAANGLA-------ANTSFAARNLF-EM
RLMD_BORBR      TLPLATQ--GRE---AVGVEGSKALTDRAHEAAARHGLG-------ERTRFATLNLF-EV
RLMD_BORPA      TLPLATQ--GRE---AVGVEGSKALTDRAHEAAARHGLG-------ERTRFATLNLF-EV
RLMD_BORPE      TLPLATQ--GRE---AVGVEGSKALTDRAHEAAARHGLG-------ERTRFATLNLF-EV
RLMD_BORA1      TLPLATQ--GRE---AVGVEGSKALTDRALEAAARHGLE-------GRTRFATLNLF-EV
RLMD_BURCA      TLPLARL--SRE---VMGIEGSDTLTTRALANARENGVD-------GHTTFACRNLF-EV
RLMD_BURCH      TLPLARL--SRE---VMGIEGSDTLTTRALANARENGVD-------GHTTFACRNLF-EV
RLMD_BURL3      TLPLARL--SRE---VMGIEGSDTLTTRALANARENGVD-------GHTTFACRNLF-EV
RLMD_BURCM      TLPLARL--SRE---VMGIEGSDTLTTRALANARENGVD-------GHTTFACRNLF-EV
RLMD_BURMA      TLPLARL--ARE---VVGIEGSDALTARALENAKENGVD-------GHTSFACRNLF-EV
RLMD_BURPS      TLPLARL--ARE---VVGIEGSDALTARALENAKENGVD-------GHTSFACRNLF-EV
RLMD_BURP1      TLPLARL--ARE---VVGIEGSDALTARALENAKENGVD-------GHTSFACRNLF-EV
RLMD_BURTA      TLPLARL--ARE---VVGIEGSETLTSRALANAKENGVD-------GHTSFASRNLF-EV
RLMD_PARXL      TLPLARI--SKE---VMGIEGSEVLTSRALANAGLNGVA-------GHTSFECRNLF-EV
RLMD_CUPNH      TLPLATQ--GKS---VMGIEGSEALTTRALANAEYNGLA-------ARTEFACRNLF-EV
RLMD_CUPMC      TLPLATQ--GAS---VMGIEGSEVLTTRALANAEYNGLA-------AKTSFACRNLF-EV
RLMD_CUPPJ      TLPLATQ--GRS---VMGIEGSEALTTRALANAGYNGLA-------EKTEFACRNLF-EV
RLMD_RALPJ      TLPMATR--ARE---VMGIEGSEALTTRALANAQHNGLH-------TKTSFACRNLF-EV
RLMD_RALSO      TLPMATR--GCE---VMGIEGSEALTTRALANAQHNGLD-------GKTTFACRNLF-EV
RLMD_POLNS      TLPLARK--AKQ---VLGIEGLESLTARAKSNAQHNGLS-------DKASFMQSDLF-EV
RLMD_AZOSB      SLPIARR--GAT---VVGVEGSEALVARALENARRNGLDS-------RTEFHAANLF-DA
RLMD_AROAE      SLPIARC--GAT---VVGVEGSESLVRRAAKNARRNGLHG-------RSEFHAANLF-EA
RLMD_CHRVO      TLPIARS--GAV---VHGMEGSQPLVRRAVENATHNGLQD-------KVSYEMANLF-DV
RLMD_METFK      TLPIARS--GAS---VFGMEGSAALVARANESAALNSLAG-------QVEFQEADLF-KM
RLMD_NITMU      TLPVARR--GAQ---VVGYEGSAALVSRARQNSQRNGLAG-------STRFMEANLF-EI
RLMD_DECAR      TLPIARS--GAT---VIGVEGSAALVRRGRESAAANGLAD-------HVEFGVANLF-EC
RLMD_THIDA      TLPIAHR--GAD---VLGIEGSTELVARARENALRNALP--------HARFEVDNLF-EM
RLMD_NEIL0      SLPMAKS--GAD---VVGIEGAENLVRRARQNARLNGCDR-------QTDFIAANLF-DC
RLMD_ACIB3      SLPLARC--VGAKGQVVGVEASEEMVQRATDNAKRNNLV--------QASFFSQDLT-KD
RLMD_ACIBY      SLPLARC--VGAKGQVVGVEASEEMVQRATDNAKRNNLV--------QASFFSQDLT-KD
RLMD_ACIB5      SLPLARC--VGAKGQVVGVEASEEMVQRATDNAKRNNLV--------QASFFSQDLT-KD
RLMD_ACIBC      SLPLARC--VGAKGQVVGVEASEEMVQRATDNAKRNNLV--------QASFFSQDLT-KD
RLMD_ACIBS      SLPLARC--VGAKGVIVGVEASEEMVQRATDNVKRNNLV--------QASFFSQDLT-KD
RLMD_ACIAD      SLPLARC--VGDTGRVVGVEGSEEMVQRAFENAAQNALH--------NVEFYSQDLT-KD
RLMD_PSYA2      SLPLARL--VGETGSVVGVEGSEAMTIRAADNARRNGIN--------NTEFYSQDLT-HD
RLMD_PSYCK      SLPLARL--VGETGSVVGVEGSEAMTARAADNARRNGIN--------NTEFYSQDLT-HD
RLMD_ALCBS      TIPAAKR--AGK---VVGVEVSQAMVERGYENARRNSLE--------NLEFHAWDLS-QD
RLMD_MARHV      TLPLARK--GGQ---VVGVEGDDAMVVRGRENARLNDLS--------NVEFHGADLH-GD
RLMD_HAHCH      TLPIARS--AAH---VVGVEGSEDMVRRGYANAELNGIS--------NVEFHAADLH-LP
RLMD_ALKEH      TLPLARR--ASE---VVGVEGAEALVERGRENALRNGLD--------NVRFYGADLT-LA
RLMD_METCA      TLPLARR--AGH---VTGVEGGAEAVARAIRNAADNGIG--------NVEFHVADLS-KP
RLMD_NITOC      TLPLAIA--GAE---VVGIEGNAGLVARAVANATHNRLE--------NAYFEMADLN-GA
RLMD_STRMK      TLPLARR--VRE---VVGVEGDAGLVARARENAVRNGLA--------NAQFFSADLT-QD
RLMD_STRM5      TLPLARR--VRE---VVGVEGDAGLVARARENAERNGLA--------NAQFFSADLT-QD
RLMD_XANAC      TLPLARV--VRE---VVGVEGDAGLVARAKENAQRNGLD--------NAQFYAADLT-QD
RLMD_XANC5      TLPLARV--VRE---VVGVEGDAGLVARAKENAQRNGLD--------NAQFHAADLT-QD
RLMD_XANOR      TLPLARV--VRE---VVGVEGDAGLVARAKDNAQRNGLD--------NAQFYAADLT-QD
RLMD_XANOM      TLPLARV--VRE---VVGVEGDAGLVARAKDNAQRNGLD--------NAQFYAADLT-QD
RLMD_XANCP      TLPLART--VRE---VVGVEGDAGLVARARENAQRNGLD--------NAQFYAADLT-QD
RLMD_XANC8      TLPLART--VRE---VVGVEGDAGLVARARENAQRNGLD--------NAQFYAADLT-QD
RLMD_XYLFA      TLPLART--VDE---VVGVEGDIGLVERARENARRNGLG--------NAEFFVADLT-RD
RLMD_XYLFT      TLPLART--VGE---VVGVEGDIGLVERARENARRNGLG--------NAEFFVADLT-RD
RLMD_FRATH      TLPISQH--AKT---VIGVEGEPTMVKRAKETADNNNIT--------NVNFYAANLF-ES
RLMD_FRATO      TLPISQH--AKT---VIGVEGEPTMVKRAKETADNNNIT--------NVNFYAANLF-ES
RLMD_FRATT      TLPISQH--AKT---VIGVEGEPTMVKRAKETADNNNIT--------NVNFYAANLF-ES
RLMD_FRAT1      TLPISQH--AKT---VIGVEGEPTMVKRAKETADNNNIT--------NVNFYAANLF-ES
RLMD_FRATN      TLPISQH--AKT---VIGVEGEPTMVKRAKETADNNNIT--------NVNFYAANLF-ES
RLMD_LEGPC      SLPMAKH--CSR---VIGVEGNKNMVERAYMNAKSNHIT--------NVDFYAANLD-DV
RLMD_LEGPA      SLPMAKH--CSR---VIGVEGNKNMVERAYMNAKSNHIT--------NVDFYAANLD-DV
RLMD_LEGPH      SLPMAKH--CSR---VIGVEGNKNMVERAYMNAKSNHIT--------NVDFYAANLD-DV
RLMD_LEGPL      SLPMAKH--CSR---VIGVEGNRNMVERAYMNAKSNHIT--------NVDFYAANLD-DV
RLMD_VESOH      TLPIARY--AKY---VVGIEGDLGLVERAKYNAEKNSIN--------NVDFYRSDLC-KE
                ::  .            . *     .                                  

