CLUSTAL format seed alignment for MF_01011

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TRMA_ACIB5      -----------------MTSSYRQQLQAKIDRITTQFSEFTPP------------TLEVF
TRMA_ACIBS      -----------------MTSSYRQQLQAKIDRITTQFSEFTPP------------TLEVF
TRMA_ACIB3      -----------------MTSSYRQQLQAKIDRITTQFSEFTPP------------TLEVF
TRMA_ACIBT      -----------------MTSSYRQQLQAKIDRITTQFSEFTPP------------TLEVF
TRMA_ACIBY      -----------------MTSSYRQQLQAKIDRITTQFSEFTPP------------TLEVF
TRMA_ACIBC      -----------------MTSSYHQQLQAKIDRITTQFSEFTPP------------TLEVF
TRMA_ACIAD      -----------------MSQTYQQQLQSKIERITHQFAEFNPP------------ALEVF
TRMA_NEIG1      ------------------MNDYTQQLQGKKDYLKTLFAGLDVP------------EWEVY
TRMA_NEIG2      ------------------MNDYTQQLQGKKDYLKTLFAGLDVP------------EWEVY
TRMA_NEIM0      ------------------MSDYTQQLQDKKDHLKTLFAGLDVP------------EWEVY
TRMA_NEIMF      ------------------MSDYTQQLQDKKDHLKTLFAGLDVP------------EWEVY
TRMA_NEIMA      ------------------MSDYTQQLQDKKDHLKTLFAGLDVP------------EWEVY
TRMA_NEIMB      ------------------MNDYTQQLQGKKDYLKTLFAGLDVP------------EWEVY
TRMA_DICNV      ----------------MTMSNYQRQLFAKHQQLHALLRPFSAP------------KIRIY
TRMA_ECOBR      -----------MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDL------------VPEVF
TRMA_ECOHS      -----------MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDL------------VPEVF
TRMA_ECO8A      -----------MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDL------------VPEVF
TRMA_ECOSE      -----------MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDL------------VPEVF
TRMA_ECOLI      -----------MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDL------------VPEVF
TRMA_ECODH      -----------MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDL------------VPEVF
TRMA_ECOBW      -----------MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDL------------VPEVF
TRMA_ECOLC      -----------MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDL------------VPEVF
TRMA_ECO55      -----------MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDL------------VPEVF
TRMA_ECO24      -----------MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDL------------VPEVF
TRMA_SHIB3      -----------MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDL------------VPEVF
TRMA_SHISS      -----------MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDL------------VPEVF
TRMA_ECOSM      -----------MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDL------------VPEVF
TRMA_ECOLU      -----------MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDL------------VPEVF
TRMA_ECOUT      -----------MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDL------------VPEVF
TRMA_ECOL5      -----------MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDL------------VPEVF
TRMA_ECOK1      -----------MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDL------------VPEVF
TRMA_ECO45      -----------MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDL------------VPEVF
TRMA_ECOL6      -----------MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDL------------VPEVF
TRMA_ECO57      -----------MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDL------------VPEVF
TRMA_ECO5E      -----------MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDL------------VPEVF
TRMA_SHIBS      -----------MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDL------------VPEVF
TRMA_SHIFL      -----------MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDL------------VPEVF
TRMA_SHIF8      -----------MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDL------------VPEVF
TRMA_SHIDS      -----------MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDL------------VPEVF
TRMA_ECO27      -----------MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDL------------VPEVF
TRMA_ECO7I      -----------MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSNL------------VPEVF
TRMA_ECO81      -----------MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSNL------------VPEVF
TRMA_ESCF3      -----------MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDL------------VPEVF
TRMA_ENT38      -----------MTPEHLPTEQYDAQLAEKVVRLQSMMTPFAAP------------VPEVF
TRMA_CITK8      -----------MTPEHLPTEQYDAQLAEKVVRLQSMMAPFSDL------------VPEVF
TRMA_SALA4      -----------MTPEHLPTEQYEAQLAEKVARLQSMMAPFSGL------------VPEVF
TRMA_SALSV      -----------MTPEHLPTEQYEAQLAEKVARLQSMMAPFSGL------------VPEVF
TRMA_SALCH      -----------MTPEHLPTEQYEAQLAEKVARLQSMMAPFSGL------------VPEVF
TRMA_SALDC      -----------MTPEHLPTEQYEAQLAEKVARLQSMMAPFSGL------------VPEVF
TRMA_SALEP      -----------MTPEHLPTEQYEAQLAEKVARLQSMMAPFSGL------------VPEVF
TRMA_SALG2      -----------MTPEHLPTEQYEAQLAEKVARLQSMMAPFSGL------------VPEVF
TRMA_SALTY      -----------MTPEHLPTEQYEAQLAEKVARLQSMMAPFSGL------------VPEVF
TRMA_SALPA      -----------MTPEHLPTEQYEAQLAEKVARLQSMMAPFSGL------------VPEVF
TRMA_SALPC      -----------MTPEHLPTEQYEAQLAEKVARLQSMMAPFSGL------------VPEVF
TRMA_SALPK      -----------MTPEHLPTEQYEAQLAEKVARLQSMMAPFSGL------------VPEVF
TRMA_SALTI      -----------MTPEHLPTEQYEAQLAEKVARLQSMMAPFSGL------------VPEVF
TRMA_SALHS      -----------MTPEHLPTEQYEAQLAEKVARLQSMMAPFSGL------------VPEVF
TRMA_SALNS      -----------MTPEHLPTEQYEAQLAEKVARLQSMMAPFSDL------------VPEVF
TRMA_SALPB      -----------MTPEHLPTEQYEAQLAEKVSRLQSMMAPFSDL------------VPEVF
TRMA_SALAR      -----------MTPEHLPTEQYDAQLAEKVARLQSMMAPFSGL------------VPEVF
TRMA_KLEP3      -----------MTPEHLPTEQYEAQLAEKVVRLQTMMAPFAAP------------VPEVF
TRMA_KLEP7      -----------MTPEHLPTEQYEAQLAEKVVRLQTMMAPFAAP------------VPEVF
TRMA_CROS8      -----------MTPEHLPIDQYDAQLAEKTERLQSMMAPFAAP------------APEVF
TRMA_ERWT9      -----------MTPEQLPIEHYEDQLAEKVTRLTTMMSAFNAP------------EVEVF
TRMA_PHOLL      ------------MQNLLPTESYEQQLTEKVSRLKNMMAPFQPP------------RPEVF
TRMA_PROMH      ------------MQNSLPTQTYQSQLNEKTERLQKMMAPFNAP------------NVEVF
TRMA_PECAS      -----------MTPEILPIEDYDDQLAEKTERLRGMMAPFNAP------------EPAVF
TRMA_PECCP      -----------MTPEILPIEQYDDQLAEKTERLRGMMAPFNAP------------EPVVF
TRMA_DICP7      -----------MTPSTLPIDQYDAQLAEKTGRLKAMMASYHAP------------EPQVF
TRMA_DICC1      -----------MTPEILPIDQYDAQLEEKTGRLGAMMAPFDAP------------APAVF
TRMA_EDWI9      -----------MTPSMLPTEHYDDQLSEKIHRLEQMMQPFGAP------------AVQPF
TRMA_YERPE      -----------MTPNILPIESYDHQLAEKSARLKAMMLPFQAP------------EPEIF
TRMA_YERPP      -----------MTPNILPIESYDHQLAEKSARLKAMMLPFQAP------------EPEIF
TRMA_YERPY      -----------MTPNILPIESYDHQLAEKSARLKAMMLPFQAP------------EPEIF
TRMA_YERPG      -----------MTPNILPIESYDHQLAEKSARLKAMMLPFQAP------------EPEIF
TRMA_YERPA      -----------MTPNILPIESYDHQLAEKSARLKAMMLPFQAP------------EPEIF
TRMA_YERPN      -----------MTPNILPIESYDHQLAEKSARLKAMMLPFQAP------------EPEIF
TRMA_YERPS      -----------MTPNILPIESYDHQLAEKSARLKAMMLPFQAP------------EPEIF
TRMA_YERPB      -----------MTPNILPIESYDHQLAEKSARLKAMMLPFQAP------------EPEIF
TRMA_YERP3      -----------MTPNILPIESYDHQLAEKSARLKAMMLPFQAP------------EPEIF
TRMA_YERE8      -----------MTPDILPTDGYEHQLAEKSARLQAMMSPFQAP------------AAEIF
TRMA_SERP5      -----------MTPENLPIERYDDQLAEKTARLKTLMSPFTAP------------EPEVF
TRMA_SODGM      -----------MTPETLPIDQYEQQLAEKAARLRQMMLAFQAP------------EAQIF
TRMA_ACTP2      --------------MNLPIEQYADLLAEKAKNLTALLAPFNPP------------ELEVF
TRMA_ACTP7      --------------MNLPIERYADLLAEKAKNLTALLVPFNPP------------ELEVF
TRMA_ACTPJ      --------------MNLPIEQYADLLAEKAKNLTALLAPFNPP------------ELEVF
TRMA_HAEDU      --------------MSLPIEQYPELLAQKVDNLTALLAPFNPP------------PFDIF
TRMA_HAEPS      --------------MTLPIHQYPALLAKKAENLTALLAPFNAP------------ELDVF
TRMA_HAEIN      --------------MQLPISQYNELLQKKLEKLTALLHPFNAP------------DIQVF
TRMA_HAEI8      --------------MQLPISQYNELLQKKLEKLTALLHPFNAP------------DIQVF
TRMA_HAEIE      --------------MQLPISQYNELLQKKLEKLTALLRPFNAP------------DIQVF
TRMA_MANSM      -------------MQQLPIEKYSELLTKKQQKLTALLAPFNAP------------ELSVF
TRMA_HAES1      -------------MQRLPIEQYSALLAEKQQKLTELLAPFNSP------------PLDVF
TRMA_HISS2      -------------MQRLPIEQYSALLAEKQQKLTALLAPFNSP------------PLDVF
TRMA_PASMU      ------------MQALLPIEQYDSLLAEKQKKLTALLAPFHAP------------ALAVF
TRMA_AGGAN      -------------MQNLPVTHYSALLAEKQEKLTALLAPFNAP------------NLQVF
TRMA_ACTSZ      -------------MQQLPIEKYDELLAEKCRKLTALLAPFDAP------------ALTVF
TRMA_TOLAT      -----------MTNAVHSDALYQQQLHEKQQRLTQLLAPFQAP------------EPEVF
TRMA_AERHH      --MTQSQQVSADPAPLRTPADYQAQLDEKRERLCGLFADFTLP------------ALEVH
TRMA_AERS4      --MTQIQQAGADSQALRTPADYQAQLDEKRERLTQLFAGFNPP------------ALEVH
TRMA_ALIF1      -----------MTQSVMNPENYQVQLDEKAEALSAMFSEFNVP------------ELEVF
TRMA_ALIFM      -----------MTQSVMNPENYQVQLDEKAEALSAMFSEFNVP------------ELEVF
TRMA_ALISL      -----------MTQPVMNPENYQVQLDEKTEALSAMFSEFDVP------------ELEVF
TRMA_PHOPR      -----------MTSTALNTAGYQQQLDEKAERIQNIFEDFETP------------ELEVF
TRMA_VIBCH      -----------MATLDVNPELYQAQLADKIARLKAMFVDYSMP------------ELEVF
TRMA_VIBC3      -----------MATLDVNPELYQAQLADKIARLKAMFVDYSMP------------ELEVF
TRMA_VIBCM      -----------MATLDVNPELYQAQLADKIARLKAMFVDYSMP------------ELEVF
TRMA_VIBCB      -----------MATLDVNPQRYQEQLAEKVERLNDMFAPYNVP------------ELEVF
TRMA_VIBPA      -----------MATLDVNPQRYQEQLAEKVERLTDMFAPYNVP------------ELEVF
TRMA_VIBVU      -----------MATLDVNPQRYQQQLAEKVQRLTDMFAPYQAP------------ELEVF
TRMA_VIBVY      -----------MATLDVNPQRYQQQLAEKVQRLTDMFAPYQAP------------ELEVF
TRMA_VIBTL      -----------MANLEVNPQRYQEQLAEKTERLTEMFSEYNVP------------ELEVY
TRMA_SHEB5      -----------MNLAAMDPQTYDTQLEHKRIKLEQAFAQFETP------------SVEVF
TRMA_SHEB9      -----------MNLAAMDPQTYDTQLEHKRIKLEQAFAQFETP------------SVEVF
TRMA_SHEB2      -----------MNLAAMDPQTYDTQLEHKRIKLEQAFAQFETP------------SVEVF
TRMA_SHEB8      -----------MNLAAMDPQTYDTQLEHKRIKLEQAFAQFETP------------SVEVF
TRMA_SHEPC      -----------MNLAAMDPQTYDAQLEHKRIKLEQAFAQFETP------------SVEVF
TRMA_SHESW      -----------MNLAAMDPQTYDAQLEHKRIKLEQAFAQFETP------------SVEVF
TRMA_SHESA      -----------MNLAAMDPTTYDAQLTAKRIKLEQAFAQFETP------------SVEVF
TRMA_SHESR      -----------MNLAAMDPTTYDAQLTAKRIKLEQAFAQFETP------------SVEVF
TRMA_SHESM      -----------MNLAAMDPTTYDAQLTAKRIKLEQAFAQFETP------------SVEVF
TRMA_SHEON      -----------MNLAAMDPTTYDAQLEAKRIKLEQAFAQFETP------------SIEVF
TRMA_SHEDO      -----------MNLAAMDPSNYDAQLAEKKRKLSEGFAEFAPP------------ELEVF
TRMA_SHEFN      -----------MNLAAMDPKNYDAQLQQKRIKLEKAFADFNPP------------ALEVF
TRMA_SHEHH      -----------MNLAAMDPTTYDVQLETKRVKLTQLFADFDTP------------ELETF
TRMA_SHEPA      -----------MNLAAMDPTTYDVQLEAKCVKLKQLFADFDTP------------ELETF
TRMA_SHEPW      -----------MNLAAMDPLTYDVQLEAKRVKLKQLFTDFDTP------------ELESF
TRMA_SHESH      -----------MNLAAMDPNTYDAQLEEKRIKLEQIFTDFDTP------------KLEVF
TRMA_SHEWM      -----------MNLAAMDPNTYDAQLEEKRIKLENIFTDFDTP------------NLEVF
TRMA_SHELP      -----------MNVDAMDPQQYDAQLDVKRQKLAQLFVDFETP------------ELEVF
TRMA_SHEAM      -----------MNAQAMDPQQYEQQLEQKCQALTEAFAHYNPP------------ALEVF
TRMA_ALTMD      -------------MSADEQQRYQAQLDEKVDRLSALLSPFNAP------------KTSVY
TRMA_PSEA6      -----------MRPTEINPADYEQQLAQKVNSVQQAFKTFSMP------------ALEAF
TRMA_PSYIN      -----------MTLQFVDPENYETLLAAKKEHLNKQFAIFNPP------------ALECF
TRMA_PSEHT      -----------MAVIKIDTSQYDAQLSEKEQRIAAQFQRFGVD------------KLEVF
TRMA_COLP3      ------------MFSHIHPDNYDAQLSKKQQDMAKLFSDFNLP------------APDLY
TRMA_IDILO      -----------MTYKRIDTSEYPQQLAQKADRVREMFRPFHLN------------EVEVF
TRMA_MARMS      -----------MRPDQIQPEMYEKQLQDKQAELAKLMATLSLP------------EMEVF
TRMA_HYDCU      ------------MLCQTYPETYAEQFAEKTHRLEQLLG--DLP------------NFDAF
TRMA_CELJU      ------MPQPQQHTADYSSAAYEAQLQQKLIRLNQDFASFNLP------------EISVF
TRMA_AROAE      -----------MPLPAIDPAEYASQLADKVTQFKHAFTPFAVP------------EPTVF
TRMA_AZOSB      -----------MSLPRFDPAEYETQLAAKIARFKSDFAPLDLP------------EPEVF
TRMA_DECAR      -----------MPLPTYDPADYPTQLATKVAHFEQNFAPFGVA------------NTAIH
TRMA_PSEAE      -----------MSRPQFDPSAYAAQLEDKKSRLAGLLAPFAAP------------APEVF
TRMA_PSEA8      -----------MSRPQFDPSAYAAQLEDKKSRLAGLLAPFAAP------------APEVF
TRMA_PSEAB      -----------MSRPQFDPSAYAAQLEDKKSRLAGLLAPFAAP------------APEIF
TRMA_PSEA7      -----------MSRPQFDPAAYAAQLEDKKARLAGLLAPFAAP------------APEVF
TRMA_AZOVD      -----------MSLPHFDPSHYDAQLADKQARLSGLLAPFAAP------------EPEVF
TRMA_PSEMY      -----------MSAPVFDPATYDAQLAEKQQRLIELLAPFAAP------------EPEVF
TRMA_PSEU5      -----------MPLPQLDPAQYAAQLAEKAARLEELLAPFDAP------------AAEVF
TRMA_PSEP1      ------------MSAAFDPSSYATQLDAKVARLRELLAPFGAP------------EPAVF
TRMA_PSEPK      ------------MSAAFDPSSYATQLDAKVARLRELLAPFGAP------------EPAVF
TRMA_PSEPG      ------------MSAAFDPSSYATQLDAKVARLRELLAPFGAP------------EPAVF
TRMA_PSEPW      ------------MSAAFDPSAYDAQLQAKVTRLRELLAPFGAP------------QPAVF
TRMA_PSEE4      ------------MSAVFDPSQYDAQLAAKAARLRELLAPFGAP------------EPSVF
TRMA_PSEFL      ----------MVQRMTFDAASYTAQLQDKVTRLRDLLAPFDAP------------EPQVF
TRMA_PSEFS      --------------MTFDAARYTAQLQDKVTRLRDLLAPFDAP------------EPQVF
TRMA_PSEPF      --------------MTFDSQAYAAQLEDKVTRLRDLLAPFDAP------------EPTVF
TRMA_PSEF5      --------------MTFDAASYTTQLNDKVARLRDLLAPFDAP------------EPQVF
TRMA_PSE14      ------------MSVPFDPASYDRQLEEKTVRLRELLAPFDAP------------EPQVF
TRMA_PSEU2      ------------MSVPFDPASYDRQLEEKTVRLRELLAPFDAP------------EPQVF
TRMA_PSESM      ------------MSVPFDPASYDRQLEEKTARLRELLAPFDAP------------EPQVF
TRMA_CHRSD      -----------MAVPVVEPERYEAQLDAKRERVTAQFARFSPP------------ALEVF
TRMA_SACD2      ---------MTTKLGQANPANYQQQLDDKEKATKEQFSDFWQG------------DIEVH
TRMA_TERTT      -----------MQPGSAPTETYDVQFSEKIERTRDQFKDFFNG------------EIDAF
TRMA_SULNB      ---MVCKHFGSCGSCALYNQNYTQQLQLKEQRVSELLSPFYTG------------ELELF
TRMA_NITSB      ---MECKYFGKCGSCSLYEGGYEEQLQKKVHEFEKLFGL----------------EPEIF
TRMA_SULDN      ---MNCKYFGICGACIVYDGGYETQLSQKVELNKELFAPFYMG------------KISVF
TRMA_WOLSU      ----MICPHQGTCGGCALALPYEEQWKLKES----EFRELLPL--------SKDTPTDLY
TRMA_HELHP      ----MNCEHFGICGGCTNIQDYSTQLQAKHNLTLQEFQSFLDTKSKNFQYPTNPLAIEVF
TRMA_CAMC1      ---MDCKYLKECGSCTL-FTSYSEQISFKTDLIKQNFSHFYDG------------KFDLF
TRMA_CAMC5      ---MRCVHFGECGSCTL-ALPYEDQLNFKANFIADKFREFFDG------------ELEIF
TRMA_CAMFF      MQENSCEYLKHCGSCTL-DMPYSEQIDFKKNFIKEHFKDFHNG------------EIIFF
TRMA_CAMHC      ---MSCSYYGKCAGCNL-NLPYNDEISFKTDFLKSEFKEFYQG------------EIEIF
TRMA_CAMJE      -------------MSLE-NFGNFLTLDEKHSFIKKYFKEFYTK------------DFKLF
TRMA_CAMJ8      -------------MSLE-NFGNFLTLDEKHSFIKKYFKEFYTK------------DFKLF
TRMA_CAMJJ      -------------MSLE-NFGNFLTLDEKHSFIKKYFKEFYTK------------DFKLF
TRMA_CAMJR      -------------MSLE-NFGNFLTLDEKHSFIKKYFKEFYTK------------DFKLF
TRMA_CAMJD      -------------MSLE-NFGNFLTLDEKHSFIKKYFKEFYTK------------DFKLF
TRMA_CAMLR      -----------------------MHFEEKIALNKALFSSLYDK------------EIQCF
TRMA_ARCB4      ---MNCNYFGICASCTLFDKTYEEQLNYKIQREKERFSNFTNI------------DFDII
TRMA_NAUPA      ---MTCSSFGKCGSCVLWEMPYDEQLKMKSEKLKEMFSEFDMP------------EIEVV
                                            *       :                       

TRMA_ACIB5      ESPEQHFRMRAEFRIWHTE-----NDMFYAMFERNDDGKQKTV--VRIDEFPIADKSIND
TRMA_ACIBS      ESPEQHFRMRAEFRIWHTE-----NDMFYAMFERNDDGKQKTV--VRIDEFPIADKSIND
TRMA_ACIB3      ESPEQHFRMRAEFRIWHTE-----NDMFYAMFERNDDGKQKTV--VRIDEFPIADKSIND
TRMA_ACIBT      ESPEQHFRMRAEFRIWHTE-----NDMFYAMFERNDDGKQKTV--VRIDEFPIADKSIND
TRMA_ACIBY      ESPEQHFRMRAEFRIWHTE-----NDMFYAMFERNGDGKQKTV--VRIDEFPIADKSIND
TRMA_ACIBC      ESPEQHFRMRAEFRIWHTE-----NDMFYAMFERNDDGKQKTV--VRIDEFPIADKSIND
TRMA_ACIAD      ESPEQHFRMRAEFRIWHTD-----NDLFYAMFERNEDGKQKEV--IRVDEFPIADQSINQ
TRMA_NEIG1      ESPDKHYRMRAEFRIWHEG-----GEMFYAMFEKGQKASGASL--IRCDRFDAASEAVNC
TRMA_NEIG2      ESPDKHYRMRAEFRIWHEG-----GEMFYAMFEKGQKASGASL--IRCDRFDAASEAVNC
TRMA_NEIM0      ESPDKHYRMRAEFRIWHEG-----GEMFYAMFEKGQKAGGASL--IRCDRFEAASEAVNR
TRMA_NEIMF      ESPDKHYRMRAEFRIWHEG-----GEMFYAMFEKGQKAGGASL--IRCDRFEAASEAVNR
TRMA_NEIMA      ESPDKHYRMRAEFRIWHEG-----GEMFYAMFEKGQKAGGASL--IRCDRFEAASEAVNR
TRMA_NEIMB      ESPDKHYRMRAEFRIWHEG-----GEMFYAMFEKGQKASGASM--IRCDRFEAASEAVNR
TRMA_DICNV      PSPEKHYRMRAEFRIWRDD-----EQLFYAMS-RGGALTAQNI--VRLHNFPPAYITIDR
TRMA_ECOBR      RSPVSHYRMRAEFRIWHDG-----DDLYHIIFDQ----QTKSR--IRVDSFPAASELINQ
TRMA_ECOHS      RSPVSHYRMRAEFRIWHDG-----DDLYHIIFDQ----QTKSR--IRVDSFPAASELINQ
TRMA_ECO8A      RSPVSHYRMRAEFRIWHDG-----DDLYHIIFDQ----QTKSR--IRVDSFPAASELINQ
TRMA_ECOSE      RSPVSHYRMRAEFRIWHDG-----DDLYHIIFDQ----QTKSR--IRVDSFPAASELINQ
TRMA_ECOLI      RSPVSHYRMRAEFRIWHDG-----DDLYHIIFDQ----QTKSR--IRVDSFPAASELINQ
TRMA_ECODH      RSPVSHYRMRAEFRIWHDG-----DDLYHIIFDQ----QTKSR--IRVDSFPAASELINQ
TRMA_ECOBW      RSPVSHYRMRAEFRIWHDG-----DDLYHIIFDQ----QTKSR--IRVDSFPAASELINQ
TRMA_ECOLC      RSPVSHYRMRAEFRIWHDG-----DDLYHIIFDQ----QTKSR--IRVDSFPAASELINQ
TRMA_ECO55      RSPVSHYRMRAEFRIWHDG-----DDLYHIIFDQ----QTKSR--IRVDSFPAASELINQ
TRMA_ECO24      RSPVSHYRMRAEFRIWHDG-----DDLYHIIFDQ----QTKSR--IRVDSFPAASELINQ
TRMA_SHIB3      RSPVSHYRMRAEFRIWHDG-----DDLYHIIFDQ----QTKSR--IRVDSFPAASELINQ
TRMA_SHISS      RSPVSHYRMRAEFRIWHDG-----DDLYHIIFDQ----QTKSR--IRVDSFPAASELINQ
TRMA_ECOSM      RSPVSHYRMRAEFRIWHDG-----DDLYHIIFDQ----QTKSR--IRVDSFPAASELINQ
TRMA_ECOLU      RSPVSHYRMRAEFRIWHDG-----DDLYHIIFDQ----QTKSR--IRVDSFPAASELINQ
TRMA_ECOUT      RSPVSHYRMRAEFRIWHDG-----DDLYHIIFDQ----QTKSR--IRVDSFPAASELINQ
TRMA_ECOL5      RSPVSHYRMRAEFRIWHDG-----DDLYHIIFDQ----QTKSR--IRVDSFPAASELINQ
TRMA_ECOK1      RSPVSHYRMRAEFRIWHDG-----DDLYHIIFDQ----QTKSR--IRVDSFPAASELINQ
TRMA_ECO45      RSPVSHYRMRAEFRIWHDG-----DDLYHIIFDQ----QTKSR--IRVDSFPAASELINQ
TRMA_ECOL6      RSPVSHYRMRAEFRIWHDG-----DDLYHIIFDQ----QTKSR--IRVDSFPAASELINQ
TRMA_ECO57      RSPVSHYRMRAEFRIWHDG-----DDLYHIIFDQ----QTKSR--IRVDSFPAASELINQ
TRMA_ECO5E      RSPVSHYRMRAEFRIWHDG-----DDLYHIIFDQ----QTKSR--IRVDSFPAASELINQ
TRMA_SHIBS      RSPVSHYRMRAEFRIWHDG-----DDLYHIIFDQ----QTKSR--IRVDSFPAASELINQ
TRMA_SHIFL      RSPVSHYRMRAEFRIWHDG-----DDLYHIIFDQ----QTKSR--IRVDSFPAASELINQ
TRMA_SHIF8      RSPVSHYRMRAEFRIWHDG-----DDLYHIIFDQ----QTKSR--IRVDSFPAASELINQ
TRMA_SHIDS      RSPVSHYRMRAEFRIWHDG-----DDLYHIIFDQ----QTKSR--IRVDSFPAASELINQ
TRMA_ECO27      RSPVSHYRMRAEFRIWHDG-----DDLYHIIFDQ----QTKSR--IRVDSFPAASELINQ
TRMA_ECO7I      RSPVSHYRMRAEFRIWHDG-----DDLYHIIFDQ----QTKSR--IRVDSFPAASELINQ
TRMA_ECO81      RSPVSHYRMRAEFRIWHDG-----DDLYHIIFDQ----QTKSR--IRVDSFPAASELINQ
TRMA_ESCF3      RSPVSHYRMRAEFRIWHDG-----DDLYHIIFDQ----QTKSR--IRVDSFPAASELINQ
TRMA_ENT38      RSPVSHYRMRAEFRIWHDG-----DDLYHIIFDQ----QTKSR--IRVNSFPAASELINQ
TRMA_CITK8      RSPASHYRMRAEFRLWHDG-----DDLYHIIFEQ----QTKSR--IRVDSFPAASELINQ
TRMA_SALA4      RSPVSHYRMRAEFRLWHDG-----DDLYHIMFDQ----QTKSR--IRVDTFPAASQLINT
TRMA_SALSV      RSPVSHYRMRAEFRLWHDG-----DDLYHIMFDQ----QTKSR--IRVDTFPAASQLINT
TRMA_SALCH      RSPVSHYRMRAEFRLWHDG-----DDLYHIMFDQ----QTKSR--IRVDTFPAASQLINT
TRMA_SALDC      RSPVSHYRMRAEFRLWHDG-----DDLYHIMFDQ----QTKSR--IRVDTFPAASQLINT
TRMA_SALEP      RSPVSHYRMRAEFRLWHDG-----DDLYHIMFDQ----QTKSR--IRVDTFPAASQLINT
TRMA_SALG2      RSPVSHYRMRAEFRLWHDG-----DDLYHIMFDQ----QTKSR--IRVDTFPAASQLINT
TRMA_SALTY      RSPVSHYRMRAEFRLWHDG-----DDLYHIMFDQ----QTKSR--IRVDTFPAASQLINT
TRMA_SALPA      RSPVSHYRMRAEFRLWHDG-----DDLYHIMFDQ----QTKSR--IRVDTFPAASQLINT
TRMA_SALPC      RSPVSHYRMRAEFRLWHDG-----DDLYHIMFDQ----QTKSR--IRVDTFPAASQLINT
TRMA_SALPK      RSPVSHYRMRAEFRLWHDG-----DDLYHIMFDQ----QTKSR--IRVDTFPAASQLINT
TRMA_SALTI      RSPVSHYRMRAEFRLWHDG-----DNLYHIMFDQ----QTKSR--IRVDTFPAASQLINT
TRMA_SALHS      RSPVSHYRMRAEFRLWHDG-----DDLYHIMFDQ----QTKSR--IRVDTFPAASQLINT
TRMA_SALNS      RSPVSHYRMRAEFRLWHDG-----DDLYHIMFDQ----QTKSR--IRVDTFPAASQLINT
TRMA_SALPB      RSPVSHYRMRAEFRLWHDG-----DDLYHIMFDQ----QTKSR--IRVDTFPAASQLINT
TRMA_SALAR      RSPASHYRMRAEFRLWHDG-----DDLYHIMFDQ----QTKSR--IRVDSFPAASQLINT
TRMA_KLEP3      RSPVSHYRMRAEFRLWHDG-----DDLYHIIFDQ----QTRSR--IRVDSFPAASALINQ
TRMA_KLEP7      RSPVSHYRMRAEFRLWHDG-----DDLYHIIFDQ----QTRSR--IRVDSFPAASALINQ
TRMA_CROS8      RSPVSHYRMRAEFRLWHDG-----DDLYHIIFDQ----ETRSR--IRVDSFPAASELINA
TRMA_ERWT9      RSAVSHYRMRAEFRIWHEG-----DDLYHIIFDQ----QTRER--IRVDSFPAASELINR
TRMA_PHOLL      RSPLSHYRMRAEFRIWHEQ-----DDLYHIMFDQ----QTKQR--IRLVQFPVASKLINK
TRMA_PROMH      SSPEQHYRMRAEFRIWHEQ-----DALYHIMFDQ----ETKQR--IRVDQFPVASQLINQ
TRMA_PECAS      RSPVSHYRMRAEFRIWHDG-----DELYHIMFDQ----QTKQR--IRVDRFPAASELINR
TRMA_PECCP      RSPVSHYRMRAEFRIWHEG-----DELYHIMFDQ----QTKQR--IRVDRFPAASELINR
TRMA_DICP7      RSPVSHYRMRAEFRIWHDG-----DDLYHIMFDQ----QTKHR--IRVDQFPVASELINR
TRMA_DICC1      RSPVSHYRMRAEFRIWHDG-----DDLYHIMFDQ----QTKQR--IRVDQFPAASELINR
TRMA_EDWI9      RSPVSHYRMRAEFRIWHDG-----DDLYHIMFDP----QSKQR--IRVDQFPAASELINR
TRMA_YERPE      RSPADHYRMRAEFRVWHDE-----DDLYHIMFDQ----QTKQR--IRVEQFPVASRLINR
TRMA_YERPP      RSPADHYRMRAEFRVWHDE-----DDLYHIMFDQ----QTKQR--IRVEQFPVASRLINR
TRMA_YERPY      RSPADHYRMRAEFRVWHDE-----DDLYHIMFDQ----QTKQR--IRVEQFPVASRLINR
TRMA_YERPG      RSPADHYRMRAEFRVWHDE-----DDLYHIMFDQ----QTKQR--IRVEQFPVASRLINR
TRMA_YERPA      RSPADHYRMRAEFRVWHDE-----DDLYHIMFDQ----QTKQR--IRVEQFPVASRLINR
TRMA_YERPN      RSPADHYRMRAEFRVWHDE-----DDLYHIMFDQ----QTKQR--IRVEQFPVASRLINR
TRMA_YERPS      RSPADHYRMRAEFRVWHDE-----DDLYHIMFDQ----QTKQR--IRVEQFPVASRLINR
TRMA_YERPB      RSPADHYRMRAEFRVWHDE-----DDLYHIMFDQ----QTKQR--IRVEQFPVASRLINR
TRMA_YERP3      RSPADHYRMRAEFRVWHDE-----DDLYHIMFDQ----QTKQR--IRVEQFPVASRLINR
TRMA_YERE8      RSPAEHYRMRAEFRVWHDE-----DDLYHIMFDQ----QTKLR--IRVEQFPVASLLINR
TRMA_SERP5      RSPVSHYRMRAEFRIWHDE-----DEMYHIMFDQ----QTKQR--IRVDKFPAASELINR
TRMA_SODGM      RSQPAHYRMRAEFRIWHDE-----DDLYHIMFDP----QTKAR--IRIDHFMPGSPLINA
TRMA_ACTP2      ESETGHFRMRAEFRVWHDTNEVGENELYHIMFDQ----ETKQR--YCVEQFPIANHLINK
TRMA_ACTP7      ESETSHFRMRAEFRVWHDTNEVGENELYHIMFDQ----ETKQR--YRVEQFPIANHLINK
TRMA_ACTPJ      ESETSHFRMRAEFRVWHDTNEVGENELYHIMFDQ----ETKQR--YRVDQFPIANHLINK
TRMA_HAEDU      ASETSHFRMRAEFRVWHQKNEQGENDLYHIMFDP----TTKQR--YRVDQLPIANQLINT
TRMA_HAEPS      ASDTSHFRLRAEFRVWHDNG-----DLYHIMFDQ----ATKQR--YRVDQFPIASQLINR
TRMA_HAEIN      DSPTSHYRMRAEFRIWHEQ-----DDFYHIMFDQ----ATLQR--YRVDEFPIASMLINR