RLMD_CHRSD      DLATQVPEVAA----VDWVIMDPPRGGAEALCRALADS----------------------
RLMD_HALED      EACRRLLATTA----PEVLVLDPPRSGAEALCRQLVEH----------------------
RLMD_CELJU      DSPRLRQLCSQ----ASAILLDPPRDGAKELVTQLRDLRRKGQL----------------
RLMD_MARPP      VAGQFSA--EN----INKILLDPPRAGAFEFLDTIIHIA---------------------
RLMD_MARMS      VNNELFK--QT----ITKVLLDPPRAGAFEFLDSIIKIG---------------------
RLMD_MARM1      APKVLKS--KK----VTKVLLDPPRSGAFEFLETLVKFK---------------------
RLMD_HYDCU      VTPQNWFRKQK----YDRVLLDPGRQGAYQLCKGLGQLK---------------------
RLMD_AERHH      DIAGMSWAREG----FDLVLLDPARPGAFEVMEHVVKLSPRR------------------
RLMD_AERS4      DIVGMSWAREG----FDLVLLDPARPGALEVMGHVVKLSPKR------------------
RLMD_TOLAT      EYANAGWQQQC----YDLVLLDPGRTGAEAVMPWLAKSGARR------------------
RLMD_PSEHT      KIETASWFNKN----LDVLVLDPSRTGAITVLEQLPLKQFKT------------------
RLMD_SHEB9      DLSLEPWMGK-----IDKLLLDPARAGAFESLQWLKKMKPRK------------------
RLMD_SHEB2      DLSLEPWMGK-----IDKLLLDPARAGAFESLQWLKKMKPRK------------------
RLMD_SHEB8      DLSLEPWMGK-----IDKLLLDPARAGAFESLQWLKKMKPRK------------------
RLMD_SHEB5      DLSLEPWMGK-----IDKLLLDPARAGAFESLQWLKKMKPRK------------------
RLMD_SHEPC      DLSLEPWMGK-----IDKLLLDPARAGAFESLQWLKKMKPRK------------------
RLMD_SHESW      DLSLEPWMGK-----IDKLLLDPARAGAFESLQWLKKMKPRK------------------
RLMD_SHESM      DLSCEPWMGK-----IDKLLLDPARAGAFESLQWLKKMKPRQ------------------
RLMD_SHESR      DLSCEPWMGK-----IDKLLLDPARAGAFESLQWLKKMKPRQ------------------
RLMD_SHESA      DLSCEPWMGK-----IDKLLLDPARAGAFESLQWLKKMKPRQ------------------
RLMD_SHEON      DLSSEPWMGK-----IDKLLLDPARAGAYESLQWLKKMKPRQ------------------
RLMD_SHESH      DLSKETWLGK-----VDKLLLDPARAGAFESLQWLKKMKPKA------------------
RLMD_SHEWM      DLSKEPWLGK-----VDKLLLDPARAGAFESLQWLKKMKPKS------------------
RLMD_SHEHH      DLSKEPWLGK-----VDKMLIDPARAGAYESMQSLKKLKPKA------------------
RLMD_SHEPA      DLSKEPWLGK-----VDKMLIDPARAGAYESMQSLKKLKPKA------------------
RLMD_SHEPW      DLSQQPWLGK-----VDKMLIDPARAGAYESMLSLKKLKPQA------------------
RLMD_SHEDO      DLSNEKWLGK-----IDKLLLDPARAGAFESLQWLQKMKPKK------------------
RLMD_SHEFN      DLSTQTWLGK-----IDKLLLDPARAGAFESLQWLQKMQPKK------------------
RLMD_SHEAM      DLAAEPWLGK-----IDKLLLDPARAGAYESLKWLKKMKPAK------------------
RLMD_FERBD      EAPKAQWLKD-----VDWVLLDPARAGAPGVMEWLAKLRPSR------------------
RLMD_ALIF1      -VSEQVWASTK----FTKILLDPARAGAAGVMETVAKLKPQT------------------
RLMD_ALIFM      -ASDQVWASTK----FTKILLDPARAGAAGVMETVAKLKPQT------------------
RLMD_ALISL      -IDQQVWASTK----FTKILLDPARAGAAGVMQTVAKLKPET------------------
RLMD_PHOPR      -VTKLAWAREP----FNKILLDPARAGAAGVMEHVVKLKPER------------------
RLMD_VIBCH      -MTSASWAQQK----FAKVLLDPARAGAEGIVDQLSALGAKR------------------
RLMD_VIBCM      -MTSASWAQQK----FAKVLLDPARAGAEGIVDQLSALGAKR------------------
RLMD_VIBC3      -MTSASWAQQK----FAKVLLDPARAGAEGIVDQLSALGAKR------------------
RLMD_VIBCB      -FEGQVWAAEQ----FDKVLLDPARAGASGIIDQVSVLGARR------------------
RLMD_VIBPA      -FDGQAWAAEK----FDKVLLDPARAGASGIIDQVSALGAQR------------------
RLMD_VIBVU      -FVGQPWASEK----FDKILLDPARAGASGIIEQVSALGAKR------------------
RLMD_VIBVY      -FVGQPWASEK----FDKILLDPARAGASGIIEQVSALGAKR------------------
RLMD_VIBTL      -LSSQLWAKEK----FDKVLLDPARAGASGIVDQISALGAKR------------------
RLMD_SHIFL      -VTKQPWAKNG----FDKVLLDPARAGAAGVMQQIIKLEPIR------------------
RLMD_SHIF8      -VTKQPWAKNG----FDKVLLDPARAGAAGVMQQIIKLEPIR------------------
RLMD_ECOLI      -VTKQPWAKNG----FDKVLLDPARAGAAGVMQQIIKLEPIR------------------
RLMD_ECOUT      -VTKQPWAKNG----FDKVLLDPARAGAAGVMQQIIKLEPIR------------------
RLMD_ECOK1      -VTKQPWAKNG----FDKVLLDPARAGAAGVMQQIIKLEPIR------------------
RLMD_ECOL6      -VTKQPWAKNG----FDKVLLDPARAGAAGVMQQIIKLEPIR------------------
RLMD_ECOL5      -VTKQPWAKNG----FDKVLLDPARAGAAGVMQQIIKLEPIR------------------
RLMD_ECO57      -VTKQPWAKNG----FDKVLLDPARAGAAGVMQQIIKLEPIR------------------
RLMD_SHIBS      -VTKQPWAKNG----FDKVLLDPARAGAAGVMQQIIKLEPIR------------------
RLMD_SHIDS      -VTKQPWAKNG----FDKVLLDPARAGAAGVMQQIIKLEPIR------------------
RLMD_SHISS      -VTKQPWAKNG----FDKVLLDPARAGAAGVMQQIIKLEPIR------------------
RLMD_CITK8      -VTKQQWAKNG----FDKILLDPARAGAAGVMKHIIKLKPIR------------------
RLMD_SALCH      -VTKQPWAKNG----FDKVLLDPARAGATGVMRHIIKLKPIR------------------
RLMD_SALTY      -VTKQPWAKNG----FDKVLLDPARAGATGVMRHIIKLKPIR------------------
RLMD_SALPA      -VTKQPWAKNG----FDKVLLDPARAGATGVMRHIIKLKPIR------------------
RLMD_SALTI      -VTKQPWAKNG----FDKVLLDPARAGATGVMRHIIKLKPIR------------------
RLMD_KLEP3      -VTRQAWAKHG----FDKVLLDPARAGAPGVMPHIIKLAPRR------------------
RLMD_KLEP7      -VTRQAWAKHG----FDKVLLDPARAGAPGVMPHIIKLAPRR------------------
RLMD_ENT38      -VTQQPWAQHG----FDKVLLDPARAGAPGVMQHIIKLAPKR------------------
RLMD_CROS8      -VTRQPWAQQG----FDKVLLDPARAGAAGVMQHIVKLKPRR------------------
RLMD_ERWT9      -VSRQPWAVEG----FNKVLLDPARAGAAGVMAHIIKIAPQR------------------
RLMD_PECAS      -VTQQPWAAQG----FDKILLDPARAGAAGVMEQITRLAPKR------------------
RLMD_PECCP      -VTQQPWVAQG----FDKILLDPARAGAAGVMEQITRLAPKR------------------
RLMD_YERE8      -ISRQPWATQG----FDKVLLDPARAGAAGVMSHIVKLAPKR------------------
RLMD_PHOLL      -IHHQPWAKLG----FNKVLLDPARAGAVGVMSHIVELVPEK------------------
RLMD_EDWI9      -VTRQAWASQG----FDKILLDPARAGAPGVMQHIVRLAPRR------------------
RLMD_PROMH      -FSAMPWAQEG----FNKVLLDPARAGAAQVMSHIVTLSAEK------------------
RLMD_HAEIN      -FVEQPWANQS----FNKILLDPPRSGAAFALNALCELKAEK------------------
RLMD_HAEI8      -FVEQPWANQS----FNKILLDPPRSGAAFALNALCELKAEK------------------
RLMD_HAEP3      -FSEQPWSKQH----FNKILLDPPRSGAAFALNALCELGAES------------------
RLMD_HAES1      -FTEQEWAKVP----FDKILLDPPRSGAAFALNALCYLMAEK------------------
RLMD_MANSM      -FADEVWATEP----FNKILLDPPRTGAAFALNALCRLKAEK------------------
RLMD_PASMU      -FVQQHWASQH----FNKILLDPPRTGAAFALHALCELGAEK------------------
RLMD_HAEDU      -FVDQHWATQP----FNKVLLDPARQGALFCLDHLMALTPER------------------
RLMD_COLP3      WLLEPWVQGQV----FDKVLLDPARAGAEQAVSQIAELKIPC------------------
RLMD_PSYIN      NLIEQEWANQN----FNKVLLDPARAGALDCLAFIAQKKPSH------------------