TRMA_HAEI8      DSPTSHYRMRAEFRIWHEQ-----DDFYHIMFDQ----ATLQR--YRVDEFPIASMLINR
TRMA_HAEIE      DSPTSHYRMRAEFRIWHEQ-----DDFYHIMFDQ----ATLQR--YRVDEFPIASTQINR
TRMA_MANSM      VSPVQNYRMRAEFRVWHDK-----GDLYHIMFNQ----QTKQR--YRVDCFPIASLLINR
TRMA_HAES1      ASETSHFRMRAEFRIWHEQ-----DDFYHIMFDQ----KTKQR--FRIDQFPIASQLINQ
TRMA_HISS2      ASETSHFRMRAEFRIWHEQ-----DDFYHIMFDQ----KTKQR--FRIDQFPIASQLINQ
TRMA_PASMU      PSPVQHYRMRAEFRIWHDK-----GDFYHIMFDQ----RTRQR--YRVDCFPMASQLINQ
TRMA_AGGAN      ASPTQHFRMRAEFRIWHEG-----DDFYHIMFDQ----QSKQR--YRVDNFPIASELINR
TRMA_ACTSZ      PSPTQHFRMRAEFRLWHDYSENRGGNLYHIMFDK----TTKQR--YRVDQFPVASQLINR
TRMA_TOLAT      ASAPSHYRMRAEFRIWHEGV----DELYYVMFNS----ETKQR--YYVHEFPTGSQLINR
TRMA_AERHH      ASPAEHYRMRAEFRIWHDG-----DDLYHCMYAP----ATKEI--IRVDQFPTASRLINQ
TRMA_AERS4      ASPAEHYRMRAEFRIWHEG-----DDLFHCMYAQ----ATKEI--IRVDHFPTASLLINQ
TRMA_ALIF1      SSPAENYRMRAEFRVWHEG-----DEMYYVMFNQ----ETKEK--YRVDYFLPASRLIND
TRMA_ALIFM      SSPAENYRMRAEFRVWHEG-----DEMYYVMFNQ----ETKEK--YRVDYFLPASRLIND
TRMA_ALISL      SSPAENYRMRAEFRIWHEG-----DDMYYVMFDQ----KTKEK--YRVDYFLPATRLIND
TRMA_PHOPR      ASPAEHYRMRAEFRMWHEG-----EDLYYVMFNQ----ETREK--YRVDQFPAASRLIND
TRMA_VIBCH      ESPVANYRMRAEFRIWHEG-----DDMYYIMFNQ----ETREK--YRVDQFPAASRLIND
TRMA_VIBC3      ESPVANYRMRAEFRIWHEG-----DDMYYIMFNQ----ETREK--YRVDQFPAASRLIND
TRMA_VIBCM      ESPVANYRMRAEFRIWHEG-----DDMYYIMFNQ----ETREK--YRVDQFPAASRLIND
TRMA_VIBCB      ESPEQHYRMRAEFRVWHEG-----EDLYYIMFNQ----ETREK--YRVDQFPAASRLIND
TRMA_VIBPA      ESPEQHYRMRAEFRVWHEG-----EDLYYIMFNQ----ETREK--YRVDQFPAASRLIND
TRMA_VIBVU      ESPDQHYRMRAEFRVWHEG-----EEMYYIMFNQ----ETREK--YRVDQFPAASRLIND
TRMA_VIBVY      ESPEQHYRMRAEFRVWHEG-----EEMYYIMFNQ----ETREK--YRVDQFPAASRLIND
TRMA_VIBTL      ESPEQHYRMRAEFRVWHEG-----DDMYYVMFNQ----ETKEK--YRVDQFPAASRLIND
TRMA_SHEB5      ASEPANYRMRAEFRMWHDG-----DDLYYYMFDK----VLNEK--VRCDQYLPASVLINQ
TRMA_SHEB9      ASEPANYRMRAEFRMWHDG-----DDLYYYMFDK----VLNEK--VRCDQYLPASVLINQ
TRMA_SHEB2      ASEPANYRMRAEFRMWHDG-----DDLYYYMFDK----VLNEK--VRCDQYLPASVLINQ
TRMA_SHEB8      ASEPANYRMRAEFRMWHDG-----DDLYYYMFDK----VLNEK--VRCDQYLPASVLINQ
TRMA_SHEPC      ASEPANYRMRAEFRMWHDG-----DDLYYYMFDK----VLNEK--VRCDQYLPASVLINQ
TRMA_SHESW      ASEPANYRMRAEFRMWHDG-----DDLYYYMFDK----VLNEK--VRCDQYLPASVLINQ
TRMA_SHESA      ASEPAHYRMRAEFRVWHEG-----DDLYYYMFDK----VLNDK--VRCDQYLPASALINQ
TRMA_SHESR      ASEPAHYRMRAEFRVWHEG-----DDLYYYMFDK----VLNDK--VRCDQYLPASALINQ
TRMA_SHESM      ASEPAHYRMRAEFRIWHEG-----DDLYYYMFDK----VLNDK--VRCDQYLPASALINQ
TRMA_SHEON      ASDPEHYRMRAEFRVWHEG-----DDLYYYMFDK----ALNDK--VRCDQYLPASTLINE
TRMA_SHEDO      ASEPAHYRMRAEFRVWHEG-----DDLYYYMFDK----VLDAK--VRCEQYLPASTLINA
TRMA_SHEFN      ASEPMHYRMRAEFRMWHQG-----DDLYYYMFDK----ALNAK--VRCDQYLPAGLIINQ
TRMA_SHEHH      SSEPAHYRMRAEFRVWHEG-----EDLYYYMFDK----ELNSK--VRCDQFLPASELINK
TRMA_SHEPA      SSEPAHYRMRAEFRVWHEG-----EDLYYYMFDK----ELNSK--VRCDQFLPASELINK
TRMA_SHEPW      SSETAHYRMRAEFRMWHEG-----EDLYYYMFDK----ELNSK--VRCDQFLPASELINK
TRMA_SHESH      SSEPAHYRMRAEFRIWHDG-----EDMYYYMFDK----ALDSK--VRCDQFLPASELINK
TRMA_SHEWM      SSEQAHYRMRAEFRIWHDG-----EDMYYYMFDK----ALNSK--VRCDQFLPASKLINE
TRMA_SHELP      ASQKAHYRMRAEFRVWHEG-----EDLYYYMFDK----AQNQK--IRCEQFLPASQLIND
TRMA_SHEAM      PSAPAHYRMRCEFRVWHDG-----DDLYYCMFDN----VAKEK--VRTDQFLPASELINR
TRMA_ALTMD      PSQPTHYRMRAEFRVWHEG-----DDLFHIMFDQ----ETKEK--YRVDSFPPACKTIND
TRMA_PSEA6      SSAPLNYRMRAEFRMWHDG-----DNLDHVMFDQ----STKQK--YAVNQFPPASIVINE
TRMA_PSYIN      ASPKLHYRMRAELRVWHDG-----DELYYIMFDK----KTKQK--FRVEQFPPASELINN
TRMA_PSEHT      SSEPINYRQRAEFRVWHDG-----DDLFHIMFDQ----QTKDK--IRVDSFDPAAPLVGE
TRMA_COLP3      PSVPLNYRQRAEFRVWHEG-----DDLYYIMFDS----KTKEK--FRVDDFPVASELINN
TRMA_IDILO      ESPASHYRMRAEFRVWHEG-----DDLYYIMFNP----ETREK--IRMNEFIPGSLLINE
TRMA_MARMS      ASQPTHYRMRAEFRIWHDG-----DDLYYAMFDS---ADPRTP--IRTDQFLAASRLINE
TRMA_HYDCU      ASEPEHYRARAEFRVWHEG-----DQTDYIMFDQ----QSKEK--VAIHHCPMALESIAT
TRMA_CELJU      RSPEKHFRMRTEFRIWHER-----GTAMYVMFSQ----TDKRP--YPIREFPIGSERINQ
TRMA_AROAE      PSAPLHYRLRAEFRMWHDGE-----RIDYAMFD--PA-EPKQP--IAIEQFDIAAEPICA
TRMA_AZOSB      RSEPLHYRLRAEFRIWHSEG-----RLDYAMFD--PA-DPKRP--VLIDGFPAAAAPIAA
TRMA_DECAR      ASAPLHYRMRAEFRIWHEGD-----DLNYAMFD--PA-DPKQP--ITLETFPPAAESICH
TRMA_PSEAE      ESPREHYRLRAEFRLWRETGN---EKRHYAMFE--QG-DKHTP--ILLEDFPIASRRINE
TRMA_PSEA8      ESPREHYRLRAEFRLWRETGN---EKRHYAMFE--QG-DKHTP--ILIEDFPIASRRINE
TRMA_PSEAB      ESPREHYRLRAEFRLWRETGN---EKRHYAMFE--QG-DKHTP--ILIEDFPIASRRINE
TRMA_PSEA7      ESPREHYRLRAEFRLWRETGN---ENRHYAMFE--QG-DKHTP--ILIEDFPIASRRINE
TRMA_AZOVD      DSPREHYRLRAEFRLWREG-----EARHYAMFD--PG-DKRKP--ILLDDFPIASERIND
TRMA_PSEMY      DSPREHYRLRAEFRLWREDG-----QRHYAMFA--PG-DKHTP--ILLDDFPIASLRINE
TRMA_PSEU5      DSPREHYRLRAEFRLWREGG-----QRHYAMFE--QG-DKHKA--ILIDDFPIASRRINE
TRMA_PSEP1      DSPREHYRLRAEFRLWREDG-----QRHYAMFA--PG-EKHKA--ILIDDFPIASERINA
TRMA_PSEPK      DSPREHYRLRAEFRLWREDG-----QRHYAMFA--PG-EKHKA--ILIDDFPIASERINA
TRMA_PSEPG      DSPREHYRLRAEFRLWREDG-----QRHYAMFA--QG-DKHKA--ILIDDFPIASQRINA
TRMA_PSEPW      DSPREHYRLRAEFRLWREDG-----QRHYAMFA--PG-EKHKA--ILIDDFPIASERINA
TRMA_PSEE4      DSPREHYRLRAEFRLWREGG-----QRHYAMFA--PG-EKHKA--ILIDDFPIASQRINE
TRMA_PSEFL      DSPLQNFRLRAEFRLWREGG-----ERHYAMFS--QD-DKRTP--ILIEEFPIASLRINQ
TRMA_PSEFS      DSPLQNFRLRAEFRLWREGG-----ERHYAMFS--QD-DKRTP--ILIEEFPIASQRINQ
TRMA_PSEPF      DSPLQNFRLRAEFRLWREGG-----ERHYAMFS--QD-DKRTP--ILIEEFPIASLRINQ
TRMA_PSEF5      DSPLQNFRLRAEFRLWREAG-----ERHYAMFS--QD-DKRTP--ILIEEFPIASQRINQ
TRMA_PSE14      DSPREHYRLRAEFRLWREDQ-----KRYYAMFA--PG-DNRTP--ILLEGLPIASERINA
TRMA_PSEU2      DSPREHYRLRAEFRLWREDQ-----KRYYAMFA--PG-DNRTP--ILLEGLPIASERINA
TRMA_PSESM      DSPREHYRLRAEFRLWREDQ-----KRYYAMFA--PG-DNKTP--ILLEGLPIASQRINA
TRMA_CHRSD      PSPPSHYRQRCEFRLWHEGD-----DLFYAMFEVDPS-DPKRKEVIRLDDYPVASERINA
TRMA_SACD2      PSPPSHYRMRAEFKMW--QQGAE---AFYAMYQP----GEYKKPVTLEWEFSVGAEKIVE
TRMA_TERTT      RSPASEYRMRAEFKIWHDKDTGR---ACYAMHQP----KVKNQVIPIE-DFEIGSARIRE
TRMA_SULNB      DSPDSRYRARAEFRIWHES-----ERCDYAMGNI----EKKGA--VTIEECPKVIEPIEK
TRMA_NITSB      PSKQSRYRARAEFRYIDG---------EYAMHRL----HEKGL--VTIDACEMVLESIYE
TRMA_SULDN      ESPRSNYRSRSEFKIWHEGD----EKINYAMNRA----DKGGV--ILIDECPQVSSAIFA
TRMA_WOLSU      PSAPHSFRARAEFRL---YRN-ESGRLSYAMSQK----GSKQP--LPIQSCPILLPSIQA
TRMA_HELHP      ASPQEGFRARAEFRFSHVFQN-KSG-LDFAMNAF----GYNHR--VPIKKCPILLPTLQD
TRMA_CAMC1      SSSPKHYRTRAEFGIWH-----EGSKLSYTMHASE------KGKKVFIDECPKVCEQISH
TRMA_CAMC5      SSKPQRYRSRAEFGIWH-----ENDEIYYTMHGS-------RSKFIKISECLKVDESIAA
TRMA_CAMFF      RSPISKFRSRAEFGLYH-----DDNSLSYTMRRA-------DGGYLKIDKCSIVDEKISV
TRMA_CAMHC      KSDEWNFRNHAEFGIWH-----EKGDVFYTMRGN-------SNERVKIETCPKMDKKIVE
TRMA_CAMJE      ASKDKHYRTRAELSFYH-----ENDTLFYAMFDPK------SKKKYIIEYLDFADEKICA
TRMA_CAMJ8      ASKDKHYRTRAELSFYH-----ENDTLFYAMFDPK------SKKKYIIEYLDFADEKICA
TRMA_CAMJJ      TSKDKHYRTRAELSFYH-----ENDTLFYAMFDPK------SKKKYIIEYLDFADEKICA
TRMA_CAMJR      ASKDKHYRTRAELSFYH-----ENDTLFYAMFDPK------NKKKYIIKYLDFADEKICT
TRMA_CAMJD      TSKDKHYRTRAELSFYH-----ENDTLFYAMFDPK------SKKKYIIEYLDFADEKICA
TRMA_CAMLR      KSPLKAYRTRAEFCIYHH----ENGEISYAMYE--------NKKKIPIKNFEIADEKIQA
TRMA_ARCB4      KSNESNFRNRAEFRIWWEKGENNKEILSYAMNDF-------KKNILKINSCEMVSFHIKE
TRMA_NAUPA      HGSDEHFRARAEFRVWH-----EGDKSYYAMRKRKED----GRGVIPIEECKIVDKAIYD
                 .    :* : *:               . :                          :  

TRMA_ACIB5      LMPLLLAELK-ANSLLSQRLFEVDFLATLSGEMLVTLIYHRKL----------NQEWEQA
TRMA_ACIBS      LMPLLLAELK-ANSLLSQRLFEVDFLATLSGEMLVTLIYHRKL----------NQEWEQA
TRMA_ACIB3      LMPLLLAELK-ANSLLSQRLFEVDFLATLSGEMLVTLIYHRKL----------NQEWEQA
TRMA_ACIBT      LMPLLLAELK-ANSLLSQRLFEVDFLATLSGEMLVTLIYHRKL----------NQEWEQA
TRMA_ACIBY      LMPLLLAELK-ANSLLSQRLFEVDFLATLSGEMLVTLIYHRKL----------NQEWEQA
TRMA_ACIBC      LMPLLLAELK-ANSLLSQRLFEVDFLATLSGEMLVTLIYHRKL----------NQEWEQE
TRMA_ACIAD      LMPRLLEELK-ANPTLSQRIFEADFLTTLSGEMLVTLIYHRKL----------DTEWESA
TRMA_NEIG1      LMPELIAVAA-QSAELRNHWYAVEFLSTLSGEMLVTMIYHKRL----------DDEWMKA
TRMA_NEIG2      LMPELIAVAA-QSAELRNHWYAVEFLSTLSGEMLVTMIYHKRL----------DDEWMKA
TRMA_NEIM0      LMPELIAVAA-QSAELRNRWYAVEFLSTLSGEMLVTMIYHKRL----------DNEWMQA
TRMA_NEIMF      LMPELIAVAA-QSAELRNRWYAVEFLSTLSGEMLVTMIYHKRL----------DNEWMQA
TRMA_NEIMA      LMPELIAVAA-QSAELRNRWYAVEFLSTLSGEMLVTMIYHKRL----------DDEWMQA
TRMA_NEIMB      LMPELIAAAA-QSPELKKRWYAVEFLSTLSGEMLVTMIYHKRL----------DAEWMQA
TRMA_DICNV      CMPLLLDALR-ADPVLHHKLYEVHFLASLRGELLVSLIYHRAL----------TDEWTAA
TRMA_ECOBR      LMTAMIAGVR-NNPVLRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DDEWRQE
TRMA_ECOHS      LMTAMIAGVR-NNPVLRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DDEWRQE
TRMA_ECO8A      LMTAMIAGVR-NNPVLRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DDEWRQE
TRMA_ECOSE      LMTAMIAGVR-NNPVLRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DDEWRQE
TRMA_ECOLI      LMTAMIAGVR-NNPVLRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DDEWRQE
TRMA_ECODH      LMTAMIAGVR-NNPVLRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DDEWRQE
TRMA_ECOBW      LMTAMIAGVR-NNPVLRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DDEWRQE
TRMA_ECOLC      LMTAMIAGVR-NNPVLRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DDEWRQE
TRMA_ECO55      LMTAMIAGVR-NNPVLRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DDEWRQE
TRMA_ECO24      LMTAMIAGVR-NNPVLRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DDEWRQE
TRMA_SHIB3      LMTAMIAGVR-NNPVLRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DDEWRQE
TRMA_SHISS      LMTAMIAGVR-NNPVLRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DDEWRQE
TRMA_ECOSM      LMTAMIAGVR-NNPVLRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DDEWRQE
TRMA_ECOLU      LMTAMIAGVR-NNPVLRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DDEWRQE
TRMA_ECOUT      LMTAMIAGVR-NNPILRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DDEWRQQ
TRMA_ECOL5      LMTAMIAGVR-NNPILRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DDEWRQQ
TRMA_ECOK1      LMTAMIAGVR-NNPILRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DDEWRQQ
TRMA_ECO45      LMTAMIAGVR-NNPILRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DDEWRQQ
TRMA_ECOL6      LMTAMIAGVR-NNPILRHKLFQIDYLTTLRNQAVVSLLYHKKL----------DDEWRQQ
TRMA_ECO57      LMTAMIAGVR-NNPVLRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DDEWRQE
TRMA_ECO5E      LMTAMIAGVR-NNPVLRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DDEWRQE
TRMA_SHIBS      LMTAMIAGVR-NNPVLRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DDEWRQE
TRMA_SHIFL      LMTAMIAGVR-NNPVLRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DDEWRQE
TRMA_SHIF8      LMTAMIAGVR-NNPVLRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DDEWRQE
TRMA_SHIDS      LMTAMIAGVR-NNPVLRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DDEWRQE
TRMA_ECO27      LMTAMIAGVR-NNPVLRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DDEWRQQ
TRMA_ECO7I      LMSAMIAGVR-NNPVLRHKLFQIDYLTTLSNQAVVSLLYHKKL----------NDEWRQQ
TRMA_ECO81      LMTAMIAGVR-NNPFLRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DDEWRQE