RLMD_IDILO      -EITASDLGKP----ADLWCLDPARPGAEGVVKLLHKLKPEHR-----------------
RLMD_ALTMD      KANVEASLQQG----FDKVLLDPSREGALTVCHALVKALPKT------------------
RLMD_ALTNA      EKSVDKALAGG----FDKVLLDPSREGALTVCHALVRATPNT------------------
RLMD_DICNV      VSAAQMKSWQS----AKSWLLDPPRAGAHAVVQALPKKFPEK------------------
RLMD_PSEAE      ALAEAPWAEQG----FTAVLLDPPRDGAFEAVREMSSLGARR------------------
RLMD_PSEAB      ALAEAPWAEQG----FTAVLLDPPRDGAFEAVREMSSLGARR------------------
RLMD_PSEE4      PLAGAEWVAEG----FSAVLLDPPRDGAYEVVQGIARLGAKR------------------
RLMD_PSEPK      PLAGTGWAAEG----FSAVLLDPPRDGAFEVVQGIARLKARR------------------
RLMD_PSEF5      PLSAAEWADEG----FSAVLLDPPRDGAFEVVRQLATLGAKR------------------
RLMD_PSEPF      PLTDAEWIGNG----FSAVLLDPPRDGAFEVVRKLAALGAKR------------------
RLMD_PSE14      PLTHADWAAEG----FSTVLLDPPRDGAFEVVRQIRKTGARR------------------
RLMD_PSEU2      PLTQADWAAEG----FSAVLLDPPRDGAFEVVRQIRKTGARR------------------
RLMD_PSESM      PLTHADWAAEG----FSAVLLDPPRDGAFEVVRQIRKTGAQR------------------
RLMD_ACIF2      RMEDFAPAGA-----IDKMLIDPPRSGAIEVLRSLTP-----------------------
RLMD_ACIF5      RMEDFAPAGA-----IDKMLIDPPRSGAIEVLRSLTP-----------------------
RLMD_ACIAC      TPEMLIADGV-----ADKWLVDPPREGAFALAKALADIHQARIG----AEDAPALPASAE
RLMD_ACISJ      TPEMLIADGA-----SDKWLVDPPREGAFALSKALADIHQARIG----AEDAPPLPAGHE
RLMD_VEREI      TPGMLLGHGA-----ADKWLVDPPREGALALVKALADIEQSRRG----AQGATALPAGAE
RLMD_RHOFT      TPELLIQDGA-----ADKWLVDPPREGAVSLVQALAELHQQKLD----PIGHPPI-VGAV
RLMD_POLNA      TPAMLVKDGA-----AEKWLVDPPREGAFELFKSLAALHQQVVTGVPCDDGIHQQSLALG
RLMD_POLSJ      TPAMLVKDGM-----ADKWLVDPPREGAFELFKSLAALHQQMVTGVPCDDGEQQQSLVLG
RLMD_RUBGI      SADELMTSGA-----ADAWLVDPPREGAFALAKSLAELR------------------GRE
RLMD_BORBR      DVQWLRGLGY-----FDRMLIDPPREGAQAVAQALSLLAPG-------------------
RLMD_BORPA      DVQWLRGLGY-----FDRMLIDPPREGAQAVVQALSLLAPG-------------------
RLMD_BORPE      DVQWLRGLGY-----FDRMLIDPPREGAQAVAQALSLLAPG-------------------
RLMD_BORA1      DVSWLRGLGY-----FDRMLIDPPREGAHAVAQALSQLTPA-------------------
RLMD_BURCA      TGDDLRALGA-----FDKFLIDPPREGALAVSKALAEIAQSG------------------
RLMD_BURCH      TGDDLRALGA-----FDKFLIDPPREGALAVSKALAEIAQSG------------------
RLMD_BURL3      TGDDIRALGA-----FDKFLIDPPREGALAVSKALAEIAQSG------------------
RLMD_BURCM      TGDDLRALGA-----FDKFLIDPPREGALAVSKALAEIAQSG------------------
RLMD_BURMA      TADDLRALGA-----FDKFLVDPPREGALAVSKALAEIAQSG------------------
RLMD_BURPS      TADDLRALGA-----FDKFLVDPPREGALAVSKALAEIAQSG------------------
RLMD_BURP1      TADDLRALGA-----FDKFLVDPPREGALAVSKALAEIAQSG------------------
RLMD_BURTA      TADDLHALGA-----FDKFLVDPPREGALAVSKALAEIAQSG------------------
RLMD_PARXL      TADDLRALGH-----FDKFLIDPPREGALAVAKALAEIARSG------------------
RLMD_CUPNH      TAEDIAALGR-----FDRWLVDPPREGALAVCKALGELAQQG------------------
RLMD_CUPMC      TAEDIAALGR-----FDRWLVDPPREGALAVCKALAELSQAG------------------
RLMD_CUPPJ      TAEDIAALGR-----FDRWLIDPPREGALAVCKALGELSQQG------------------
RLMD_RALPJ      SADDVAALGK-----FDRWLIDPPREGALAVSKALAELSQSGGD---------------A
RLMD_RALSO      SADDIAALGR-----FDRWLVDPPREGALAVSKAVAELSQRGGE---------------A
RLMD_POLNS      TSETVASWGG-----AERWLMDPPRKGAMDICKALAELHLQQ------------------
RLMD_AZOSB      TEDSLAALGP-----LDKLLIDPPREGAIAVVKAVGP-----------------------
RLMD_AROAE      TEDSLAALGR-----LDKLLIDPPREGAIAVVKALST-----------------------
RLMD_CHRVO      TEESFAALGK-----FDKMLVDPPRDGAVQLLKAITE-----------------------
RLMD_METFK      TPALLQSLGR-----FDKWLIDPPRDGAIELVKALPDIEDADAD----------------
RLMD_NITMU      DESWMREQGD-----FDKMLIDPPREGAVAVVTALEE-----------------------
RLMD_DECAR      TEQSLAALGR-----FDKMLIDPPREGAVELVRAIGK-----------------------
RLMD_THIDA      TPEKFAALGP-----FDKLLIDPPRSGAIEVVKSLPE-----------------------
RLMD_NEIL0      TEKTVASWER-----FDKMLIDPPRSGAYEVVKSLHT-----------------------
RLMD_ACIB3      F-SHHSWANQ----GFDALLIDPPRAGAYEIMQYVPNFG---------------------
RLMD_ACIBY      F-SHHSWANQ----GFDALLIDPPRAGAYEIMQYVPNFG---------------------
RLMD_ACIB5      F-SHHSWANQ----GFDALLIDPPRAGAYEIMQYVPNFG---------------------
RLMD_ACIBC      F-SHHSWANQ----GFDALLIDPPRAGAYEIMQYVPNFG---------------------
RLMD_ACIBS      F-SHHSWANQ----GFDALLIDPPRAGAYEIIQYVPNFG---------------------
RLMD_ACIAD      F-SHHSWANQ----GFDALLIDPPRSGAFEIMHYIANFE---------------------
RLMD_PSYA2      C-TDKPWANQ----GFDALLIDPPRSGAWEIMQYLPKFN---------------------
RLMD_PSYCK      C-TDKPWANQ----GFDALLIDPPRSGAWEIMQYLPKFN---------------------
RLMD_ALCBS      V-SGQAWARQ----TYDRILIDPPRTGALEMVKLMPRLG---------------------
RLMD_MARHV      F-TGQSWAKE----GFDKILIDPPRSGAEEICKYLTAFG---------------------
RLMD_HAHCH      L-APAKEAKHAWLRTYDKVLLDPPRSGAEELAKQMTRFG---------------------
RLMD_ALKEH      A-ADQPWATG----GFDRVLLDPPRSGAFEVLGLVAALG---------------------
RLMD_METCA      E-SCGSWAGR----EYHKVLLDPSRSGALEILQCVPNWK---------------------
RLMD_NITOC      EWTHYVWARE----GFSKALLDPPRSGALLAVQQMSKLR---------------------
RLMD_STRMK      Q-RSTPWMRQ----GFDKLLLDPPRSGAIEVLQQLPLKQ---------------------
RLMD_STRM5      Q-RSTAWMRQ----GFDKLLLDPPRSGAIEVLQQLPLKQ---------------------
RLMD_XANAC      Q-RSAPWMRQ----GFDKLLLDPPRSGALEVLQQLPLKT---------------------
RLMD_XANC5      Q-RSAPWMRQ----GFDKLLLDPPRSGALEVLQQLPLKT---------------------
RLMD_XANOR      Q-RNAAWMRQ----GFDKLLLDPPRSGALEVLQQLPLKT---------------------
RLMD_XANOM      Q-RNAAWMRQ----GFDKLLLDPPRSGALEVLQQLPLKT---------------------
RLMD_XANCP      Q-RQTAWMRQ----GFDKLLLDPPRSGAIDVLQQLPLKQ---------------------
RLMD_XANC8      Q-RQTAWMRQ----GFDKLLLDPPRSGAIDVLQQLPLKQ---------------------
RLMD_XYLFA      Q-RDAPWMRQ----GFDKLLLDPPRSGAIEVLKQLPLKM---------------------
RLMD_XYLFT      Q-RDAPWMRQ----GFDKLLLDPPRSGAIEVLKQLPLKM---------------------
RLMD_FRATH      F-EDKEWFNNF---EYNKMLLDPPRAGAQEVCNNIEKFN---------------------
RLMD_FRATO      F-EDKEWFNNF---EYNKMLLDPPRAGAQEVCNNIEKFN---------------------
RLMD_FRATT      F-EDKEWFNNF---EYNKMLLDPPRAGAQEVCNNIEKFN---------------------
RLMD_FRAT1      F-EDKEWFNNF---EYNKMLLDPPRAGAQEVCNNIEKFN---------------------
RLMD_FRATN      F-EDKEWFNNF---EYNKMLLDPPRAGAQEVCNNIEKFN---------------------