TRMA_ESCF3      LMTAMIAGVR-NNPVLRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DDEWRQQ
TRMA_ENT38      LMTLMIEGVR-NNPQLRHKLFQIDYLTTQSNQAIVSMLYHKKL----------GDEWRKE
TRMA_CITK8      LMTAMIEGVR-HNRVLRHKLFQIDYLTTMSNQAVVSLLYHKKL----------DDEWRQE
TRMA_SALA4      LMKAMIAGVR-DNHALRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DEEWREA
TRMA_SALSV      LMKAMIAGVR-DNHALRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DEEWREA
TRMA_SALCH      LMKAMIAGVR-DNHALRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DEEWREA
TRMA_SALDC      LMKAMIAGVR-DNHALRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DEEWREA
TRMA_SALEP      LMKAMIAGVR-DNHALRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DEEWREA
TRMA_SALG2      LMKAMIAGVR-DNHALRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DEEWREA
TRMA_SALTY      LMKAMIAGVR-DNHALRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DEEWREA
TRMA_SALPA      LMKAMIAGVR-DNHALRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DEEWREA
TRMA_SALPC      LMKAMIAGVR-DNHALRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DEEWREA
TRMA_SALPK      LMKAMIAGVR-DNHALRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DEEWREA
TRMA_SALTI      LMKAMIAGVR-DNHALRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DEEWREA
TRMA_SALHS      LMKAMIAGVR-DNHALRHKLFQMDYLTTLSNQAVVSLLYHKKL----------DEEWREA
TRMA_SALNS      LMKAMIAGVR-DNHALRHKLFQMDYLTTLSNQAVVSLLYHKKL----------DEEWREA
TRMA_SALPB      LMKAMIAGVR-DNHALRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DEEWREA
TRMA_SALAR      LMKAMIAGVR-DNHALRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DEEWREA
TRMA_KLEP3      LMTAMLEGVR-NNPVLRHKLFQIDYLTTLSNQAVVSLLYHKKL----------DDTWREQ
TRMA_KLEP7      LMTAMLEGVR-NNPVLRQKLFQIDYLTTLSNQAVVSVLYHKKL----------DDAWREQ
TRMA_CROS8      LMPRMIAGIR-DNRTLRHKLFQIDYLTTRSQQAVVSLLYHRAL----------DDAWREE
TRMA_ERWT9      LMPRLIEKIR-DQRLLRFKLFQVDYLSTVSGQIVVSMLYHRKL----------DEEWQQA
TRMA_PHOLL      MMVVLIDSIR-SEQILCHKLFQIDYLSTCSNKILVSLLYHKKL----------GEEWTQQ
TRMA_PROMH      MMVALLAEIK-DKPTLRHKLFQIDYLSTLSNKIIVSLLYHKKI----------DETWQQE
TRMA_PECAS      LMPEMLAAIQ-PDPVLRRKLFQIDYLSTLSGEVIVSLLYHRAL----------NEEWQEH
TRMA_PECCP      LMPELLAAIQ-PDSVLRRKLFQIDYLSTLSGEVIVSLLYHRAL----------DEEWQEH
TRMA_DICP7      LMPALLNALR-PHLTLRRKLFQIDYLSTMSNEIVVSLLYHKTL----------DDEWRQQ
TRMA_DICC1      LMPVLLNALR-AEPVLRRKLFQLDYLSTLSGEIAVSLLYHKAL----------DDEWRQR
TRMA_EDWI9      LMPLLLDALR-PNPTLRHKLFQIDYLSTRSGQIIVSLLYHRTL----------DDAWKQA
TRMA_YERPE      LMDALMTAIR-AEPLLRRKLFQIDYLSTLSGKLIASLLYHRQL----------DEEWQQK
TRMA_YERPP      LMDALMTAIR-AEPLLRRKLFQIDYLSTLSGKLIASLLYHRQL----------DEEWQQK
TRMA_YERPY      LMDALMTAIR-AEPLLRRKLFQIDYLSTLSGKLIASLLYHRQL----------DEEWQQK
TRMA_YERPG      LMDALMTAIR-AEPLLRRKLFQIDYLSTLSGKLIASLLYHRQL----------DEEWQQK
TRMA_YERPA      LMDALMTAIR-AEPLLRRKLFQIDYLSTLSGKLIASLLYHRQL----------DEEWQQK
TRMA_YERPN      LMDALMTAIR-AEPLLRRKLFQIDYLSTLSGKLIASLLYHRQL----------DEEWQQK
TRMA_YERPS      LMDALMTAIR-AEPLLRRKLFQIDYLSTLSGKLIASLLYHRQL----------DEEWQQK
TRMA_YERPB      LMDALMTAIR-AEPLLRRKLFQIDYLSTLSGKLIASLLYHRQL----------DEEWQQK
TRMA_YERP3      LMDALMTAIR-AEPLLRRKLFQIDYLSTLSGKLIASLLYHRQL----------DEEWQQK
TRMA_YERE8      LMSALMTAIR-AEPILRHKLFQIDYLSTLSGKLLATLLYHRPL----------DEEWQQK
TRMA_SERP5      LMSALIAAIK-PEPILRRKLFQIDYLSTRSGKIIASLLYHRKL----------DDEWQQQ
TRMA_SODGM      LMAEMMTAIR-PEPLLRAKLFQIDYLTTQSGEAVVTLIYHRPL----------DDAWREC
TRMA_ACTP2      MMSSLLAEIK-GNELLTRKLFQVDYLSTLSGEIAVSMLYHKKL----------NEEWQAE
TRMA_ACTP7      MMSSLLAEIK-GNELLTRKLFQVDYLSTLSGEIAVSMLYHKKL----------NEEWQAE
TRMA_ACTPJ      MMSSLLAEIK-GNELLTRKLFQVDYLSTLSGEIAVSMLYHKKL----------NEEWQAE
TRMA_HAEDU      MMQKLLTQIQ-GIPVLTHKLFQVDYLTTLSGEIAISLLYHKKL----------TDEWLAQ
TRMA_HAEPS      MMTVLLAEIK-GNELLTRKLFQIDYLSTLSGQIAVSMLYHKSL----------TEEWIEQ
TRMA_HAEIN      MMQTLLPLLK-QQEVLHKKLFQIDYLSTLSNKIIVSLLYHKTL----------TEEWESA
TRMA_HAEI8      MMQTLLPLLK-QQEVLHKKLFQIDYLSTLSNKIIVSLLYHKTL----------TEEWESA
TRMA_HAEIE      MMQTLLPLLK-QQEVLHKKLFQIDYLSTLSNKIIVSLLYHKTL----------TEEWESA
TRMA_MANSM      MMENLIPLLK-EQEILTKKLFQIDYLSTLSNKIIVSLLYHKTL----------TEEWQAA
TRMA_HAES1      MMLALLPLLK-QHNILTHRLFQIDYLSTLSNKIIVSLLYHKTL----------NEEWLQA
TRMA_HISS2      MMLALLPLLK-QHNILTHRLFQIDYLSTLSNKIIVSLLYHKTL----------NEEWLQA
TRMA_PASMU      MMDTLLPLLK-TNRVLHHKLFQIDYLSTLSNKIIVSLLYHKTL----------DEEWEQA
TRMA_AGGAN      MMTALLPLLK-QQTVLHHRLFQIDYLSTQSQHIIVSLLYHKAL----------DEDWQAA
TRMA_ACTSZ      MMATILPLLK-EQDVLSRKLFQIDYLSTLSEQIIVSLLYHKTL----------TDEWQEA
TRMA_TOLAT      LMPRLLELIR-GNHTLKYKLFQIDFLTTLSGEALISLLYHKTL----------NEAWQPA
TRMA_AERHH      LMPVLLEGLR-PHPVLRRKLFQIDYLSTQSGQICVSLLYHRKL----------ESEWQQA
TRMA_AERS4      LMPVLLAGLR-PHFVLRRKLFQIDYLSTQSGQIIVSLLYHRKL----------EAEWQQA
TRMA_ALIF1      LMPLLTEAVK-ESKTLRYKMFQVDFLSTLSGEILVSMLYHRQL----------DDAWKEE
TRMA_ALIFM      LMPLLTEAVK-ESKTLRYKMFQVDFLSTLSGEILVSMLYHRQL----------DDAWKEE
TRMA_ALISL      LMPLLAEAIK-GSKTLRYKMFQVDFLSTLSGEILVSMLYHRQL----------DDAWKEE
TRMA_PHOPR      LMPLLVEALK-PSQTLRHKLFQVDFLSTLSGEILVSLLYHRQL----------DEEWEVE
TRMA_VIBCH      LMPLLMDAMK-GSPILRHKLFQVDFLSTLSGEILVSLLYHRQL----------SEEWITA
TRMA_VIBC3      LMPLLMDAMK-GSPILRHKLFQVDFLSTLSGEILVSLLYHRQL----------SEEWITA
TRMA_VIBCM      LMPLLMDAMK-GSPILRHKLFQVDFLSTLSGEILVSLLYHRQL----------SEEWITA
TRMA_VIBCB      LMPLLVEAMK-DNESLRRKLFQVDFLSTLSGEILVSLLYHRQL----------DEEWIEN
TRMA_VIBPA      LMPLLVEAMK-DNESLRRKLFQVDFLSTLSGEILVSLLYHRQL----------DEEWIEN
TRMA_VIBVU      LMPLLIDAMK-DNESLRRKLFQVDFLSTLSGEILVSLLYHRQL----------DDAWIEN
TRMA_VIBVY      LMPLLIDAMK-DNESLRRKLFQVDFLSTLSGEILVSLLYHRQL----------DDAWIEN
TRMA_VIBTL      LMPLLTDAMK-DNHSLRHKLFQVDFLSTLSGEILVSLLYHRQL----------GEQWIQD
TRMA_SHEB5      MMSALIAELK-PNPSLRHKLFQVDFLSTLSGEILVSLLYHRQL----------DDQWRAD
TRMA_SHEB9      MMSALIAELK-PNPSLRHKLFQVDFLSTLSGEILVSLLYHRQL----------DDQWRAD
TRMA_SHEB2      MMSALIAELK-PNPSLRHKLFQVDFLSTLSGEILVSLLYHRQL----------DDQWRAD
TRMA_SHEB8      MMSALIAELK-PNPSLRHKLFQVDFLSTLSGEILVSLLYHRQL----------DDQWRAD
TRMA_SHEPC      MMSALIAELK-PNPSLRHKLFQVDFLSTLSGEILVSLLYHRQL----------DDQWRTN
TRMA_SHESW      MMSALIAELK-PNPSLRHKLFQVDFLSTLSGEILVSLLYHRQL----------DDQWRTN
TRMA_SHESA      MMAALITELK-PNHSLRHKLFQVDFLSTLSGEILVSLLYHRQL----------DDQWRSE
TRMA_SHESR      MMAALIAELK-PNHSLRHKLFQVDFLSTLSGEILVSLLYHRQL----------DDQWRSE
TRMA_SHESM      MMAALIAELK-PNHSLRHKLFQVDFLSTLSGEILVSLLYHRQL----------DDQWRSE
TRMA_SHEON      MMAALIAELK-PNPSLRHKLFQVDFLSTLSGEILVSLLYHRQL----------DDQWRAE
TRMA_SHEDO      IMTSLVEELR-PNHSLRHRLFQVDFLSTLSGEILVSLLYHRQL----------DEQWQVE
TRMA_SHEFN      MMAALIAELT-PNPALRYRLFQVDFLSTLSGEILVSLLYHRQL----------DEEWREQ
TRMA_SHEHH      MMPALVELLK-PNTILRHRLFQIDFLSTLSGEILVSLLYHKQL----------DSEWEQQ
TRMA_SHEPA      MMPALVELLK-PNTILRHRLFQIDFLSTLSGEILVSLLYHKQL----------DSEWEQQ
TRMA_SHEPW      MMPVLVELLK-PNTILRHRLFQIDFLSTLSGEILVSLLYHKQL----------DAEWEEQ
TRMA_SHESH      VMPALMEELR-PNPTLRHRLFQIDFLSTLSGEILVSLLYHKQL----------DAQWEIE
TRMA_SHEWM      MMPALIAELK-PNPLLRHRLFQIDFLSTLSGEILVSLLYHKQL----------DEQWETE
TRMA_SHELP      MMPELMAALR-PNPVLRHKLFQVDFLSTLSGEILVSLLYHKQL----------DAQWQEE
TRMA_SHEAM      MMPALLDELR-PNRALRHKLFQVDFLSTLSGEILVSLLYHRQL----------DDQWLTE
TRMA_ALTMD      AMEKLLNEIR-PNEILRKKLFQIDYLSALSGELVISLLYHRQL----------DDEWEAA
TRMA_PSEA6      VMMKLLSLVK-KNEVLRRKLFQIDYLSTLTNEILVTLVYHKPL----------EDEWLKE
TRMA_PSYIN      LMPVLLELVK-SSEILRYKLFQIDFLSNLKGQVIVSLLYHKQL----------DDNWLVE
TRMA_PSEHT      VMQVMIDNLK-SCEILRRKLFQIDYLSTLSGEILVSLLYHKPL----------DEHWLSE
TRMA_COLP3      AMKALLATIK-DQRELRFKLFQVDFLSTLSGELLISMLYHKPL----------EDNWQIE
TRMA_IDILO      LMKELISLLK-PNDVLRRKLFQVDFLTTTTGEAIISLLYHRPL----------DDQWEQE
TRMA_MARMS      LMPKLLDAVR-DVPVLRYKLFQVDFLTTTTGEALISLLYHKPI----------DAEWNAA
TRMA_HYDCU      LMPKLMAHIV-QTPVLRQKLFQVDFLATLSGEMLVTLIYRKSLQTKTETGVENDVAWVDA
TRMA_CELJU      LMPELMALVN-RHECLRHKLFQVEFLTSLSNQALITLVYHKPL----------DEEWISA
TRMA_AROAE      AMPRLRERLR-ASETLKRRLFQVEFLATLSGELMISLIYHRPL----------DESWEAA
TRMA_AZOSB      AMPVLRERVM-ASEPLRRKLFQVEFLATLSGELMISLVYHRPL----------EADWEAA
TRMA_DECAR      LMPRLRDKLR-GNESLRRRLFQADFLATLSGEMLVTLIYHRQL----------DEAWEAA
TRMA_PSEAE      LMPRLKAAW--ADPALGFKLFQVEFLTTLAGDALITLCYHRPI----------DDAWRQA
TRMA_PSEA8      LMPRLKAAW--ADPALGFKLFQVEFLTTLAGDALITLCYHRPI----------DDAWRQA
TRMA_PSEAB      LMPRLKAAW--ADPALGFKLFQVEFLTTLAGDALITLCYHRPI----------DDAWRQA
TRMA_PSEA7      LMPRLKDAW--AEPALGFKLFQVEFLTTLAGDALITLCYHRPI----------DAAWQQA
TRMA_AZOVD      LMPRLKAAW--ENAALGFKLFQVEFLTTLAGDALITLCYHRPL----------DTFWQTA
TRMA_PSEMY      LMPRLRAAWR-ASEALSFKLFQVEFLTTLAGDALITLAYHRPL----------DEAWQAA
TRMA_PSEU5      LMPQLKAAWQ-ASEVLSFKLFQVEFLTTLSGDALITLAYHRPL----------DEAWQAE
TRMA_PSEP1      LMPRLKAAWQ-ASEELGNRLFQVEFLTTLAGDAMITMCYHRPL----------DEAWEVE
TRMA_PSEPK      LMPRLKAAWQ-ASEELGNRLFQVEFLTTLAGDAMITMCYHRPL----------DEAWEVE
TRMA_PSEPG      LMPRLKAAWQ-ASEELGNRLFQVEFLTTLAGDAMITMCYHRPL----------DEAWEVE
TRMA_PSEPW      LMPRLKAAWQ-ASDELSNRLFQVEFLTTLAGDAMVTMCYHRPL----------DDAWEVA
TRMA_PSEE4      LMPRLKAAWQ-GNEDLNNRLFQVEFLTTLAGDAMVTLCYHRPL----------DEAWEAA
TRMA_PSEFL      LMPQLKAAWQ-ASAALSHKLFQVEFLTTLAGDAMITLCYHRPL----------DEHWHTA
TRMA_PSEFS      LMPQLKAAWQ-ASAALSHKLFQVEFLTTLAGDAMITLCYHRPL----------DEHWHTA
TRMA_PSEPF      LMPQLKAAWQ-ASAALSHKLFQVEFLTTLAGDAMITLCYHRPL----------DEHWHAA
TRMA_PSEF5      LMPRLKAAWQ-ASAPLSHKLFQVEFLTTLAGDAMITLCYHRPL----------DEHWHKA
TRMA_PSE14      LMPVLRERWE-ASPTLNHKLFQVDFLTTLAGDAMITMCYHRPL----------DAEWQAA
TRMA_PSEU2      LMPVLRERWE-ASPTLNHKLFQVDFLTTLAGDAMITLCYHRPL----------DAEWQAA
TRMA_PSESM      LMPVLRERWE-ASPTLNHKLFQVDFLTTLAGDAMITMCYHRPL----------DDEWLAA
TRMA_CHRSD      LMPALREALL-ASDVLRRKLFQVEFLTTLSGEALVTLIYHRQL----------DAAWEQE
TRMA_SACD2      LMPKLLEIVN-ASELLRKRLFQVEFLTTTTGESVTTLIYHKPL----------TEEWQAE
TRMA_TERTT      LMPDVLAAVN-NSTLLKQKLFQIEFLTATSGDAVVSLIYHRPL----------SEQWQAE
TRMA_SULNB      RMWKLLEKINASQEVLKQRLFAVEFLATTTDECLVTMLYHRKL----------DEAWSEE
TRMA_NITSB      LMSKLRLLIN-KHEILSNRLYRVDFLSGLSGESLVTMVYHRPI----------DEAWEKA
TRMA_SULDN      LMPKLLRAIK--RHKIDFKLFGVDFLSSNSGEIVVSLLYHRAL----------DSTFKEI
TRMA_WOLSU      LMPSLLEALE-SDEILTQKLFGVEFLSGLSQEVLVSLLYHKRL----------DHAWEER
TRMA_HELHP      IMPLLLHYLN-TYDLLNHKLYACNLLSSLQNEIIITLIYHKSL----------DSHWESL
TRMA_CAMC1      LMPRLLESLQ-DDEILRTKLFGVEFI-ACKSGTLVTLLYHKKLDSE----------FEAA
TRMA_CAMC5      LMPRLLEELG-TSNELKSKIFGVEFI-STSELCAVILLYHKRLEG-----------LEAA
TRMA_CAMFF      IMPVLLDLLK-ENQNLKAKLFGVEFI-TTRDEILIILLYHKDAST-----------IIQE
TRMA_CAMHC      MMPKLLQNLR-ENKNLKERLFGIEFI-ATKFDFMAILLYHKDIFN-----------IKDD
TRMA_CAMJE      FMPRLLEYLR-QDNKLKEKLFGVEFL-TTKQELSITLLYHKNIED-----------IKSN
TRMA_CAMJ8      FMPKLLEYLR-QDNKLKEKLFGVEFL-TTKQELSITLLYHKNIED-----------IKSN
TRMA_CAMJJ      FMPKLLEYLR-QDDKLKEKLFGVEFL-TTKQELSVTLLYHKNIED-----------IKSN
TRMA_CAMJR      FMPKLLEYLR-QDNKLKEKLFGVEFL-TTKQELSVTLLYHKNIED-----------IKSN
TRMA_CAMJD      FMPKLLEYLR-QDDKLKEKLFGVEFL-TTKQELSLTLLYHKNIED-----------IKSN
TRMA_CAMLR      YMPILLDNL---NENLKHKLFGVEFL-ATKIDLSITLLYHKNIES-----------ITQD
TRMA_ARCB4      LMPKLIDELQ-NDLELSFKLFAVEFLGSSTKDMLVTLIYHKKLEES----------WIQK
TRMA_NAUPA      IMTPLLKEIE-KNDNLRFKLYEIDFLSNSKGELIITLIYHKKVDES----------IAED
                 *  :          :  : :  . :          : *::                   

TRMA_ACIB5      AKALAEKL------NIKIMGRSRGQKIVIGDDFVVEEFELLNRS-----FKYKQIESSFT
TRMA_ACIBS      AKALAEKL------NIKIMGRSRGQKIVIGDDFVVEEFELLNRS-----FKYKQIESSFT
TRMA_ACIB3      AKALAEKL------NIKIMGRSRGQKIVIGDDFVVEEFELLNRS-----FKYKQIESSFT
TRMA_ACIBT      AKALAEKL------NIKIMGRSRGQKIVIGDDFVVEEFELLNRS-----FKYKQIESSFT
TRMA_ACIBY      AKALAEKL------NIKIMGRSRGQKIVIGDDFVVEEFELLNRS-----FKYKQIESSFT
TRMA_ACIBC      AKALAEKL------NIKIMGRSRGQKIVIGDDFVVEEFELLNRS-----FKYKQIESSFT
TRMA_ACIAD      AKALAEKL------NIKIMGRSRGQKVIIGDDYVVEQLNVHGRT-----FKYKQIESSFT
TRMA_NEIG1      AQALQQQL------DISVIGRSRGQKIVLKQDYVTETLRVGDRD-----FHYRQIEGSFT
TRMA_NEIG2      AQALQQQL------DISVIGRSRGQKIVLKQDYVTETLRVGDRD-----FHYRQIEGSFT
TRMA_NEIM0      AQALQQQL------DISVIGRSRGQKIVLKQDYVTETLKVGNRD-----FRYRQIEGSFT
TRMA_NEIMF      AQALQQQL------DISVIGRSRGQKIVLKQDYVTETLKVGNRD-----FRYRQIEGSFT
TRMA_NEIMA      AQALQQQL------DTSVIGRSRGQKIVLKQDYVTETLKVGNRD-----FRYRQIEGGFT
TRMA_NEIMB      AQALQQQL------DISVIGRSRGQKIVLKQDYVTETLKVGNRD-----FRYRQIEGSFT
TRMA_DICNV      AKALAKRF------HILLIGRSRKQKITLERDFILETLNVDGRA-----FHYHQYEQSFS
TRMA_ECOBR      AEALRDALR-AQNLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_ECOHS      AEALRDALR-AQNLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_ECO8A      AEALRDALR-AQNLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_ECOSE      AEALRDALR-AQNLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_ECOLI      AEALRDALR-AQNLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_ECODH      AEALRDALR-AQNLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_ECOBW      AEALRDALR-AQNLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_ECOLC      AEALRDALR-AQNLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_ECO55      AEALRDALR-AQNLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_ECO24      AEALRDALR-AQNLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_SHIB3      AEALRDALR-AQNLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_SHISS      AEALRDALR-AQNLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_ECOSM      AEALRDALR-AQNLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_ECOLU      AEALRDALR-AQNLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_ECOUT      AEALRDALR-AQNLNVHLIGRATKTKIALDQDYIDERLPIAGKE-----MIYRQVENSFT
TRMA_ECOL5      AEALRDALR-AQNLNVHLIGRATKTKIALDQDYIDERLPIAGKE-----MIYRQVENSFT
TRMA_ECOK1      AEALRDALR-AQNLNVHLIGRATKTKIALDQDYIDERLPIAGKE-----MIYRQVENSFT
TRMA_ECO45      AEALRDALR-AQNLNVHLIGRATKTKIALDQDYIDERLPIAGKE-----MIYRQVENSFT
TRMA_ECOL6      AEALRDALR-AQNLNVHLIGRATKTKIALDQDYIDERLPIAGKE-----MIYRQVENSFT
TRMA_ECO57      AEALRDALR-AQNLNVHLIGRATKTKIALDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_ECO5E      AEALRDALR-AQNLNVHLIGRATKTKIALDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_SHIBS      AEALRDALR-AQNLNVHLIGRATKTKIALDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_SHIFL      AEALRDALR-AQNLNVHLIGRATKTKIALDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_SHIF8      AEALRDALR-AQNLNVHLIGRATKTKIALDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_SHIDS      AEALRDALR-AQNLNVHLIGRATKTKIALDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_ECO27      AEALRDALR-AQNLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_ECO7I      AEALRDALR-AQNLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_ECO81      AEALRDALR-AQNLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_ESCF3      AEVLRDALR-AQNLNVHLIGRATKTKIELDQDYIDERLPVAGRE-----MIYRQVENSFT
TRMA_ENT38      AEVLRDALR-AQNINVHLIGRATKTKIMLDQDYVDERLPVAGKE-----MIYRQVENSFT
TRMA_CITK8      AETLRDALR-AQNLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_SALA4      ATALRDALR-AQGLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_SALSV      ATALRDALR-AQGLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_SALCH      ATALRDALR-AQGLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_SALDC      ATALRDALR-AQGLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_SALEP      ATALRDALR-AQGLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_SALG2      ATALRDALR-AQGLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_SALTY      ATALRDALR-AQGLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_SALPA      ATALRDALR-AQGLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----IIYRQVENSFT
TRMA_SALPC      ATALRDALR-AQGLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----IIYRQVENSFT
TRMA_SALPK      ATALRDALR-AQGLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----IIYRQVENSFT
TRMA_SALTI      ATALRDALR-AQGLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----IIYRQVENSFT
TRMA_SALHS      ATALRDALR-AQGLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_SALNS      ATALRDALR-AQGLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_SALPB      ATALRDALR-AQGLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_SALAR      ATALRDALR-AQGLNVHLIGRATKTKIELDQDYIDERLPVAGKE-----MIYRQVENSFT
TRMA_KLEP3      AEALRDALR-AQGLNVHLIGRATKTKIELDQDYIDERLPVGGRE-----MIYRQVENSFT
TRMA_KLEP7      AEALRDALR-AQGLNVHLIGRATKTKIELDQDYIDERLPVGGRE-----MIYRQVENSFT
TRMA_CROS8      ATRLRDALR-ADGFDVHFIGRATKTKIMLDQDYIDERLPVAGTE-----MIYRQVENSFT
TRMA_ERWT9      AAALRDSLR-AEGFDLHLIGRATKTKICLDQDYVDERLTVDGRE-----MVYRQVENSFT
TRMA_PHOLL      ALRLREALR-HKGFDVELIGRAAKTKITLDHDYIDEVLPVAGRK-----MIYRQVENSFT
TRMA_PROMH      ATALRQTLI-AQGFDVQLIGRAYKTKIMLDNDFVDEVLPVAGQQ-----MIYRQVENSFT
TRMA_PECAS      ARALRDSLT-AQGFNLQLIGRATKTKICLDRDYVDECLPVAGRN-----MIYRQVENSFT
TRMA_PECCP      ARALRDSLT-AQGFRLQLIGRATKTKICLDRDYVDECLPVAGRD-----MIYRQVENSFT
TRMA_DICP7      AIALRDQLR-QQGFNLQLIGRATKTKICLDHDYVDECLPVAGKQ-----MVYRQVENSFT
TRMA_DICC1      ARELCDELR-AQGFALQLIGRATKTKICLDRDYVDECLPVAGRQ-----MIYRQVENSFT
TRMA_EDWI9      AEALRDALR-GQGFAIQLIGRASKTKICLDQDWVDEVLPVAGRQ-----MIYRQVENSFT
TRMA_YERPE      ALELRDQLR-AQGFDLQLIGRAAKTKIMLDHDYIDEVLPVAGRE-----MIYRQVENSFT
TRMA_YERPP      ALELRDQLR-AQGFDLQLIGRAAKTKIMLDHDYIDEVLPVAGRE-----MIYRQVENSFT
TRMA_YERPY      ALELRDQLR-AQGFDLQLIGRAAKTKIMLDHDYIDEVLPVAGRE-----MIYRQVENSFT
TRMA_YERPG      ALELRDQLR-AQGFDLQLIGRAAKTKIMLDHDYIDEVLPVAGRE-----MIYRQVENSFT
TRMA_YERPA      ALELRDQLR-AQGFDLQLIGRAAKTKIMLDHDYIDEVLPVAGRE-----MIYRQVENSFT
TRMA_YERPN      ALELRDQLR-AQGFDLQLIGRAAKTKIMLDHDYIDEVLPVAGRE-----MIYRQVENSFT
TRMA_YERPS      ALELRDQLR-AQGFDLQLIGRAAKTKIMLDHDYIDEVLPVAGRE-----MIYRQVENSFT
TRMA_YERPB      ALELRDQLR-AQGFDLQLIGRAAKTKIMLDHDYIDEVLPVAGRE-----MIYRQVENSFT
TRMA_YERP3      ALELRDQLR-AQGFDLQLIGRAAKTKIMLDHDYIDEVLPVAGRE-----MIYRQVENSFT
TRMA_YERE8      ARELRDQLR-EQGFDLQLIGRASKTKIMLDHDYIDEVLPVAGRD-----MIYRQVENSFT
TRMA_SERP5      AEKLRDDLR-AQGFDLQLIGRASKMKIMLDQDYVDEVLPVAGRD-----MIYRQVENSFT
TRMA_SODGM      AAGLRDALR-ARGYHIQFIGRANKTKIYLDRDYVDERLTVAGRT-----LIYQQIENSFT
TRMA_ACTP2      AAALKARLE-HQGFKVQIIGRATKQKIALDRDYVEEVLPVDGRN-----LIYRQVENSFT
TRMA_ACTP7      AAALKARLE-HQGFKVQIIGRATKQKIALDRDYVEEVLPVDGRN-----LIYRQVENSFT
TRMA_ACTPJ      AAALKARLE-HQGFKVQILGRATKQKIALDRDYVEEVLPVDGRN-----LIYRQVENSFT
TRMA_HAEDU      AKLLKQRLS-EPGLTVHIIGRASKQKIAIDCDYVKEKLNVAGKT-----LIYRQVENSFT
TRMA_HAEPS      AKLLKQRLI-GYGFDVQLIGRATKQKIALDCDYVEEALNVDGQI-----YRYRQVENSFT
TRMA_HAEIN      AKNLKDLLE-KQDFDVQIIGRASKQKICFEQDYVDEVLPVNGRN-----YVYRQVENSFT
TRMA_HAEI8      AKNLKDLLE-KQDFDVQIIGRASKQKICFEQDYVDEVLPVNGRN-----YVYRQVENSFT
TRMA_HAEIE      AKNLKDLLE-KQGFNVQIIGRASKQKICFEQDYVDEVLPVNGRN-----YVYRQVENSFT
TRMA_MANSM      AQALKVRLE-KLDFDVQIVGRATKQKICLERDYADEVLPVNGRN-----YVYRQIENSFT
TRMA_HAES1      ATQLKQQLI-KQGFDVQIIGRANKQKICLQQDFVDEILPVKNQQ-----YIYRQVENSFT
TRMA_HISS2      ATQLKQQLI-KQGFDVQIIGRANKQKICLQQDFVDEILPVKNQQ-----YIYRQVENSFT
TRMA_PASMU      AKQLKASLL-QQGFDLQLIGRASKQKICLEQEFVDEVLTVHGKS-----YVYRQVENSFT
TRMA_AGGAN      AQTLRSQLQ-QQGFNVQIVGRASKQKICLEQDYVDEILRVHGKD-----YIYRQVENSFT
TRMA_ACTSZ      AQALKVRLR-NLGFSVQIIGRATKQKICLDQDFVDEELSVGDKK-----YVYRQVENSFT
TRMA_TOLAT      ATELRQALR-AEFGEVDVVGRAHKQKIVLEREYVLEQLQVGDRT-----LEYMQVENSFT
TRMA_AERHH      AEALQADLR-AKGFELQLIGRAHKQKICLGEEFVIERLTVQGRQ-----LVYKQVENSFT
TRMA_AERS4      AETLQADLQ-AQGFDLRLIGRAHKQKICLGDDFVIEQLNVAGRQ-----LTYKQVENSFT
TRMA_ALIF1      AKALKQRLN-DEGFNLNIIGRARKMKIVLDQEFVIEKLKVNDDI-----LTYKQVENSFT
TRMA_ALIFM      AKALKQRLN-DEGFNLNIIGRARKMKIVLDQEFVIEKLKVNDDI-----LTYKQVENSFT
TRMA_ALISL      AAVLKQQLN-EKGFNLNLIGRARKMKIVLDQEFVIEKLKVNDDI-----LTYKQVENSFT
TRMA_PHOPR      IKKLKQCLN-DEGFNLNIIGRARKMKIVADRDYVIEKLNVFDQT-----LTYKQVENSFT
TRMA_VIBCH      AQALKQRLN-DEGFNLNLIGRARKMKVVLDRDYVVENLQVNGQP-----YVYKQVENSFT
TRMA_VIBC3      AQALKQRLN-DEGFNLNLIGRARKMKVVLDRDYVVENLQVNGQP-----YVYKQVENSFT
TRMA_VIBCM      AQALKQRLN-DEGFNLNLIGRARKMKVVLDRDYVVENLQVNGQP-----YVYKQVENSFT
TRMA_VIBCB      AKALKQRLN-DEGFNLNIIGRARKMKIVLDRDYVIEKLDVNGQS-----YIYQQVENSFT
TRMA_VIBPA      AKALKQRLN-DEGFNLNIIGRARKMKIILDRDYVIEKLDVNGQS-----YIYQQVENSFT
TRMA_VIBVU      AKALKQRLN-DEGFNLNLIGRARKMKIVLDRDYVVEKLDVNGKP-----YTYQQVENSFT
TRMA_VIBVY      AKALKQRLN-DEGFDLNLIGRARKMKIVLDRDYVVEKLDVNGKP-----YVYQQVENSFT
TRMA_VIBTL      AKALKQQLN-DEGFNLNLIGRARKMKIVLDRDYVIEKLDVNGDS-----YIYQQVENSFT
TRMA_SHEB5      ATALKAKLS-SQ-FNVNIIGRARKQKIDLDKDFVVESLQVNDKT-----FLYKQIENSFT
TRMA_SHEB9      ATALKAKLS-SQ-FNVNIIGRARKQKIDLDKDFVVESLQVNDKT-----FLYKQIENSFT
TRMA_SHEB2      ATALKAKLS-SQ-FNVNIIGRARKQKIDLDKDFVVESLQVNDKT-----FLYKQIENSFT
TRMA_SHEB8      AAALKTKLS-SQ-FNVNIIGRARKQKIDLDKDFVVESLQVNDKT-----FLYKQIENSFT
TRMA_SHEPC      AAALKAKLS-SQ-FNVNIIGRARKQKIDLDKDFVVESLQVNDKT-----FLYKQIENSFT
TRMA_SHESW      AAALKAKLS-SQ-FNVNIIGRARKQKIDLDKDFVVESLQVNDKT-----FLYKQIENSFT
TRMA_SHESA      AAALKARLS-SQ-FKVNIIGRARKQKIDLDKDFVVESLQVNDKV-----FHYKQIENSFT
TRMA_SHESR      AAALKARLS-SQ-FKVNIIGRARKQKIDLDKDFVVESLQVNDKV-----FHYKQIENSFT
TRMA_SHESM      AAALKARLS-SQ-FKVNIIGRARKQKIDLDKDFVVESLQVNDKV-----FHYKQIENSFT
TRMA_SHEON      AIALKAKLS-SQ-FKVNIIGRARKQKIDLDKDFVVESLQVNDKV-----FHYKQIENSFT
TRMA_SHEDO      AAALKQRLS-SQ-FNVNIIGRARKQKIDLDKDFVVETIKVNGQD-----LHYKQIENSFT
TRMA_SHEFN      ATQLKAKLS-AQ-FNVNIIGRARKQKIDLDKDFVVETLTVNEQV-----LHYKQIENSFT
TRMA_SHEHH      AKILKQTLS-TQ-FNVNLIGRARKQKIIFDKDFVVESLNVAGKQ-----LQYHQIENSFT
TRMA_SHEPA      AKILKQTLS-TQ-FNVNLIGRARKQKIIFDKDFVVESLNVAGKQ-----LQYHQIENSFT
TRMA_SHEPW      AKILKQTLS-SQ-FNVNLIGRARKQKLIFDKDFVVESLNVAGKQ-----LQYHQIENSFT
TRMA_SHESH      AKALKEKLA-AT-FNINIIGRARKQKLIIDKDFVIESLTVNNEQ-----LQYHQIENSFT
TRMA_SHEWM      AKSLKERLA-SK-FNVNIIGRARKQKLIFDKDFVVESLQVNGEQ-----LQYHQIENSFT
TRMA_SHELP      AQALKEALS-SK-FKVDIIGRARKQKLVMDRDFVIESLPVNGKQ-----LTYKQVENSFT
TRMA_SHEAM      ARALKARLG-EH-FKVDIIGRARKQKFVLDRDFVVESLDVDGKT-----LHYKQVENSFT
TRMA_ALTMD      AKSLKSTLE-THFPKVNIIGRARKQKRIIDNDFVIERLPVKGNE-----FVFKHIENSFT
TRMA_PSEA6      AKALRALLR-DE-FKIDIIGRAKKQKVLLDKDYVIETLPVNDRL-----YTFKQIENSFT
TRMA_PSYIN      AKRIKAELL-KQ-FDINFIGRARKQKILLDYDYVIEELQVDGNK-----LFYQQIENSFT
TRMA_PSEHT      INTLKEKLS-SK-YKIDFIGRARKQKEMLGDDYVTERLNVNGQE-----LIYQQVENSFT