RLMD_LEGPC      M-EVRNLVNT----SFSKVLIDPPRSGALEIVKQIDSID---------------------
RLMD_LEGPA      M-EVRSLVNT----SFSKVLIDPPRSGALEIVKQIDSID---------------------
RLMD_LEGPH      M-EVRNLVNT----SFSKVLIDPPRSGALEIVKQIDSID---------------------
RLMD_LEGPL      M-EVRNLVNT----SFSKVLIDPPRSGALEIVKQIDSID---------------------
RLMD_VESOH      V-VGFEWFKGK---TYNKALIDPSRSGAIEIVELLPKLG---------------------
                                    :** * **      :                         

RLMD_CHRSD      ---PVTTLLYVSCDPAALARDAARLVQG----GYRIQRAALADMFPHTAHLESMLLLTRD
RLMD_HALED      ---PVPWVLYISCDPATLARDAAWLVSA----GYVVRRSAVADMFAHTSHLESMLLLEHP
RLMD_CELJU      ---SAQRIVYVSCNPATLARDAALLAEA----GYGLDALGVMDMFPHTSHVESMALFLYK
RLMD_MARPP      ----PQQILYVSCNASTLARDAEYLVLN----GYKVVRAGLMDMFPQTSHVETMMLLQKQ
RLMD_MARMS      ----PTQILYVSCNASTLARDAEYLVAK----GYRVLRVSLMDMFPQTSHVETMMLLQKK
RLMD_MARM1      ----PEQILYVSCNASTLARDAEYLIAN----GYVVSRVSLMEMFPQTAHAEAMMLLQRK
RLMD_HYDCU      ----ADKIVYVSCNASTLIRDVKELEKQ----GYQLKKAIMVDMFPHTSHTEVMAQLIKT
RLMD_AERHH      -------VVYVSCNPVTLARDSQVLVKG----GYRLVRLGMLDMFPHTGHLESMALFERK
RLMD_AERS4      -------VVYVSCNPVTLARDSQVLVKG----GYRLVRLGMLDMFPHTGHLESMALFEQ-
RLMD_TOLAT      -------IVYVSCNPVTAARDC-ALLQP----GYTLKQWGLLDMFPHTGHVESLFLFERK
RLMD_PSEHT      -------ILYVSCDPVTLARDSAIISQA----GFELHKIGLMNMFPHTGHIETMALFQRR
RLMD_SHEB9      -------VVYVSCNPASLARDSAVLLER----GYRLQQLGLIDMFPQTHHIEAMALFELT
RLMD_SHEB2      -------VVYVSCNPASLARDSAVLLER----GYRLQQLGLIDMFPQTHHIEAMALFELT
RLMD_SHEB8      -------VVYVSCNPASLARDSAVLLER----GYRLQQLGLIDMFPQTHHIEAMALFELT
RLMD_SHEB5      -------VVYVSCNPASLARDSAVLLER----GYRLQQLGLIDMFPQTHHIEAMALFELT
RLMD_SHEPC      -------VLYVSCNPASLARDSTVLLER----GYRLQRLGLIDMFPQTHHIEAMALFELT
RLMD_SHESW      -------VLYVSCNPASLARDSAVLLER----GYRLQRLGLIDMFPQTHHIEAMALFELT
RLMD_SHESM      -------VVYVSCNPASLARDSAVLLER----GYKLQKLGLIDMFPQTHHIEAMALFELA
RLMD_SHESR      -------VVYVSCNPASLARDSAVLLER----GYKLQKLGLIDMFPQTHHIEAMALFELA
RLMD_SHESA      -------VVYVSCNPASLARDSAVLLER----GYKLQKLGLIDMFPQTHHIEAMALFELA
RLMD_SHEON      -------VVYVSCNPASLARDSAVLLER----GYKLQKLGLIDMFPQTHHIEAMALFELA
RLMD_SHESH      -------IVYVSCDPSSLARDSEPLLKH----GYKLKKLGLIDMFPQTHHIEAMALFELD
RLMD_SHEWM      -------IVYVSCDPSSLARDSEPLLKH----GYKLKKLGLVDMFPQTHHIEAMALFELS
RLMD_SHEHH      -------LVYVSCNPASLARDSEVILKQ----GYQLKKIGLVDMFPQTHHLESMALFELK
RLMD_SHEPA      -------LVYVSCNPASLARDSEVILKQ----GYQLKKIGLIDMFPQTHHLESMALFELG
RLMD_SHEPW      -------LVYVSCNPASLARDSEVILKQ----GYRLTKIAMVDMFPQTHHLESMALFELG
RLMD_SHEDO      -------VVYVSCNPASLARDSSVLLSQ----GYQLKQLSMIDMFPQTHHIEAMALFEIA
RLMD_SHEFN      -------VVYVSCNPASLARDSSVLLAS----GYRIAQVGLVDMFPQTHHIEAMVLFELN
RLMD_SHEAM      -------VLYVSCNPASLARDSVLLFEA----GYQLTRLGLVDMFPQTHHSEGMALFELV
RLMD_FERBD      -------ILYVACNPASLGRDGKVLAQQ----GYRLSRLGLVDMFPHTHHLESMALFEPG
RLMD_ALIF1      -------VVYVSCNPATLARDSQLLIQH----GFKLTRLGMLDMFPHTGHLESMALFER-
RLMD_ALIFM      -------VVYVSCNPATLARDSQLLIQH----GFKLTRLGMLDMFPHTGHLESMALFER-
RLMD_ALISL      -------VVYVSCNPATLARDSQLLIQR----GYKLTRLGMLDMFPHTGHLESMALFER-
RLMD_PHOPR      -------VVYVSCNPATLARDSQVLLKK----GYQLERLGMLDMFPQTGHLESMALFVKA
RLMD_VIBCH      -------VVYVSCNPATLARDSQSLLSQ----GFRLEKLGMLDMFPHTSHLESMALFVKK
RLMD_VIBCM      -------VVYVSCNPATLARDSQSLLSQ----GFRLEKLGMLDMFPHTSHLESMALFVKK
RLMD_VIBC3      -------VVYVSCNPATLARDSQSLLSQ----GFRLEKLGMLDMFPHTSHLESMALFVKK
RLMD_VIBCB      -------IVYVSCNPATLARDSQSLLEQ----GYQLTKLGMLDMFPHTSHLESMALFEKS
RLMD_VIBPA      -------VVYVSCNPATLARDSQSLLDQ----GYQLTKLGMLDMFPHTSHLESMALFEKS
RLMD_VIBVU      -------VVYVSCNPATLARDSQSLLEQ----GYRLTKLGMLDMFPYTSHLESMALFEK-
RLMD_VIBVY      -------VVYVSCNPATLARDSQSLLEQ----GYRLTKLGMLDMFPYTSHLESMALFEK-
RLMD_VIBTL      -------VVYVSCNPATLARDSESLEKQ----GYQLAKLGMLDMFPHTSHLESMALFIKA
RLMD_SHIFL      -------IVYVSCNPATLARDSEALLKA----GYTIARLAMLDMFPHTGHLESMVLFSRV
RLMD_SHIF8      -------IVYVSCNPATLARDSEALLKA----GYTIARLAMLDMFPHTGHLESMVLFSRV
RLMD_ECOLI      -------IVYVSCNPATLARDSEALLKA----GYTIARLAMLDMFPHTGHLESMVLFSRV
RLMD_ECOUT      -------IVYVSCNPATLARDSEALLKA----GYTIARLAMLDMFPHTGHLESMVLFSRV
RLMD_ECOK1      -------IVYVSCNPATLARDSEALLKA----GYTIARLAMLDMFPHTGHLESMVLFSRV
RLMD_ECOL6      -------IVYVSCNPATLARDSEALLKA----GYTIARLAMLDMFPHTGHLESMVLFSRV
RLMD_ECOL5      -------IVYVSCNPATLARDSEALLKA----GYTIARLAMLDMFPHTGHLESMVLFSRV
RLMD_ECO57      -------IVYVSCNPATLARDSEALLKA----GYTIARLAMLDMFPHTGHLESMVLFSRV
RLMD_SHIBS      -------IVYVSCNPATLARDSEALLKA----GYTIARLAMLDMFPHTGHLESMVLFSRV
RLMD_SHIDS      -------IVYVSCNPATLARDSEALLKA----GYTIARLAMLDMFPHTGHLESMVLFSRV
RLMD_SHISS      -------IVYVSCNPATLARDSEALLKA----GYTIARLAMLDMFPHTGHLESMVLFSRV
RLMD_CITK8      -------IVYVSCNPATLARDSDALLNA----GYQIQRLAMLDMFPHTGHLESMVLFERL
RLMD_SALCH      -------IVYVSCNPATLARDSEALVNA----GYEVTRLAMLDMFPHTGHLESMVLFERM
RLMD_SALTY      -------IVYVSCNPATLARDSEALVNA----GYEVTRLAMLDMFPHTGHLESMVLFERM
RLMD_SALPA      -------IVYVSCNPATLARDSEALVNA----GYEVTRLAMLDMFPHTGHLESMVLFERM
RLMD_SALTI      -------IVYVSCNPATLARDSEALVNA----GYEVTRLAMLDMFPHTGHLESMVLFERM
RLMD_KLEP3      -------VVYVSCNPATLARDSETLLQA----GYQIQRLAMLDMFPHTGHLESMVLFERR
RLMD_KLEP7      -------VVYVSCNPATLARDSETLLQA----GYQIQRLAMLDMFPHTGHLESMVLFERR
RLMD_ENT38      -------VVYVSCNPATLARDSEALLSA----GYQIQRLAMLDMFPHTGHLESMVLFQL-
RLMD_CROS8      -------VVYVSCNPATLMRDSETLLAA----GYRTVRLAMLDMFPHTGHLESMALFERD
RLMD_ERWT9      -------VVYVSCNPTTLARDSEILLTS----GYQLERVTMLDMFPHTGHLESMVLFSRK
RLMD_PECAS      -------VVYVSCNATTLARDSKVLLAA----GYRLANVAMLDMFPHTGHLESMALFLHD
RLMD_PECCP      -------VVYVSCNATTLARDSKVLLAA----GFTLVNVAMLDMFPHTGHLESMALFLHD
RLMD_YERE8      -------VVYVSCNPTTLARDSQVLLAA----GYRLAQVRMLDMFPHTGHLESMALFMQE
RLMD_PHOLL      -------VVYVSCNPTTLARDSKILLEA----GYQIISVRMLDMFPHTGHLESMALFSR-
RLMD_EDWI9      -------VVYVSCNPTTLARDSQTLLQG----GYRLTRLCMLDMFPHTGHLESMALFESA
RLMD_PROMH      -------IVYVSCNPTTLARDSKILLDS----GYQLTQLRMLDMFPQTGHLESMALFIRK
RLMD_HAEIN      -------ILYVSCNPATLVRDAEILCNF----GYKIEKSAVIDMFPHTGHLESITLFTTK
RLMD_HAEI8      -------ILYVSCNPATLVRDAEILCDF----GYKIEKSAVIDMFPHTGHLESITLFTTK
RLMD_HAEP3      -------ILYVSCNPATLVRDAEILRSF----GYRIIKTAMIDMFPNTSHLESVTLFIK-
RLMD_HAES1      -------IVYVSCNPATLVRDVELLLKF----GYQLKKVAMIDMFPHTSHLESISLFERN
RLMD_MANSM      -------ILYVSCNPATLVRDAEILLNS----DYRVKKVAMIDMFPHTGHLESITLFEKQ
RLMD_PASMU      -------ILYVSCNPATLVRDTAILLQF----NYRLKKVAMIDMFPNTGHLESISLFEKE
RLMD_HAEDU      -------IIYISCNPATLMRDAEKLIRH----GYKIAKSAVIDMFPHTGHLESISMFIK-
RLMD_COLP3      -------VLYVSCDPATLARDSAILVSK----GYKLEKISLMDMFSQTKHVETMILFTHT
RLMD_PSYIN      -------ILYVSCDPLTLARDSQVLLDK----GYKLDKLGLLDMFPQTAHMESMALFTG-
RLMD_IDILO      ----PQRILYVSCAPDTLARDIAGMLTESKGCNYRIIGLSTVDMFPQTHHIETMVCLERA
RLMD_ALTMD      -------IVYVSCNPSTFSRDAKVLING----GYEMEKAGVAEMFPFTHHMEMMALFTQR
RLMD_ALTNA      -------IVYVSCNPNTFSRDARVLIDG----GYQMQKAGVVEMFPFTHHMETMALFTRQ
RLMD_DICNV      -------IVYVSCNPATLARDVAILQSK----GFHLERGQVVNMFAHSAHIESVILMTRT
RLMD_PSEAE      -------VVYVSCNPATLARDAGEMARQ----GYRLKRAGILDMFPQTAHVEAMALFEAG
RLMD_PSEAB      -------VVYVSCNPATLARDAGEMARQ----GYRLKRAGILDMFPQTAHVEAMALFEAG
RLMD_PSEE4      -------LVYVSCNPATLARDTQVLVGQ----GYRLKRAGILDMFPQTAHVEAMALFEAG
RLMD_PSEPK      -------LVYVSCNPATLARDAQVLVGQ----GYRLKRAGILDMFPQTAHVEAMALFEAG
RLMD_PSEF5      -------LVYVSCNPATLARDTVELIKQ----GYRLKRAGILDMFPQTAHVEAMALFEAS
RLMD_PSEPF      -------LVYVSCNPATLARDTVELIKQ----GYRLKRAGILDMFPQTAHVEAMALFEAS
RLMD_PSE14      -------LLYVSCNPATLARDTVELISQ----GYRLKRAGILDMFPQTAHVEAMALFEMS
RLMD_PSEU2      -------LLYVSCNPATLARDAVELIRQ----GYRLKRAGILDMFPQTAHVEAMALFEMS
RLMD_PSESM      -------LLYVSCNPATLARDTVELVKQ----GYRLKRAGILDMFPQTAHVEAMALFEVS
RLMD_ACIF2      ---GVRRLVYVSCNPATLARDAEYLVHER---GYRLRAAGVVNMFPHTAHVESIALFER-
RLMD_ACIF5      ---GVRRLVYVSCNPATLARDAEYLVHER---GYRLRAAGVVNMFPHTAHVESIALFER-
RLMD_ACIAC      GWTPPQRIVYVSCNPATLARDAGLLVHQA---GYRCVAAGVVNMFPHTAHVESMAVFERV
RLMD_ACISJ      GWQPPRRIVYVSCNPATLARDAGLLVHQA---GYRCVAAGVVNMFPHTAHVESMAVFERG
RLMD_VEREI      DWVPPRRIVYVSCNPATLARDAALLVHLA---GYQCAAAGMVNMFPHTAHVESIAVFERG
RLMD_RHOFT      GWMPPKRIVYVSCNPSTLARDADLLVHQA---GYRCSFAGVVNMFPHTAHVESMAVFDLE
RLMD_POLNA      GWTPPSRIVYVSCNPATLARDAGVLVEGG---GYRCTAAGVVNMFPHTAHVESMAVFERL
RLMD_POLSJ      DWTPPQRIVYVSCNPATLARDAGVLVESG---AYRCTLAGVVNMFPHTAHVESIAVFERG
RLMD_RUBGI      GWTPPRRIVYVSCNPATLARDAGLIVHLA---GFRCVAAGVVNMFPHTAHVESIAVFERS
RLMD_BORBR      --ERPRRIVYVSCNPGTLARDAAIMVHEG---GYALRSAGVINMFPHTGHVESIAVFESL
RLMD_BORPA      --ERPRRIVYVSCNPGTLARDAAIMVHEG---GYALRSAGVINMFPHTGHVESIAVFESL
RLMD_BORPE      --ERPRRIVYVSCSPGTLARDAAIMVHEG---GYALRSAGVINMFPHTGHVESIAVFESL
RLMD_BORA1      --ERPRRIVYVSCNPATLARDAAIMVHEG---GYVLKAAGVINMFPHTGHVESIAVFESL
RLMD_BURCA      AGPLPKRIVYVSCNPSTLARDAGLLVHEA---GYRLKGAGVVNMFPNTSHVESIALFERD
RLMD_BURCH      AGPLPKRIVYVSCNPSTLARDAGLLVHEA---GYRLKGAGVVNMFPNTSHVESIALFERD
RLMD_BURL3      EGPLPKRIVYVSCNPSTLARDAGLLVHEA---GYRLKGAGVVNMFPNTSHVESIALFERD
RLMD_BURCM      EGPLPKRIVYVSCNPSTLARDAGLLVHEA---GYRLKGAGVVNMFPNTSHVESIALFERG
RLMD_BURMA      AGPLPARIVYVSCNPSTLARDAGLLVHEA---GYRLKGAGVVNMFPHTSHVESIALFERD
RLMD_BURPS      AGPLPARIVYVSCNPSTLARDAGLLVHEA---GYRLKGAGVVNMFPHTSHVESIALFERD
RLMD_BURP1      AGPLPARIVYVSCNPSTLARDAGLLVHEA---GYRLKGAGVVNMFPHTSHVESIALFERD
RLMD_BURTA      EGPLPARIVYVSCNPSTLARDAGLLVHEA---GYRLKGAGVVNMFPHTSHVESIALFERD
RLMD_PARXL      NGPLPKRIVYVSCAPATLARDAGLLVHEA---GYRLVGAGVVNMFPHTSHVESIALFERD
RLMD_CUPNH      SNVLPQRIVYVSCSPATLARDAGLLVHGA---GYRLAGAGVVNMFPHTSHVESIAVFERG
RLMD_CUPMC      SDVLPKRIVYVSCSPATLARDAGLLVHEA---GYRLAGAGVVNMFPHTSHVESIAVFERD
RLMD_CUPPJ      SDVLPQRIVYVSCSPATLARDAGLLVHEA---GYRLAGAGVVNMFPHTSHVESIAVFERR
RLMD_RALPJ      ADLLPKRIIYVSCNPATLARDAGLLVHEA---GYRLAGAGVVNMFPHTSHVESMAVFERD
RLMD_RALSO      AALLPGRIVYVSCNPATLARDAGLLVHEA---GYRLAGAGVVNMFPHTSHVESIAVFERA
RLMD_POLNS      SDLLPERIVYVSCNPKTLARDVEILCHQA---GYRLSSAGIINMFPHTSHVESMVVFDRA
RLMD_AZOSB      -AQQPARIVYVSCNPATLARDAAVLVHEK---GYVLRGAGIANMFPQTSHVESIALFERP
RLMD_AROAE      -LQSPARIVYVSCNPATLARDAAVLVHEK---GYVLRGAGIANMFPQTSHVESIALFERN
RLMD_CHRVO      -ETAPQRIVYVSCNPSTLARDAGVLVHTK---GYTLKAAGIINMFPHTAHVESVAWFEKT
RLMD_METFK      TSHVPQRIVYVSCNPATLARDAGILVHTK---GYRLLASGVINMFPHTSHVESIALFEKA
RLMD_NITMU      KQLKPWRIVYVSCNPATLARDASVLVHRN---GYALKAAGVINMFPHTAHVESIALFEKA
RLMD_DECAR      --DAPKRIVYVSCNPGTLARDAAVLVTEK---GYRFVSAGAVNMFPHTAHVESIAVFELP
RLMD_THIDA      -AGAPRRIVYVSCDPATLARDAEVLVHVK---GYRLEAAGVANMFPHTAHVESIALFER-
RLMD_NEIL0      -PYLPQKIVYVSCNPSTLARDAGVLV-EK---GYMLSQAGIMNMFAQTSHTESVAVFDLL
RLMD_ACIB3      ----AKRIVYVSCNPATLARDAGVLV-QH---GYQLKKAAVMDMFTHTEHVESIALFEKI
RLMD_ACIBY      ----AKRIVYVSCNPATLARDAGVLV-QH---GYQLKKAAVMDMFTHTEHVESIALFEKI
RLMD_ACIB5      ----AKRIVYVSCNPATLARDAGVLV-QH---GYQLKKAAVMDMFTHTEHVESIALFEKI
RLMD_ACIBC      ----AKRIVYVSCNPATLARDAGVLV-QH---GYQLKKAAVMDMFTHTEHVESIALFEKI
RLMD_ACIBS      ----AKRIVYVSCNPATLARDAGVLV-QH---GYQLKKAAVMDMFTHTEHVESIALFEKI
RLMD_ACIAD      ----AKRIVYVSCNPATLARDAGVLA-QH---GYQLKKVGVMDMFTHTEHVESIALFEKI
RLMD_PSYA2      ----AERIVYVSCNPATLARDTKALL-EQ---GYRLTHAGVMDMFCHTGHVESIARFEKV
RLMD_PSYCK      ----AERIVYVSCNPATLARDTKALL-EQ---GYRLTHAGVMDMFCHTGHVESIARFEKI
RLMD_ALCBS      ----ASKIVYVSCNPATLARDAGELM-AL---GYRLKAAGVMDMFPHTTHVESIAVFEKM
RLMD_MARHV      ----ANRIVYVSCNPATLARDAGVMV-RN---GYRLVQAGVMDMFPHTTHVESIALFERS
RLMD_HAHCH      ----AKRIVYVSCNPATLARDAGILA-TQ---GYKLIKAGVMDMFPHTAHVESMALFEKA
RLMD_ALKEH      ----PKRIVYVSCGPATLARDAGELVHRH---GYRLTAAGVMDMFPHTAHVESMAVFQRE
RLMD_METCA      ----AGRIVYVSCNPSTLARDAGILVHEY---GYRLLKAGVMDMFPHTAHVESIAVFER-
RLMD_NITOC      ----VQRIVYVSCNPATLARDAGELVNRQ---GYRLRYAGVIDMFPHTTHVETLALFEQT
RLMD_STRMK      ----FKRIVYVSCHPGSLARDAGYLVNEQ---GFTLVSAGAMDMFPHTAHVESIAVFEKR
RLMD_STRM5      ----FKRIVYVSCHPGSLARDAGYLVNEQ---GFTLVSAGAMDMFPHTAHVESIAVFEKR
RLMD_XANAC      ----FQRIVYVSCHPGSLARDAGYLVNEQ---GFTLVSAGAMDMFPHTAHVESIAVFERR
RLMD_XANC5      ----FDRIVYVSCHPGSLARDAGYLVNDQ---GFTLVCAGAMDMFPHTAHVESIAVFERR
RLMD_XANOR      ----FERIVYVSCHPGSLARDAGYLVNEQ---GFTLVSAGAMDMFPHTAHVESIAVFERR
RLMD_XANOM      ----FERIVYVSCHPGSLARDAGYLVNEQ---GFTLVSAGAMDMFPHTAHVESIAVFERR
RLMD_XANCP      ----FKRIVYVSCHPGSLARDAGYLVNEQ---GFSLLSAGAMDMFPHTAHVESIAVFEKR
RLMD_XANC8      ----FKRIVYVSCHPGSLARDAGYLVNEQ---GFSLLSAGAMDMFPHTAHVESIAVFEKR
RLMD_XYLFA      ----FERIVYVSCHPGSLARDADFLVNEQ---GFVLRAVGAMDMFPHTAHVESIAVFDRC