TRMA_COLP3      AEKLKAQLS-TI-APVDIIGRAKKQKIIVDKDYVMESLNVGGKT-----YVYQQVENSFT
TRMA_IDILO      AIQLREALT-SI-AKVEVIGRARKQKRVLYKESVTEEVKVDGKS-----YLSLQTENSFT
TRMA_MARMS      VQQLNNAFP-A----CHFIGRSRKKKQIITRDFVMETLTVNGQK-----FHYQQVENSFT
TRMA_HYDCU      ANALRCELP-I----THIIGRARKQKICLDKDYVIEKLQVDHQT-----FIYQQIENSFT
TRMA_CELJU      ATDLRKQL------NVEIIGRSRKQKILLERDHIIECLKVNGRE-----YRYQQVEGSFT
TRMA_AROAE      ARELAAEL------NVQLIGRSRKQKIVLDRDWVLERFALDGRP-----LQYKQIEGSFT
TRMA_AZOSB      ARELAAAM------GVQLIGRSRKQKIVLERDWVLESFELDGRT-----LHYQQIEGSFS
TRMA_DECAR      AREMAAEL------GIGLIGRSRGQKIVLDRDWVLEGFELNGRQ-----LRYKQVEGSFT
TRMA_PSEAE      AEKLAAEL------GVNLVGRSRGKRIVVGRDYVEEELSVAGRR-----FRYRQPEGAFT
TRMA_PSEA8      AEKLAAEL------GVNLVGRSRGKRIVVGRDYVEEELSVAGRR-----FRYRQPEGAFT
TRMA_PSEAB      AEKLAAEL------GVNLVGRSRGKRIVVGRDYVEEELSVAGRR-----FRYRQPEGAFT
TRMA_PSEA7      AEALAAEL------GVSLVGRSRGKRIVVGRDYVEEELLVAGRR-----FRYRQPEGAFT
TRMA_AZOVD      AERLAAEL------GVSIVGRSRGQRLVVGRDYVEEELEVAGRR-----FRYRQPEGAFT
TRMA_PSEMY      AEKLASEL------NVSLVGRSRGQRLVIGRDYVEEELTVAGRR-----FRYRQPEGAFT
TRMA_PSEU5      AEQLAADL------GVSLVGRSKGKRIVIGRDYVEEQLVVAGRS-----FRYRQPEGAFT
TRMA_PSEP1      ARQLAEAL------GVSVIGRSKGKRLVIGRDYAVEKLDVAGRV-----FSYRQPEGAFT
TRMA_PSEPK      ARQLAEAL------GVSVIGRSKGKRLVIGRDYAVEKLDVAGRV-----FSYRQPEGAFT
TRMA_PSEPG      ARQLAEAL------GVSVIGRSKGKRLVIGRDYAIEELDVAGRV-----FSYRQPEGAFT
TRMA_PSEPW      ARQLAEEL------GVSLIGRSKGKRLVIGRDYAVEKLDVAGRV-----FSYRQPEGAFT
TRMA_PSEE4      AQQLASEL------NVSVIGRSKGKRVVIGRDYAVENLDIAGRT-----FSYRQPEGAFT
TRMA_PSEFL      ANKLAADL------NVSIIGRSKGKRDVIGRDYVVEKLDVGGRT-----FSYRQPEGAFT
TRMA_PSEFS      ANKLATDL------NVSIIGRSKGKRDVIGHDYVVEKLEVGGRT-----FSYRQPEGAFT
TRMA_PSEPF      ATKLATDL------GVSIIGRSKGKREVLGLDYVVEKLDVGGRT-----FSYRQPEGAFT
TRMA_PSEF5      ASQLAADL------KVSVIGRSKGKREVIGQDYVVEKLEVGGRT-----FSYRQPEGAFT
TRMA_PSE14      AEQLAAEL------NVSLIGRSKGQKLIIGQDYVTEKLDVAGRT-----FSYRQPEGAFT
TRMA_PSEU2      AAQLAAEL------DVSLIGRSKGQKLVIGHDYVTEKLDVAGRT-----FSYRQPEGAFT
TRMA_PSESM      AEQLAVEL------DVSLIGRSKGQKLIIGHDYVTEKLDVAGRT-----FSYRQPEGAFT
TRMA_CHRSD      ARALQTTL------GVSIIGRARKQRLVLDRDHVWERLQVEGRE-----FVYQQVENSFT
TRMA_SACD2      ANALASSL------NTHIIGRSKKQKIVLTQDYVEETLTISGTP-----FTYKQIESGFT
TRMA_TERTT      AEQLQSTL------RCQLIGRSRKQKIALGRDYVLETLLVNDKS-----YTYQQVETGFT
TRMA_SULNB      AKMLEREL------NCRVMGRSRKQKVILSDEFVTETLEIDGKE-----FTYVQYESGFT
TRMA_NITSB      ANEIAKAL------HIDIVGRSRGKKIVIGKEYITEKLPVFEKE-----FLFRHYEGSFT
TRMA_SULDN      AEIISDEL------DIYIIGRSRGQKVVIKQDYVTEILHVDGVE-----FKFNYIENSFT
TRMA_WOLSU      ALGLLS----SLPTLSSLIGRSKGQKIVLGESFITETLTIDSKP-----WRFLHYEGSFT
TRMA_HELHP      ALKIQKELEYTLNTNIHIIGRSKNHKHILSNDIICEHLTLFANTPKERTYTFFKQESRFC
TRMA_CAMC1      MKILASKL------DVMILARSRGQKLLSGELNLVDELNVDGQI-----YKFSLSENAFI
TRMA_CAMC5      FSELAKRL------GVKIVARSRGQKISSDERELCDSFEINGLR-----YALNFGDSAFI
TRMA_CAMFF      LTWLQSKL------KVGLIARSKGKKLVFGSSSLNEKLFINGKS-----YHYVFGDAAFI
TRMA_CAMHC      LAKLAEIL------DIKISARSRGKFLNFGGEILREKV----QN-----FIYRFNADAFF
TRMA_CAMJE      LENLSNIL------HINLIARSKGKKLIFKTENLRQTLNIQDRK-----IFYEFNNDCFI
TRMA_CAMJ8      LENLSNIL------HINLIARSKGKKLIFKTENLRQTLNIQDRK-----IFYEFNNDCFI
TRMA_CAMJJ      LENLSNNL------HINLIARSKGKKLIFKTENLRQTLNIQDRK-----IFYEFNNDCFI
TRMA_CAMJR      LENLSNIL------HINLIARSKGKKLIFKTENLRQTLNIQGRK-----IFYEFNNDCFI
TRMA_CAMJD      LENLSNNL------HINLIARSKGKKLIFKTENLRQTLNIQGRE-----IFYEFNNDCFI
TRMA_CAMLR      LQELSKKL------NLKLIARSRGKKLVFNGENLKQILNIKNKE-----IFYEFNNDCFI
TRMA_ARCB4      AKEIEKKL------NIKIIGRSKKQRLVLTNDYINETLNISNQN-----FFFAYEENGFT
TRMA_NAUPA      IKKLKEKFK-----NADFIVRKKGRKYVFDKNYLIEELNINSKT-----YKYKIIENTFS
                   :             .  *              : .                    * 

TRMA_ACIB5      QPNAQVCKKMLQWACDAAEGS-----KKHLLELYCGNGNFTLPLSLKFERVLATELAKSS
TRMA_ACIBS      QPNAQVCKKMLQWACDAAEGS-----KKHLLELYCGNGNFTLPLSLKFERVLATELAKSS
TRMA_ACIB3      QPNAQVCKKMLQWACDAAEGS-----KKHLLELYCGNGNFTLPLSLKFERVLATELAKSS
TRMA_ACIBT      QPNAQVCKKMLQWACDAAEGS-----KKHLLELYCGNGNFTLPLSLKFERVLATELAKSS
TRMA_ACIBY      QPNAQVCKKMLQWACDAAEGS-----KKHLLELYCGNGNFTLPLSLKFERVLATELAKSS
TRMA_ACIBC      QPNAQVCKKMLQWACDAAEGS-----KKHLLELYCGNGNFTLPLSLKFERVLATELAKSS
TRMA_ACIAD      QPNAEVCQKMLTWACDVIQGS-----NQDLLELYCGNGNFTLPLSLHFRRVLATELAKSS
TRMA_NEIG1      QPNAAVCRKMLEWACRAAEGL-----GGDLLELYCGNGNFTLPLSRYFRQVLATEISKTS
TRMA_NEIG2      QPNAAVCRKMLEWACRAAEGL-----GGDLLELYCGNGNFTLPLSRYFRQVLATEISKTS
TRMA_NEIM0      QPNAAVCQKMLEWACGAAEGL-----DGDLLELYCGNGNFTLPLSEKFERVLATEISKTS
TRMA_NEIMF      QPNAAVCQKMLEWACGAAEGL-----DGDLLELYCGNGNFTLPLSEKFERVLATEISKTS
TRMA_NEIMA      QPNAAVCQKMLEWACGAAEGL-----GGDLLELYCGNGNFTLPLSEKFERVLATEISKTS
TRMA_NEIMB      QPNAAVCQKMLEWACRTAEGL-----GSDLLELYCGNGNFTLPLSRYFRQVLATEISKTS
TRMA_DICNV      QPNAYVCQKMLRWACAQAGEN-----AGDLLELYCGNGNFTLPLASHFRRVLATEISKSS
TRMA_ECOBR      QPNAAMNIQMLEWALDVTKGS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_ECOHS      QPNAAMNIQMLEWALDVTKGS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_ECO8A      QPNAAMNIQMLEWALDVTKGS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_ECOSE      QPNAAMNIQMLEWALDVTKGS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_ECOLI      QPNAAMNIQMLEWALDVTKGS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_ECODH      QPNAAMNIQMLEWALDVTKGS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_ECOBW      QPNAAMNIQMLEWALDVTKGS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_ECOLC      QPNAAMNIQMLEWALDVTKGS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_ECO55      QPNAAMNIQMLEWALDVTKGS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_ECO24      QPNAAMNIQMLEWALDVTKGS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_SHIB3      QPNAAMNIQMLEWALDVTKGS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_SHISS      QPNAAMNIQMLEWALDVTKGS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_ECOSM      QPNAAMNIQMLEWALDVTKGS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_ECOLU      QPNAAMNIQMLEWALDVTKGS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_ECOUT      QPNAAMNIQMLEWALDVTKGS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_ECOL5      QPNAAMNIQMLEWALDVTKGS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_ECOK1      QPNAAMNIQMLEWALDVTKGS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_ECO45      QPNAAMNIQMLEWALDVTKGS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_ECOL6      QPNAAMNIQMLEWALDVTKGS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_ECO57      QPNAAMNIQMLEWALDVTKGS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_ECO5E      QPNAAMNIQMLEWALDVTKGS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_SHIBS      QPNAAMNIQMLEWALDVTKGS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_SHIFL      QPNAAMNIQMLEWALDVTKGS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_SHIF8      QPNAAMNIQMLEWALDVTKGS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_SHIDS      QPNAAMNIQMLEWALDVTKGS-----KGDLLELYCGNGNFSLALAHNFDRVLATEIAKPS
TRMA_ECO27      QPNAAMNIQMLEWALDVTKGS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_ECO7I      QPNAAMNIQMLEWALDVTKGS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_ECO81      QPNAAMNIQMLEWALDVTKGS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_ESCF3      QPNAAMNIQMLEWALDVTKDS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_ENT38      QPNAAMNVQMLEWALSATEGS-----KGDLLELYCGNGNFSLALARNFERVLATEIAKPS
TRMA_CITK8      QPNAAMNIQMLEWALDATKAS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_SALA4      QPNAAMNIQMLEWALEVTKDS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_SALSV      QPNAAMNIQMLEWALEVTKDS-----KGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_SALCH      QPNAAMNIQMLEWALEVTKDS-----KGDLLELYCGNGNFSLALARNFNRVLATEIAKPS
TRMA_SALDC      QPNAAMNIQMLEWALEVTKDS-----KGDLLELYCGNGNFSLALARNFNRVLATEIAKPS
TRMA_SALEP      QPNAAMNIQMLEWALEVTKDS-----KGDLLELYCGNGNFSLALARNFNRVLATEIAKPS
TRMA_SALG2      QPNAAMNIQMLEWALEVTKDS-----KGDLLELYCGNGNFSLALARNFNRVLATEIAKPS
TRMA_SALTY      QPNAAMNIQMLEWALEVTKDS-----KGDLLELYCGNGNFSLALARNFNRVLATEIAKPS
TRMA_SALPA      QPNAAMNIQMLEWALEVTKDS-----KGDLLELYCGNGNFSLALARNFNRVLATEIAKPS
TRMA_SALPC      QPNAAMNIQMLEWALEVTKDS-----KGDLLELYCGNGNFSLALTRNFNRVLATEIAKPS
TRMA_SALPK      QPNAAMNIQMLEWALEVTKDS-----KGDLLELYCGNGNFSLALARNFNRVLATEIAKPS
TRMA_SALTI      QPNAAMNIQMLEWALEVTKDS-----KGDLLELYCGNGNFSLALARNFNRVLATEIAKPS
TRMA_SALHS      QPNAAMNIQMLEWALEVTKDS-----KGDLLELYCGNGNFSLALARNFNRVLATEIAKPS
TRMA_SALNS      QPNAAMNIQMLEWALEVTKDS-----KGDLLELYCGNGNFSLALARNFNRVLATEIAKPS
TRMA_SALPB      QPNAAMNIQMLEWALEVTKDS-----KGDLLELYCGNGNFSLALARNFNRVLATEIAKPS
TRMA_SALAR      QPNAAMNIQMLEWALEVTKDS-----KGDLLELYCGNGNFSLALARNFNRVLATEIAKPS
TRMA_KLEP3      QPNAAMNIQMLEWALDVTKEA-----TGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_KLEP7      QPNAAMNIQMLEWALDVTKGA-----TGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_CROS8      QPNAAMNIHMLEWALDVTQGS-----KGDLLELYCGNGNFSLALARNFNRVLATEIAKPS
TRMA_ERWT9      QPNAAVNVKMLEWALDSTRHS-----AGDLLELYCGNGNFSLALARNFNRVLATEIAKPS
TRMA_PHOLL      QPNASVNIHMLEWAINITKDS-----KGDLLELYCGNGNFSLALAQNFERVLATEIAKPS
TRMA_PROMH      QPNAQVNIKMLEWALSVTENS-----TGDLLELYCGNGNFSLALARNFKRVLATEIAKPS
TRMA_PECAS      QPNAAVNIQMLEWALDATAGS-----KGDLLELYCGNGNFSLALARNFERVLATEIAKPS
TRMA_PECCP      QPNAAINIQMLEWALDATAGS-----TGDLLELYCGNGNFSLALARNFERVLATEIAKPS
TRMA_DICP7      QPNAAMNIQMLEWALSVTEGS-----KGDLLELYCGNGNFSLALARNFERVLATEIAKPS
TRMA_DICC1      QPNAMMNIQMLEWALSVTQGS-----TGDLLELYCGNGNFSLALARNFERVLATEIAKPS
TRMA_EDWI9      QPNAAINIQMLEWALDATRGA-----EGDLLELYCGNGNFSLALAHNFRQVLATEIAKPS
TRMA_YERPE      QPNAAVNIHMLEWALDVTQGA-----TGDLLELYCGNGNFSLALARNFERVLATEIAKPS
TRMA_YERPP      QPNAAVNIHMLEWALDVTQGA-----TGDLLELYCGNGNFSLALARNFERVLATEIAKPS
TRMA_YERPY      QPNAAVNIHMLEWALDVTQGA-----TGDLLELYCGNGNFSLALARNFERVLATEIAKPS
TRMA_YERPG      QPNAAVNIHMLEWALDVTQGA-----TGDLLELYCGNGNFSLALARNFERVLATEIAKPS
TRMA_YERPA      QPNAAVNIHMLEWALDVTQGA-----TGDLLELYCGNGNFSLALARNFERVLATEIAKPS
TRMA_YERPN      QPNAAVNIHMLEWALDVTQGA-----TGDLLELYCGNGNFSLALARNFERVLATEIAKPS
TRMA_YERPS      QPNAAVNIHMLEWALDVTQGA-----TGDLLELYCGNGNFSLALARNFERVLATEIAKPS
TRMA_YERPB      QPNAAVNIHMLEWALDVTQGA-----TGDLLELYCGNGNFSLALARNFERVLATEIAKPS
TRMA_YERP3      QPNAAVNIHMLEWALDVTQGA-----TGDLLELYCGNGNFSLALARNFERVLATEIAKPS
TRMA_YERE8      QPNAAVNIHMLEWAIDVTQHA-----SGDLLELYCGNGNFSLALARNFDRVLATEIAKPS
TRMA_SERP5      QPNAALNIQMLEWALDVTTGS-----KGDLLELYCGNGNFSLALARNFERVLATEIAKPS
TRMA_SODGM      QPNAGINVHMLEWALAATEGA-----QGDLLELYCGNGNFSLALARHFDRVLATEIAKLS
TRMA_ACTP2      QPNAKMNIKMLEWARSCTRHS-----SGDLLELYCGNGNFSIALAENFRKVLATEISKSS
TRMA_ACTP7      QPNAKMNIKMLEWARSCTRHS-----SGDLLELYCGNGNFSIALAENFRQVLATEISKSS
TRMA_ACTPJ      QPNAKMNIKMLEWARSCTRHS-----SGDLLELYCGNGNFSIALAENFRKVLATEISKSS
TRMA_HAEDU      QPNAKMNINMLEWAQKCTANSQ----DSDLLELYCGNGNFSIALAGNFRKVLATEICKSS
TRMA_HAEPS      QPNGKMNIKMLEWARACTANS-----KGDLLELYCGNGNFSIALANQFRKVLATEISKSS
TRMA_HAEIN      QPNATVNCKMLEWAIDCTQNS-----EGDLLELYCGNGNFSIALAQNFRKVLATEIAKPS
TRMA_HAEI8      QPNATVNCKMLEWAIDCTQNS-----EGDLLELYCGNGNFSIALAQNFRKVLATEIAKPS
TRMA_HAEIE      QPNATVNCKMLEWAIDCTQNS-----EGDLLELYCGNGNFSIALAQNFRKVLATEIAKPS
TRMA_MANSM      QPNAAVNCKMLEWAIGCTKNS-----SGDLLELYCGNGNFSIALAQNFRKVLATEIAKPS
TRMA_HAES1      QPNATVNCKMLEWAIDCTKNS-----QGDLLELYCGNGNFSIALAQNFRKVLATEIAKPS
TRMA_HISS2      QPNATVNCKMLEWAINCTKNS-----QGDLLELYCGNGNFSIALAQNFRKVLATEIAKPS
TRMA_PASMU      QPNAIVNQKMLEWAVDCTQNS-----EGDLLELYCGNGNFSIALAQNFRKVLATEIAKPS
TRMA_AGGAN      QPNATVNSKMLEWAVDCTRNS-----HGDLLELYCGNGNFSIALAQNFRKVLATEIAKPS
TRMA_ACTSZ      QPNAALNCKMLEWAIDCTRDS-----QGDLLELYCGNGNFSIALAQNFRKVLATEIAKPS
TRMA_TOLAT      QPNAGMNQQMLGWATDVTADC-----QGDLLELYCGNGNFSLALAKNFNRVLATEIAKPS
TRMA_AERHH      QPNAAINEQMLGWALDVTKGS-----EGDLLELYCGNGNFSIALAQNFRKVLATEIAKPS
TRMA_AERS4      QPNAAINEQMLGWALDVTRGS-----EGDLLELYCGNGNFSIALAQNFRKVLATEIAKPS
TRMA_ALIF1      QPNGIVAQKMLEWAVDCTQNS-----QGDLLELYCGNGNFSLALAKNFDRVLATELAKPS
TRMA_ALIFM      QPNGIVAQKMLEWAVDCTQNS-----QGDLLELYCGNGNFSLALAKNFDRVLATELAKPS
TRMA_ALISL      QPNGVVAQKMLEWAVDCTQDS-----QGDLLELYCGNGNFSLALAKNFDRVLATELAKPS
TRMA_PHOPR      QPNGEVAQKMLEWAVDCTQDS-----DGDLLELYCGNGNFSLALAKNFERVLATELAKPS
TRMA_VIBCH      QPNAKVAEKMLEWAVDCTQES-----KGDLLELYCGNGNFSLALAQNFERVLATELAKPS
TRMA_VIBC3      QPNAKVAEKMLEWAVDCTQES-----KGDLLELYCGNGNFSLALAQNFERVLATELAKPS
TRMA_VIBCM      QPNAKVAEKMLEWAVDCTQES-----KGDLLELYCGNGNFSLALAQNFERVLATELAKPS
TRMA_VIBCB      QPNGKVAEKMLEWAVDCTQES-----TGDLLELYCGNGNFSLALAQNFDRVLATELAKPS
TRMA_VIBPA      QPNGKVAEKMLEWAVDCTQES-----TGDLLELYCGNGNFSLALAQNFDRVLATELAKPS
TRMA_VIBVU      QPNGKVAEKMLEWAVDCTQES-----QGDLLELYCGNGNFSLALAQNFERVLATELAKPS
TRMA_VIBVY      QPNGKVAEKMLEWAVDCTQES-----QGDLLELYCGNGNFSLALAQNFERVLATELAKPS
TRMA_VIBTL      QPNGKVAEKMLEWAVDCTQDS-----KGDLLELYCGNGNFSLALAQNFERVLATELAKPS
TRMA_SHEB5      QPNAKVSVKMLEWAIDATQNS-----QGDLLELYCGNGNFSIALAQNFNRVLATELAKPS
TRMA_SHEB9      QPNAKVSVKMLEWAIDATQNS-----QGDLLELYCGNGNFSIALAQNFNRVLATELAKPS
TRMA_SHEB2      QPNAKVSVKMLEWAIDATQNS-----QGDLLELYCGNGNFSIALAQNFNRVLATELAKPS
TRMA_SHEB8      QPNAKVSVKMLEWAIDATQDS-----EGDLLELYCGNGNFSIALAQNFNRVLATELAKPS
TRMA_SHEPC      QPNAKVAVKMLEWAIDVTQDS-----QGDLLELYCGNGNFSIALAQNFNRVLATELAKPS
TRMA_SHESW      QPNAKVAVKMLEWAIDVTQDS-----QGDLLELYCGNGNFSIALAQNFNRVLATELAKPS
TRMA_SHESA      QPNAKVAIKMLEWAIDVTQNS-----QGDLLELYCGNGNFSIALAQNFNRVLATELAKPS
TRMA_SHESR      QPNAKVAIKMLEWAIDVTQNS-----QGDLLELYCGNGNFSIALAQNFNRVLATELAKPS
TRMA_SHESM      QPNAKVAIKMLEWAIDVTQHS-----QGDLLELYCGNGNFSIALAQNFNRVLATELAKPS
TRMA_SHEON      QPNAKVAIKMLEWAIDVTQNS-----QGDLLELYCGNGNFSIALAQNFNRVLATELAKPS
TRMA_SHEDO      QPNAKVSIKMLEWAIDATKQS-----QGDLLELYCGNGNFTIALAQNFNRVLATELAKPS
TRMA_SHEFN      QPNAKVSVKMLEWAIDATKDS-----QGDLLELYCGNGNFTIALARNFNRVLATELAKPS
TRMA_SHEHH      QPNGKVSVKMLEWAIDVTKNS-----TGDLLELYCGNGNFSIALAQNFDRVLATELAKPS
TRMA_SHEPA      QPNGKVSVKMLEWAIDITKNS-----SGDLLELYCGNGNFSIALAQNFERVLATELAKPS
TRMA_SHEPW      QPNGKVSVKMLEWAIDVTKNS-----TGDLLELYCGNGNFSIALAQNFERVLATELAKPS
TRMA_SHESH      QPNGKVSVKMLEWAIDVTKNS-----QGDLLELYCGNGNFSIALAQNFDRVLATELAKPS
TRMA_SHEWM      QPNGKVSVKMLEWAIDVTKNS-----SGDLLELYCGNGNFSIALAQNFDRVLATELAKPS
TRMA_SHELP      QPNGEVAIKMLEWAIDITRDS-----SGDLLELYCGNGNFSIALAQNFNRVLATELAKPS
TRMA_SHEAM      QPNAGVAVKMLEWALDATKQS-----SGDLLELYCGNGNFSIALAPNFGKVLATELAKPS
TRMA_ALTMD      QPNAEVNCKMIEWALDCVKPL-----SGDLLEMYCGAGNFSLPLALHFDNVVGTEIAKPS
TRMA_PSEA6      QPNAGVNSKMLEWALDVTQDC-----QGDLLELYCGAGNFSLPLAQNFRQVLATEISKSS
TRMA_PSYIN      QPNAKVCEKMLEWAIDCTRDS-----QGDLLELYCGNGNFSLALAKNFNKVLATEIAKPS
TRMA_PSEHT      QPNAKVNIKMLEWAQDLCKPL-----KNDLLELYCGNGNFSIALAGSFNKVLATEISKSS
TRMA_COLP3      QPNAGVNEQMLLWAQQATQNAG-----GDLIELYCGNGNFSIALAENFERVLGTEISKTS
TRMA_IDILO      QPNAIINQQMISWAKRHAGNNS-----HDLLELYCGNGNFTLPLAENFNRVLATEISKSS
TRMA_MARMS      QPNAGISEKMLEWALDVTKEAS-----GDLLEMYCGNGNFSIPLARRFDRVVATEISKVS
TRMA_HYDCU      QPNAEMAQNMLHWARKVAAKANPD-QQNDLIELYCGNGHFSIALSDQFHRVLATEISKTS
TRMA_CELJU      QPNARVCEQMLSWAQEQTRHT-----GGDLLELYCGNGNFTLPLAQNFDRVLATEISKTS
TRMA_AROAE      QPNGGVNRQMLGWACEQVRG-----VGGDLLELYCGNGNFTVALAPLFDRVLATEVSKTS
TRMA_AZOSB      QPNGGVNRQMLVWARRQAEG-----SGADLLELYCGNGNFTVALAPLFGKVLATEMSKSS
TRMA_DECAR      QPNGGVNRQMLGWACQQAAG-----FGGNLVELYCGNGNFTIALSPLFERVLATEVSKSS
TRMA_PSEAE      QPNGEVNQKMLGWAYEALGQ-----RDDDLLELYCGNGNFTLPLATRVRKVLATEISKSS
TRMA_PSEA8      QPNGEVNQKMLGWAYEALGQ-----RDDDLLELYCGNGNFTLPLATRVRKVLATEISKSS
TRMA_PSEAB      QPNGEVNQKMLGWAYEALGQ-----RDDDLLELYCGNGNFTLPLATRVRKVLATEISKSS
TRMA_PSEA7      QPNGEVNQKMLGWAYEALGE-----REDDLLELYCGNGNFTLPLATRVRKVLATEISKSS
TRMA_AZOVD      QPNGVVCRKMLNWAHDVLGE-----RDDDLLELYCGNGNFTLPLATRVRRVLATEISKTS
TRMA_PSEMY      QPNGAVCEKMLGWAYEALGE-----RDDDLLELYCGNGNFTLPLATRVRRVLATEISKTS
TRMA_PSEU5      QPNGEVCQKMLNWAHEALGE-----RDDDLLELYCGNGNFTLPLATRVRRVLATEISKTS
TRMA_PSEP1      QPNGAVNQKMLSWAFEAMGD-----REDDLLELYCGNGNFTLPLATRVRQVLATEISKTS
TRMA_PSEPK      QPNGAVNQKMLSWAFEAIGE-----REDDLLELYCGNGNFTLPLATRVRQVLATEISKTS
TRMA_PSEPG      QPNGAVNQKMLSWAFEAIGE-----REDDLLELYCGNGNFTLPLATRVRQVLATEISKTS
TRMA_PSEPW      QPNGAVNQKMLSWAYDAIGE-----RDDDLLELYCGNGNFTLPLATRVRQVLATEISKTS
TRMA_PSEE4      QPNGAVNQKMLGWAFEAMGE-----RDDDLLELYCGNGNFTLPLATRARQVLATEISKTS
TRMA_PSEFL      QPNGTVNQKMLNWAFEALGD-----RSDDLLELYCGNGNFTLPLATRVRKVLATEISKTS
TRMA_PSEFS      QPNGTVNQKMLNWAYDALGD-----RPDDLLELYCGNGNFTLPLATRVRKVLATEISKTS
TRMA_PSEPF      QPNGTVNQKMLNWAYEALGD-----RSDDLLELYCGNGNFTLPLATRVRKVLATEISKTS
TRMA_PSEF5      QPNGTVNQKMLNWAYEALGE-----RQDDLLELYCGNGNFTLPLATRVRKVLATEISKTS
TRMA_PSE14      QPNGTVNGKMLNWAFDALGE-----RQDDLLELYCGNGNFTLPLATRVRKVLATEISKTS
TRMA_PSEU2      QPNGTVNGKMLNWAFDALGE-----RQDDLLELYCGNGNFTLPLATRVRKVLATEISKTS
TRMA_PSESM      QPNGTVNGKMLNWAFDALGE-----RQDDLLELYCGNGNFTLPLATRVRKVLATEISKTS
TRMA_CHRSD      QPNAAICQSMLGWARDVTRES----REGDLVEFYCGNGNFTVALAENFRRVVATEISRTS
TRMA_SACD2      QPNAAVCQKMLQWAVDATANL-----GGDLVELYCGNGNFTLPLSKNFDKVLATEVSKTS
TRMA_TERTT      QPNAAVCQKMLTWAQTVSADI-----GGDLLELYCGNGNFTLPLAQNFSRVLATEVSKTS
TRMA_SULNB      QPNPAVNVKMIEWAIWQAKKVGY----GDFLESYCGLGNFTLPLSHYFDNVLATEISKRS
TRMA_NITSB      QPNPYVNIKMIEWAGRIAKDLQ-----GDLLELYCGAGNFTLPLSRYFEKVLATEVNKSS
TRMA_SULDN      QPNAKVNEQMIGWALRELPNMD-----ADLLELYCGAGNFTIPFASKYRKILATEISKSS
TRMA_WOLSU      QPNPKVNEKMIEWIISAPPQ-------GDLLELYCGAGNFTLPLSSRYAKILATEVSKTS
TRMA_HELHP      QPNPFINTQMLEFIVSALSSIYTPQTPCDMLELYCGSGNFTIPLASIFRHIFATEVVKSA
TRMA_CAMC1      QPNKAVNEKMIAWAKECVQSGA------DLLELYCGHGNFTIPLSFKFKNVLATEISKSS
TRMA_CAMC5      QPNKCVNEKMISWAMNAVQNAE------DMLEMYCGHGNFTIPLAGKFRRVLATEISKSS
TRMA_CAMFF      QPNRNINENMISWVLDHTTDCK------DLLELYCGHGNFTIPLSFKFNKVLATEISKAS
TRMA_CAMHC      QSNTKVNEKMILFVLNAVKNGK------DLLEMYCGHGNFTLPLASEFGKILANEISKNS
TRMA_CAMJE      QPNTAINEKMITWVCEILNTQKRM----DLLELYCGYGNFTLALAPFFFKILATEISKSN
TRMA_CAMJ8      QPNTTINEKMITWVCEILNTQKRM----DLLELYCGYGNFTLALAPFFFKVLATEISKSN
TRMA_CAMJJ      QPNTAINEKMITWVCEILNTQKRM----DLLELYCGYGNFTLALAPFFFKVLATEISKSN
TRMA_CAMJR      QPNTTINEKMITWVCEILNTQKRM----DLLELYCGYGNFTLALAPFFFKVLATEISKSN
TRMA_CAMJD      QPNTTINEKMITWVCEILSIQKRM----DLLELYCGYGNFTLALAQFFFKVLATEISKSS
TRMA_CAMLR      QPNTTINEKMIEWVIDLLEKEERK----DLLELYCGYGNFTIALAKYFNKILATEISKKN
TRMA_ARCB4      QPNTNVNVQMIEWVLENTKNSSK-----DLCELYCGGGNFTIPLSTKFRKVLATEISKTS
TRMA_NAUPA      QPNRQMNQKMIEWAMRNSEDLKG-----DLVELYCGNGNFTIPLSERFNKVIATEISKES
                *.*  :   *: :               .: * *** *:*::.::    .:...*: :  

TRMA_ACIB5      VYAAQWNIEQNQIDNIQVARLSAEEFTQAYQGEREF-RRLQEADIDIQSYDFGTVFVDPP
TRMA_ACIBS      VYAAQWNIEQNQIDNIQVARLSAEEFTQAYQGEREF-RRLQEADIDIQSYDFGTVFVDPP
TRMA_ACIB3      VYAAQWNIEQNQIDNIQVARLSAEEFTQAYQGEREF-RRLQEADIDIQSYDFGTVFVDPP
TRMA_ACIBT      VYAAQWNIEQNQIDNIQVARLSAEEFTQAYQGEREF-RRLQEAYIDIQSYDFGTVFVDPP
TRMA_ACIBY      VYAAQWNIEQNQIDNIQVARLSAEEFTQAYQGEREF-RRLQEADIDIQSYDFGTVFVDPP
TRMA_ACIBC      VYAAQWNIEQNQIDNIQVARLSAEEFTQAYQGEREF-RRLQEADIDIQSYDFDTVFVDPP
TRMA_ACIAD      VYAAQWNIEQNQIENIQIARLSAEEFTQAYQGEREF-RRLQEANIDIQSYEFDTIFVDPP
TRMA_NEIG1      VSAAQWNIEANWIGNIKIARLSAEEFTEAYTGKREF-TRLKESGIVLTDYAFSTIFVDPP
TRMA_NEIG2      VSAAQWNIEANWIGNIKIARLSAEEFTEAYTGKREF-TRLKESGIVLTDYAFSTIFVDPP
TRMA_NEIM0      VSAAQWNIEANRIGNIKIARLSAEEFTEAYTGKREF-KRLKDGGIALTDYAFSTIFVDPP
TRMA_NEIMF      VSAAQWNIEANRIGNIKIARLSAEEFTEAYTGKREF-KRLKDGGIALTDYAFSTIFVDPP
TRMA_NEIMA      VGAAQWNIEANGIGNIKIARLSAEEFTEAYTGKREF-ARLKDGGIALTDYAFSTIFVDPP
TRMA_NEIMB      VSAAQWNIEANRIGNIKIARLSAEEFTEAYTGKREF-KRLKDGGIALTDYAFSTIFVDPP
TRMA_DICNV      ITALQENIFLNQTNNIAVARLSAEEFTQAWQKERDF-YRLKQAGIELADYQFETVFVDPP
TRMA_ECOBR      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKSYQCETIFVDPP
TRMA_ECOHS      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKSYQCETIFVDPP
TRMA_ECO8A      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKSYQCETIFVDPP
TRMA_ECOSE      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKSYQCETIFVDPP
TRMA_ECOLI      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKSYQCETIFVDPP
TRMA_ECODH      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKSYQCETIFVDPP
TRMA_ECOBW      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKSYQCETIFVDPP
TRMA_ECOLC      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKSYQCETIFVDPP
TRMA_ECO55      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKSYQCETIFVDPP
TRMA_ECO24      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKSYQCETIFVDPP
TRMA_SHIB3      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKSYQCETIFVDPP
TRMA_SHISS      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKSYQCETIFVDPP
TRMA_ECOSM      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKSYQCETIFVDPP
TRMA_ECOLU      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKSYQCETIFVDPP
TRMA_ECOUT      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKSYQCETIFVDPP
TRMA_ECOL5      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKSYQCETIFVDPP
TRMA_ECOK1      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKSYQCETIFVDPP
TRMA_ECO45      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKSYQCETIFVDPP
TRMA_ECOL6      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKSYQCETIFVDPP
TRMA_ECO57      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKSYQCETIFVDPP
TRMA_ECO5E      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKSYQCETIFVDPP
TRMA_SHIBS      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKSYQFETIFVDPP
TRMA_SHIFL      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKSYQFETIFVDPP
TRMA_SHIF8      VAAAQYNITANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKSYQFETIFVDPP
TRMA_SHIDS      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKSYQCETIFVDPP
TRMA_ECO27      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKSYQCETIFVDPP
TRMA_ECO7I      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-HRLQ--GIDLKSYQCETIFVDPP
TRMA_ECO81      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKSYQCETIFVDPP
TRMA_ESCF3      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKSYQCETIFVDPP
TRMA_ENT38      VASAQYNIAANHIDNVQIIRMAAEEFTQAMNGEREF-NRLQ--GIDLKSYQCETIFVDPP