RLMD_XYLFT      ----FERIVYVSCHPGSLARDADFLVNEQ---GFVLRAVGAMDMFPHTAHVESIAVFDRC
RLMD_FRATH      ----VKRIVYVSCDTAALARDAGILVNTK---GYKLISAGVMDMFPHTMHVESIAVFEKI
RLMD_FRATO      ----VKRIVYVSCDTAALARDAGILVNTK---GYKLISAGVMDMFPHTMHVESIAVFEKI
RLMD_FRATT      ----VKRIVYVSCDTAALARDAGILVNTK---GYKLISAGVMDMFPHTMHVESIAVFEKI
RLMD_FRAT1      ----VKRIVYVSCDTAALARDAGILVNTK---GYKLISAGVMDMFPHTMHVESIAVFEKI
RLMD_FRATN      ----VKRIVYVSCDTATLARDAGILVNNK---DYKLISAGVMDMFPHTMHVESIAVFEKI
RLMD_LEGPC      ----PERIVYVSCNPITLARDTDILVNQK---GYVLITAGVMDMFPHTAHVESIALFQKG
RLMD_LEGPA      ----PERIVYVSCNPITLARDTDILVNQK---GYVLITAGVMDMFPHTAHVESIALFQKG
RLMD_LEGPH      ----PERIVYVSCNPITLARDTDILVNQK---GYVLITAGVMDMFPHTAHVESIALFQKG
RLMD_LEGPL      ----PERIVYVSCNPITLARDTDILVNQK---GYVLITAGVMDMFPHTAHVESIALFQKG
RLMD_VESOH      ----VTRLVYVSCNPATLARDTLKLIKL----GFTLETAGVIDMFPQTSHVESIALFVKR
                       ::*::* . :  **   :        :        :**  : * * :  :   

RLMD_CHRSD      TPRGRSTSVEREDHGQGP------------------------------------------
RLMD_HALED      DSARRQQGASTDG-----------------------------------------------
RLMD_CELJU      Q-----------------------------------------------------------
RLMD_MARPP      K-----------------------------------------------------------
RLMD_MARMS      K-----------------------------------------------------------
RLMD_MARM1      ------------------------------------------------------------
RLMD_HYDCU      GKKPKQRGPGIFKL----------------------------------------------
RLMD_AERHH      ------------------------------------------------------------
RLMD_AERS4      ------------------------------------------------------------
RLMD_TOLAT      ------------------------------------------------------------
RLMD_PSEHT      ------------------------------------------------------------
RLMD_SHEB9      K-----------------------------------------------------------
RLMD_SHEB2      K-----------------------------------------------------------
RLMD_SHEB8      K-----------------------------------------------------------
RLMD_SHEB5      K-----------------------------------------------------------
RLMD_SHEPC      K-----------------------------------------------------------
RLMD_SHESW      K-----------------------------------------------------------
RLMD_SHESM      K-----------------------------------------------------------
RLMD_SHESR      K-----------------------------------------------------------
RLMD_SHESA      K-----------------------------------------------------------
RLMD_SHEON      K-----------------------------------------------------------
RLMD_SHESH      ------------------------------------------------------------
RLMD_SHEWM      ------------------------------------------------------------
RLMD_SHEHH      N-----------------------------------------------------------
RLMD_SHEPA      N-----------------------------------------------------------
RLMD_SHEPW      K-----------------------------------------------------------
RLMD_SHEDO      T-----------------------------------------------------------
RLMD_SHEFN      I-----------------------------------------------------------
RLMD_SHEAM      N-----------------------------------------------------------
RLMD_FERBD      NNKHPK------------------------------------------------------
RLMD_ALIF1      ------------------------------------------------------------
RLMD_ALIFM      ------------------------------------------------------------
RLMD_ALISL      ------------------------------------------------------------
RLMD_PHOPR      KAVKKKRVVTKL------------------------------------------------
RLMD_VIBCH      G-----------------------------------------------------------
RLMD_VIBCM      G-----------------------------------------------------------
RLMD_VIBC3      G-----------------------------------------------------------
RLMD_VIBCB      ------------------------------------------------------------
RLMD_VIBPA      ------------------------------------------------------------
RLMD_VIBVU      ------------------------------------------------------------
RLMD_VIBVY      ------------------------------------------------------------
RLMD_VIBTL      ------------------------------------------------------------
RLMD_SHIFL      K-----------------------------------------------------------
RLMD_SHIF8      K-----------------------------------------------------------
RLMD_ECOLI      K-----------------------------------------------------------
RLMD_ECOUT      K-----------------------------------------------------------
RLMD_ECOK1      K-----------------------------------------------------------
RLMD_ECOL6      K-----------------------------------------------------------
RLMD_ECOL5      K-----------------------------------------------------------
RLMD_ECO57      K-----------------------------------------------------------
RLMD_SHIBS      K-----------------------------------------------------------
RLMD_SHIDS      K-----------------------------------------------------------
RLMD_SHISS      K-----------------------------------------------------------
RLMD_CITK8      ------------------------------------------------------------
RLMD_SALCH      ------------------------------------------------------------
RLMD_SALTY      ------------------------------------------------------------
RLMD_SALPA      ------------------------------------------------------------
RLMD_SALTI      ------------------------------------------------------------
RLMD_KLEP3      LT----------------------------------------------------------
RLMD_KLEP7      LT----------------------------------------------------------
RLMD_ENT38      ------------------------------------------------------------
RLMD_CROS8      ------------------------------------------------------------
RLMD_ERWT9      ------------------------------------------------------------
RLMD_PECAS      TGMRKAQ-----------------------------------------------------
RLMD_PECCP      TGTRKA------------------------------------------------------
RLMD_YERE8      PGVAK-------------------------------------------------------
RLMD_PHOLL      ------------------------------------------------------------
RLMD_EDWI9      AQ----------------------------------------------------------
RLMD_PROMH      ------------------------------------------------------------
RLMD_HAEIN      ------------------------------------------------------------
RLMD_HAEI8      ------------------------------------------------------------
RLMD_HAEP3      ------------------------------------------------------------
RLMD_HAES1      R-----------------------------------------------------------
RLMD_MANSM      S-----------------------------------------------------------
RLMD_PASMU      ------------------------------------------------------------
RLMD_HAEDU      ------------------------------------------------------------
RLMD_COLP3      S-----------------------------------------------------------
RLMD_PSYIN      ------------------------------------------------------------
RLMD_IDILO      S-----------------------------------------------------------
RLMD_ALTMD      QQ----------------------------------------------------------
RLMD_ALTNA      QQ----------------------------------------------------------
RLMD_DICNV      I-----------------------------------------------------------
RLMD_PSEAE      ------------------------------------------------------------
RLMD_PSEAB      ------------------------------------------------------------
RLMD_PSEE4      ------------------------------------------------------------
RLMD_PSEPK      ------------------------------------------------------------
RLMD_PSEF5      ------------------------------------------------------------
RLMD_PSEPF      QDGSSDPTGRP-------------------------------------------------
RLMD_PSE14      K-----------------------------------------------------------
RLMD_PSEU2      K-----------------------------------------------------------
RLMD_PSESM      K-----------------------------------------------------------
RLMD_ACIF2      ------------------------------------------------------------
RLMD_ACIF5      ------------------------------------------------------------
RLMD_ACIAC      ------------------------------------------------------------
RLMD_ACISJ      ------------------------------------------------------------
RLMD_VEREI      ------------------------------------------------------------
RLMD_RHOFT      V-----------------------------------------------------------
RLMD_POLNA      ------------------------------------------------------------
RLMD_POLSJ      ------------------------------------------------------------
RLMD_RUBGI      EAALSPRPVGEAAPELAAEPAPDAVA----------------------------------
RLMD_BORBR      DEATVLQAQAQARQKAREEAERLAEAAAA-------------------------------
RLMD_BORPA      DEATVLQAQAQARQKAREEAERLAEAAAA-------------------------------
RLMD_BORPE      DEATVLQAQAQARQKAREEAERLAEAAAA-------------------------------
RLMD_BORA1      ADDEVLHVQQQARLKAELAAQEAAEATVQAGAASEQPA----------------------
RLMD_BURCA      ------------------------------------------------------------
RLMD_BURCH      ------------------------------------------------------------
RLMD_BURL3      ------------------------------------------------------------
RLMD_BURCM      ------------------------------------------------------------
RLMD_BURMA      ------------------------------------------------------------
RLMD_BURPS      ------------------------------------------------------------
RLMD_BURP1      ------------------------------------------------------------
RLMD_BURTA      ------------------------------------------------------------
RLMD_PARXL      ------------------------------------------------------------
RLMD_CUPNH      ------------------------------------------------------------
RLMD_CUPMC      ------------------------------------------------------------
RLMD_CUPPJ      ------------------------------------------------------------
RLMD_RALPJ      ------------------------------------------------------------
RLMD_RALSO      ------------------------------------------------------------
RLMD_POLNS      ------------------------------------------------------------
RLMD_AZOSB      ------------------------------------------------------------
RLMD_AROAE      ------------------------------------------------------------
RLMD_CHRVO      GPCKTRKEVEEIEALEAAEREAAKAARLAEENAEKARKAAELAEKAAAKEARRAHYFAEK
RLMD_METFK      SP----------------------------------------------------------
RLMD_NITMU      RRQA--------------------------------------------------------
RLMD_DECAR      ------------------------------------------------------------
RLMD_THIDA      ------------------------------------------------------------
RLMD_NEIL0      PQTGKNFLKIKGKD----------------------------------------------
RLMD_ACIB3      QEIND-------------------------------------------------------
RLMD_ACIBY      QEIND-------------------------------------------------------
RLMD_ACIB5      QEIND-------------------------------------------------------
RLMD_ACIBC      QEIND-------------------------------------------------------
RLMD_ACIBS      QEIND-------------------------------------------------------
RLMD_ACIAD      QEIND-------------------------------------------------------
RLMD_PSYA2      SA----------------------------------------------------------
RLMD_PSYCK      SA----------------------------------------------------------
RLMD_ALCBS      KKK---------------------------------------------------------
RLMD_MARHV      AD----------------------------------------------------------
RLMD_HAHCH      ------------------------------------------------------------
RLMD_ALKEH      AQD---------------------------------------------------------
RLMD_METCA      ------------------------------------------------------------
RLMD_NITOC      RKH---------------------------------------------------------
RLMD_STRMK      ------------------------------------------------------------
RLMD_STRM5      ------------------------------------------------------------
RLMD_XANAC      ------------------------------------------------------------
RLMD_XANC5      ------------------------------------------------------------
RLMD_XANOR      ------------------------------------------------------------
RLMD_XANOM      ------------------------------------------------------------
RLMD_XANCP      ------------------------------------------------------------
RLMD_XANC8      ------------------------------------------------------------
RLMD_XYLFA      ------------------------------------------------------------
RLMD_XYLFT      ------------------------------------------------------------
RLMD_FRATH      ------------------------------------------------------------
RLMD_FRATO      ------------------------------------------------------------
RLMD_FRATT      ------------------------------------------------------------
RLMD_FRAT1      ------------------------------------------------------------
RLMD_FRATN      ------------------------------------------------------------
RLMD_LEGPC      ------------------------------------------------------------
RLMD_LEGPA      ------------------------------------------------------------
RLMD_LEGPH      ------------------------------------------------------------
RLMD_LEGPL      ------------------------------------------------------------
RLMD_VESOH      ------------------------------------------------------------
                                                                            

RLMD_CHRSD      ------------
RLMD_HALED      ------------
RLMD_CELJU      ------------
RLMD_MARPP      ------------
RLMD_MARMS      ------------
RLMD_MARM1      ------------
RLMD_HYDCU      ------------
RLMD_AERHH      ------------
RLMD_AERS4      ------------
RLMD_TOLAT      ------------
RLMD_PSEHT      ------------
RLMD_SHEB9      ------------
RLMD_SHEB2      ------------
RLMD_SHEB8      ------------
RLMD_SHEB5      ------------
RLMD_SHEPC      ------------
RLMD_SHESW      ------------
RLMD_SHESM      ------------
RLMD_SHESR      ------------
RLMD_SHESA      ------------
RLMD_SHEON      ------------
RLMD_SHESH      ------------
RLMD_SHEWM      ------------
RLMD_SHEHH      ------------
RLMD_SHEPA      ------------
RLMD_SHEPW      ------------
RLMD_SHEDO      ------------
RLMD_SHEFN      ------------
RLMD_SHEAM      ------------
RLMD_FERBD      ------------
RLMD_ALIF1      ------------
RLMD_ALIFM      ------------
RLMD_ALISL      ------------
RLMD_PHOPR      ------------
RLMD_VIBCH      ------------
RLMD_VIBCM      ------------
RLMD_VIBC3      ------------
RLMD_VIBCB      ------------
RLMD_VIBPA      ------------
RLMD_VIBVU      ------------
RLMD_VIBVY      ------------
RLMD_VIBTL      ------------
RLMD_SHIFL      ------------
RLMD_SHIF8      ------------
RLMD_ECOLI      ------------
RLMD_ECOUT      ------------
RLMD_ECOK1      ------------
RLMD_ECOL6      ------------
RLMD_ECOL5      ------------
RLMD_ECO57      ------------
RLMD_SHIBS      ------------
RLMD_SHIDS      ------------
RLMD_SHISS      ------------
RLMD_CITK8      ------------
RLMD_SALCH      ------------
RLMD_SALTY      ------------
RLMD_SALPA      ------------
RLMD_SALTI      ------------
RLMD_KLEP3      ------------
RLMD_KLEP7      ------------
RLMD_ENT38      ------------
RLMD_CROS8      ------------
RLMD_ERWT9      ------------
RLMD_PECAS      ------------
RLMD_PECCP      ------------
RLMD_YERE8      ------------
RLMD_PHOLL      ------------
RLMD_EDWI9      ------------
RLMD_PROMH      ------------
RLMD_HAEIN      ------------
RLMD_HAEI8      ------------
RLMD_HAEP3      ------------
RLMD_HAES1      ------------
RLMD_MANSM      ------------
RLMD_PASMU      ------------
RLMD_HAEDU      ------------
RLMD_COLP3      ------------
RLMD_PSYIN      ------------
RLMD_IDILO      ------------
RLMD_ALTMD      ------------
RLMD_ALTNA      ------------
RLMD_DICNV      ------------
RLMD_PSEAE      ------------
RLMD_PSEAB      ------------
RLMD_PSEE4      ------------
RLMD_PSEPK      ------------
RLMD_PSEF5      ------------
RLMD_PSEPF      ------------
RLMD_PSE14      ------------
RLMD_PSEU2      ------------
RLMD_PSESM      ------------
RLMD_ACIF2      ------------
RLMD_ACIF5      ------------
RLMD_ACIAC      ------------
RLMD_ACISJ      ------------
RLMD_VEREI      ------------
RLMD_RHOFT      ------------
RLMD_POLNA      ------------
RLMD_POLSJ      ------------
RLMD_RUBGI      ------------
RLMD_BORBR      ------------
RLMD_BORPA      ------------
RLMD_BORPE      ------------
RLMD_BORA1      ------------
RLMD_BURCA      ------------
RLMD_BURCH      ------------
RLMD_BURL3      ------------
RLMD_BURCM      ------------
RLMD_BURMA      ------------
RLMD_BURPS      ------------
RLMD_BURP1      ------------
RLMD_BURTA      ------------
RLMD_PARXL      ------------
RLMD_CUPNH      ------------
RLMD_CUPMC      ------------
RLMD_CUPPJ      ------------
RLMD_RALPJ      ------------
RLMD_RALSO      ------------
RLMD_POLNS      ------------
RLMD_AZOSB      ------------
RLMD_AROAE      ------------
RLMD_CHRVO      ARRDAEEAASDQ
RLMD_METFK      ------------
RLMD_NITMU      ------------
RLMD_DECAR      ------------
RLMD_THIDA      ------------
RLMD_NEIL0      ------------
RLMD_ACIB3      ------------
RLMD_ACIBY      ------------
RLMD_ACIB5      ------------
RLMD_ACIBC      ------------
RLMD_ACIBS      ------------
RLMD_ACIAD      ------------
RLMD_PSYA2      ------------
RLMD_PSYCK      ------------
RLMD_ALCBS      ------------
RLMD_MARHV      ------------
RLMD_HAHCH      ------------
RLMD_ALKEH      ------------
RLMD_METCA      ------------
RLMD_NITOC      ------------
RLMD_STRMK      ------------
RLMD_STRM5      ------------
RLMD_XANAC      ------------
RLMD_XANC5      ------------
RLMD_XANOR      ------------
RLMD_XANOM      ------------
RLMD_XANCP      ------------
RLMD_XANC8      ------------
RLMD_XYLFA      ------------
RLMD_XYLFT      ------------
RLMD_FRATH      ------------
RLMD_FRATO      ------------
RLMD_FRATT      ------------
RLMD_FRAT1      ------------
RLMD_FRATN      ------------
RLMD_LEGPC      ------------
RLMD_LEGPA      ------------
RLMD_LEGPH      ------------
RLMD_LEGPL      ------------
RLMD_VESOH      ------------