TRMA_CITK8      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKSYQCETIFVDPP
TRMA_SALA4      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKRYQCETIFVDPP
TRMA_SALSV      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKRYQCETIFVDPP
TRMA_SALCH      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKRYQCETIFVDPP
TRMA_SALDC      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKRYQCETIFVDPP
TRMA_SALEP      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKRYQCETIFVDPP
TRMA_SALG2      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKRYQCETIFVDPP
TRMA_SALTY      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKRYQCETIFVDPP
TRMA_SALPA      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKRYQCETIFVDPP
TRMA_SALPC      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKRYQCETIFVDPP
TRMA_SALPK      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKRYQCETIFVDPP
TRMA_SALTI      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKRYQCETIFVDPP
TRMA_SALHS      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKGYQCETIFVDPP
TRMA_SALNS      VAAAQYNIAANHIDNVQIIRMAAEEFTLAMNGVREF-NRLQ--GIDLKGYQCETIFVDPP
TRMA_SALPB      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKRYQCETIFVDPP
TRMA_SALAR      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKRYQCETIFVDPP
TRMA_KLEP3      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLQSYQCETIFVDPP
TRMA_KLEP7      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVRQF-NRLQ--GIDLHSYQCETIFVDPP
TRMA_CROS8      VAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF-NRLQ--GIDLKSYQCETIFVDPP
TRMA_ERWT9      VASAQYNIAVNQIDNVQIIRMAAEEFTQAMNGERSF-RRLE--GIDLTRYQCETIFVDPP
TRMA_PHOLL      VAAAQYNITANGIDNVQIIRMSAEEFTQAMNGEREF-NRLQ--GINLKSYQCETIFVDPP
TRMA_PROMH      VHAAQYNIAMNHIDNVKIIRMSAEDFTQAMNGVREF-KRLE--GINLQDYQCETIFVDPP
TRMA_PECAS      VAAAQYNIAANQIENVQIIRMAAEEFTQAMQGVRQF-NRLQ--GIDLTSYQCETIFVDPP
TRMA_PECCP      VAAAQYNIAANQIENVQIIRMAAEEFTQAMQGVRQF-NRLQ--GIDLTSYQCETIFVDPP
TRMA_DICP7      VQAAQYNITANQIGNVQIIRMAAEEFTQAMRGVRQF-NRLE--GIDLASYRCDTIFVDPP
TRMA_DICC1      VAAAQYNIAANQIDNVQIIRMAAEEFTQAMNGVRQF-NRLQ--GIDLAGYRCETIFVDPP
TRMA_EDWI9      VAAAQYNIAANQINNVQIIRMSAEEFTQAMQGVRAF-NRLQ--GIDLHSYECNTIFVDPP
TRMA_YERPE      VAAAQYNIAANNIDNVQIIRMSAEEFTQAMQGVREF-NRLK--GIDLGSYNCETIFVDPP
TRMA_YERPP      VAAAQYNIAANNIDNVQIIRMSAEEFTQAMQGVREF-NRLK--GIDLGSYNCETIFVDPP
TRMA_YERPY      VAAAQYNIAANNIDNVQIIRMSAEEFTQAMQGVREF-NRLK--GIDLGSYNCETIFVDPP
TRMA_YERPG      VAAAQYNIAANNIDNVQIIRMSAEEFTQAMQGVREF-NRLK--GIDLGSYNCETIFVDPP
TRMA_YERPA      VAAAQYNIAANNIDNVQIIRMSAEEFTQAMQGVREF-NRLK--GIDLGSYNCETIFVDPP
TRMA_YERPN      VAAAQYNIAANNIDNVQIIRMSAEEFTQAMQGVREF-NRLK--GIDLGSYNCETIFVDPP
TRMA_YERPS      VAAAQYNIAANNIDNVQIIRMSAEEFTQAMQGVREF-NRLK--GIDLGSYNCETIFVDPP
TRMA_YERPB      VAAAQYNIAANNIDNVQIIRMSAEEFTQAMQGVREF-NRLK--GIDLGSYNCETIFVDPP
TRMA_YERP3      VAAAQYNIAANNIDNVQIIRMSAEEFTQAMQGVREF-NRLK--GIDLGSYNCETIFVDPP
TRMA_YERE8      VAAAQYNIAANHIDNVQIIRMSAEEFTQAMQGVREF-NRLK--GIDLTSYNCETIFVDPP
TRMA_SERP5      VAAAQYNIAANQIDNVQIIRMAAEDFTQAMNGVREF-NRLK--GIDLSSYNCETIFVDPP
TRMA_SODGM      VEAAHYNIAANHIDNVQIVRMSAEEFTQAMRKEREF-TRLK--EIDLQSYRCETIFVDPP
TRMA_ACTP2      VQSAQYNIEQNGIDNLQIIRMSAEEFTQAMNGVREF-NRLK--GIDLKAYDCNTIFVDPP
TRMA_ACTP7      VQSAQYNIEQNGIDNLQIIRMSAEEFTQAMNGVREF-NRLK--GIDLKAYDCNTIFVDPP
TRMA_ACTPJ      VQSAQYNIEQNGIDNLQIIRMSAEEFTQAMNGVREF-NRLK--GIDLKAYDCNTIFVDPP
TRMA_HAEDU      VHSAQYNIAQNGIDNLQIIRMSAEEFTQAINGVRQF-NRLQ--GIDLSAYQCNTIFVDPP
TRMA_HAEPS      VESAQYNIAVNGVDNLQIIRMSAEEFTEAMNGVRVF-YRLR--GIDLKQYDCNTIFVDPP
TRMA_HAEIN      VAAAQFNIAENKVDNLQIIRMSAEEFTQAMNGVRAF-NRLK--GIDLKSYECNTIFVDPP
TRMA_HAEI8      VAAAQFNIAENKVDNLQIIRMSAEEFTQAMNGVRAF-NRLK--GIDLKSYECNTIFVDPP
TRMA_HAEIE      VAAAQFNIAENKVDNLQIIRMSAEEFTQAMNGVRAF-NRLK--GIDLKSYECNTIFVDPP
TRMA_MANSM      VAAAQFNIAENGIDNLQIIRMSAEEFTQAMNGVREF-NRLK--GIDLKSYECNTIFVDPP
TRMA_HAES1      VSAAQFNIAANKIDNLHIIRMSAEDFTQAMNGVRAF-NRLK--GINLQDYQCNTIFVDPP
TRMA_HISS2      VSAAQFNIAANKIDNLHIIRMSAEDFTQAMNGVRAF-NRLK--GINLQDYQCNTIFVDPP
TRMA_PASMU      VAAAQFNIAENSIKNLQIIRMSAEEFTQAMNGVREF-HRLK--GIDLNAYECNTIFVDPP
TRMA_AGGAN      VAAAQFNIAANQINNLQIIRMSAEEFTQAMQGVREF-NRLK--GIDLKAYECNTIFVDPP
TRMA_ACTSZ      VAAAQFNIAANQVDNLQIIRMSAEEFTQAVNGVRAF-NRLK--GIDLQAYECHTIFVDPP
TRMA_TOLAT      VHAAQHNIAVNKIDNVQILRMSAEEFTQAMNGEREF-NRLK--GIDLQSYQCNTILVDPP
TRMA_AERHH      VDSAQFNIAANGVDNLIILRMSAEEFTMAMRGEREF-NRLK--GVDLGAYQCNTIFVDPP
TRMA_AERS4      VDSAQFNIAANGVDNLIILRMSAEEFTMAMRGEREF-NRLK--GVDLKSYQCNTIFVDPP
TRMA_ALIF1      VDSAQYNIAANNIDNVQIIRMSAEDFTDAMEGKREF-RRLKDQNIDLKSYNCNTIFVDPP
TRMA_ALIFM      VDSAQYNIAANNIDNVQIIRMSAEDFTDAMEGKREF-RRLKDQNIDLKSYNCNTIFVDPP
TRMA_ALISL      VESAQYNIAANNIDNVQIVRMSAEDFTDAMEGKREF-RRLKDQNVDLKSYNCNTIFVDPP
TRMA_PHOPR      VESAQYNIAVNNIDNVQIVRMSAEDFTDAMAGKREF-RRLKAQNVDLQSYNCNTIFVDPP
TRMA_VIBCH      VEAAQFNIAANQIGNVQIIRMSAEEFTQAMEGKREF-NRLKDAGVDLQSYRCNTIFVDPP
TRMA_VIBC3      VEAAQFNIAANQIGNVQIIRMSAEEFTQAMEGKREF-NRLKDAGVDLQSYRCNTIFVDPP
TRMA_VIBCM      VEAAQFNIAANQIGNVQIIRMSAEEFTQAMEGKREF-NRLKDAGVDLQSYRCNTIFVDPP
TRMA_VIBCB      VVSAQYNIAANEIDNVQILRLSAEEFTQAIEGKREF-RRLQDAGVDLKSYNCNTIFVDPP
TRMA_VIBPA      VESAQYNIAANKIDNVQIIRMSAEEFTEAMEGKREF-RRLKDNGVDLKSYNCNTIFVDPP
TRMA_VIBVU      VESAQYNIAANKIENVQIIRMSAEEFTEAMEGKREF-RRLKDNGIDLKSYNCNTIFVDPP
TRMA_VIBVY      VESAQYNIAANKIENVQIIRMSAEEFTEAMEGKREF-RRLKDNGIDLKSYNCNTIFVDPP
TRMA_VIBTL      VESAQYNIAANKIENVQIIRMSAEDFTVAMEGKREF-RRLQQANIDLKSYNCNTIFVDPP
TRMA_SHEB5      VDAAQYNIEVNGIENLQIIRMSAEDFSDAMAKKRSF-RRLE--GIDLDSYVCNTIFVDPP
TRMA_SHEB9      VDAAQYNIEVNGIENLQIIRMSAEDFSDAMAKKRSF-RRLE--GIDLDSYVCNTIFVDPP
TRMA_SHEB2      VDAAQYNIEVNGIENLQIIRMSAEDFSDAMAKKRSF-RRLE--GIDLDSYVCNTIFVDPP
TRMA_SHEB8      VDAAQYNIEVNGIENLQIIRMSAEDFSDAMAKKRSF-RRLE--GIDLDSYVCNTIFVDPP
TRMA_SHEPC      VEAAQYNIEANGIKNLQIIRMSAEDFSDAMAKKRSF-RRLE--GIDLDSYVCNTIFVDPP
TRMA_SHESW      VEAAQYNIEANGIKNLQIIRMSAEDFSDAMAKKRSF-RRLE--GIDLDSYVCNTIFVDPP
TRMA_SHESA      VDAAQYNIEVNNIDNLQIIRMSAEEFSDAMAKKRSF-RRLE--GIDLDSYVCNTIFVDPP
TRMA_SHESR      VDAAQYNIEVNNIDNLQIIRMSAEEFSDAMAKKRSF-RRLE--GIDLDSYVCNTIFVDPP
TRMA_SHESM      VDAAQYNIEVNNIDNLQIIRMSAEEFSDAMAKKRSF-RRLE--GIDLDSYVCNTIFVDPP
TRMA_SHEON      VDAAQYNIEINGIDNLQIIRMSAEEFSDAMAKKRSF-RRLE--GIDLDSYLCNTIFVDPP
TRMA_SHEDO      VGAAQYNIAINNVDNVQIIRMSAEDFSDAMAKKRSF-RRLE--GIDLDSYNCNTIFVDPP
TRMA_SHEFN      VDAAQYNIDINHVDNVQIIRMSAEDFSDAMAKKRQF-RRLE--GIDLDSYDCNTIFVDPP
TRMA_SHEHH      VESAQYNIKVNQVENLQIIRMSAEDFTEAMAKKRSF-RRLE--GIDLDSYNCNTIFVDPP
TRMA_SHEPA      VESAQYNIKVNQVENLQIIRMSAEDFTEAMAKKRSF-RRLE--GIDLDSYNCNTIFVDPP
TRMA_SHEPW      VESAQYNIKMNHVDNLQIIRMSAEDFTDAMAKKRSY-RRLE--GIDLDSYNCNTIFVDPP
TRMA_SHESH      VESAQYNIKINKIDNLQIIRMSAEDFTDAMAKKRTF-RRLE--GIDLDSYNCNTIFVDPP
TRMA_SHEWM      VESAQYNIKINKIDNLQIIRMSAEDFTDAMAKKRSF-RRLE--GIDLDSYNCNTIFVDPP
TRMA_SHELP      VDSAQYNIEANQIDNLQIIRMSAEDFTDALAKKRSF-RRLE--GVDLDSYDCNTIFVDPP
TRMA_SHEAM      VEAAQYNIQVNKVSNLDIVRMSAEEFTEAMKGEKRF-NRLG--DIDLQSYQCNTIFVDPP
TRMA_ALTMD      VQAAQFNIEQNRLHNVKIVRLAAEEFTQAMKGKRTF-SRLE--GIDLSEYNFTTVLVDPP
TRMA_PSEA6      VAAAQDNIRLNNIENVTILRMSSEEFVQALNNERSF-RRLE--GINLQDYDCQTVLVDPP
TRMA_PSYIN      VESAQFNMAQNGINNVTVIRMSAEEFTQAINGEREF-YRLK--EITLSDYQCNTILVDPP
TRMA_PSEHT      VHSAQYNIAQNKVDNLDIIRMSSEEFTQAMNGERSF-SRLE--GIDLNSYNCQTILVDPP
TRMA_COLP3      VRSAQINISENGIDNIDIVRMSSEEFSQAMNGERKF-RRLE--DFDLTTYNYDTVLVDPP
TRMA_IDILO      VAAARENAELNNIKNVTVVRMSAEEFSAALSGELES-KRAA--DAEIHSFDCQTVLVDPP
TRMA_MARMS      VNSAQLNIAINGMHNVQVVKMASEDVSAALNGDVELPKSLV--QAGVSELTPSVVLVDPP
TRMA_HYDCU      VASAQFNIEANKVDNVTVVKMAAEEISAALQGETFF--RLK--DIDLSAYAFNTIFVDPP
TRMA_CELJU      VDSALYNSRLNQVENLQIARMSSEEFTQAMDGVREF-NRLK--HISLNDYRFSTIFVDPP
TRMA_AROAE      VEAAHYNLAANDIGNVAMVRMSSDEISAALARTREF-RRMK--DVDLDRYRFSTLFVDPP
TRMA_AZOSB      VRAAHYNLAANAVDNVTMVRMASEEISDALAGGRAY-RRMQ--GIDLAGYRFGTLFVDPP
TRMA_DECAR      VHAAQYNLAANQVENVALVRMSSEEFSNALAGREEF-QRLK--DIDLEPFRHATLFVDPP
TRMA_PSEAE      VNAALANLADNAVDNVSLVRLSAEELTQALNEVRPF-RRLA--DIDLKSYAFGSVFVDPP
TRMA_PSEA8      VNAALANLADNAVDNVSLVRLSAEELTQALNEVRPF-RRLA--DIDLKSYAFGSVFVDPP
TRMA_PSEAB      VNAALANLADNAVDNVSLVRLSAEELTQALNEVRPF-RRLA--DIDLKSYAFGNVFVDPP
TRMA_PSEA7      VNAALANLADNAVDNVSLVRLSAEELTQALNEVRPF-RRLA--DIDLKSYAFGSVFVDPP
TRMA_AZOVD      VNAALTNLESNGVDNVTLVRLSAEELTQALNEVRPF-RRLA--GVDLKGYDFGSLFVDPP
TRMA_PSEMY      VNAALANLADNGVNNVELVRLSAEELTQALNEVRPF-RRLA--GIDLKSYDFGSVFVDPP
TRMA_PSEU5      VNAALANIEDNGLDNIELVRLSAEELTQALNEVRPF-RRLA--GIDLKSYSFGSVFVDPP
TRMA_PSEP1      VNAALSNLDENAVDNVRLVRLSAEELTQALNEVRPF-RRLE--GIDLKSYQFGTVFVDPP
TRMA_PSEPK      VNAALSNLDENAVDNVRLVRLSAEELTQALNEVRPF-RRLE--GIDLKSYQFGTVFVDPP
TRMA_PSEPG      VNAALSNLDENAVDNVRLVRLSAEELTQALNEVRPF-RRLE--GIDLKSYEFGTVFVDPP
TRMA_PSEPW      VNAALSNLSENAVDNVRLVRLSAEELTQALNEVRPF-RRLE--GIDLKSYAFGTVFVDPP
TRMA_PSEE4      VNAALHNLDENGVDNVRLVRLSAEELTQALNEVRPF-RRLE--GIDLKSYDFGTVFVDPP
TRMA_PSEFL      VNAALSNLDENAVDNVTLVRLSAEELTEALNEVRPF-RRLH--GIDLKSYEFGSVFVDPP
TRMA_PSEFS      VNAALSNLDENAVGNVTLVRLSAEELTEALNEVRPF-RRLH--GIDLKRYEFSSVFVDPP
TRMA_PSEPF      VNAALSNLAENAVDNVTLVRLSAEELTEALNEVRPF-RRLH--GIDLKSYEFGSVFVDPP
TRMA_PSEF5      VNAALSNLSENAVDNVTLVRLSAEELTEALNEVRPF-RRLQ--GVDLKSYEFGSVFVDPP
TRMA_PSE14      VNAALSNLDDNGVDNVTLVRLSAEELTEALNEVRPF-RRLH--GVDLKSYDFGSVFVDPP
TRMA_PSEU2      VNAALSNLDDNGVDNVTLVRLSAEELTEALNEVRPF-RRLH--GVDLKSYDFGSVFVDPP
TRMA_PSESM      VNAALSNLDDNGVDNVTLVRLSAEELTEALNEVRPF-RRLQ--GIDLKSYDFGSVFVDPP
TRMA_CHRSD      VASANVNLEANAVANAVVARMSAEEFSAALAGEKTG-RRVA--ALALDEHTFTTALVDPP
TRMA_SACD2      VKAAEYNIEKNGCKNITIARMSSEEFTEALNGVREF-RRLK--DIELDSYNFSTVFVDPP
TRMA_TERTT      VKSALYNIEQNGATNIAIARLSSEEFTEAMNKVRRF-RRLE--NIDLDSYQFSTIFVDPP
TRMA_SULNB      IHAALQNCELNAVENITFARLASEEMTEALNGVREF-SRLK--GIDLKSYDFSTVLVDPP
TRMA_NITSB      IKAAKENVALNGIENVEFVRLSSQEVTQALRGVRDF-RRLE--NIDLHSYNFQTVFVDPP
TRMA_SULDN      INAAKSNMSLNKVKNISFVRMGVEEFVEALDGVRIF-NRMK--EIDIDSYEIKTIFVDPP
TRMA_WOLSU      IHAAKQNCELNSVRHISFVRLNAQETQSALEGEREF-YRLR--ELDLPSYDFQAVFVDPP
TRMA_HELHP      ITLLQKNMAKNNIENIIPARLNAFESIQALRKERVF-FRLK--NIDLDAFAFDCVLIDPP
TRMA_CAMC1      IANALKNCELNGVENIKFLRMDADELMSAFAGVREF---NRLKDIKLSDFNFSHVLVDPP
TRMA_CAMC5      IANALKNCERNGIGNIKFLRMSAEELMSAFSGERGF---RRLEGVNLADFTFSHVLVDPP
TRMA_CAMFF      INSALKNCELNGVDNIKFTRLSAEELMEAFLFKRDF---RRLQDIDLRSYEFSHILVDPP
TRMA_CAMHC      IKNARENSK--NKDNINFVRMSAKELIDAFNGVREF---NRLKDIDITDFDFSHVLVDPP
TRMA_CAMJE      INFALKNCELNNTTNIHFARLSSEELSLAIKKEREF---FRLKDIRLDDFNFSHVLVDPP
TRMA_CAMJ8      INFALKNCKLNNTTNIHFARLSSEELSLAIKKEREF---FRLKDIRLDDFNFSHVLVDPP
TRMA_CAMJJ      INFALKNCELNNTTNIHFARLSSEELSLAIKKEREF---FRLKDIRLDDFNFSHVLVDPP
TRMA_CAMJR      INFALKNCELNNTTNIHFARLSSEELSLAIKKEREF---FRLKDIRLDDFNFSHVLVDPP
TRMA_CAMJD      INFALKNCKLNNTTNIHFARLSSEELSLAIKKEREF---FRLKDIRLDDFNFSHVLVDPP
TRMA_CAMLR      IEFALKNCDLNSIKNISFTRLSSEELSQALKKEREF---NRLKGIDLDGFNISHVLVDPP
TRMA_ARCB4      IKSALRNCSLNKIESISFIRMSAEDFVQALNKVRAF---NRLKDINLDDYEFDTIFMDPP
TRMA_NAUPA      IEAATYNAEINARDNITFLAMSAAEFSKLYKD----------RSPLITKYDLKNILIDPP
                :     *             :   :                     :        ::***

TRMA_ACIB5      RAGIDDE-TLKLLQGFERIIYISCNPDTLYENLKTLTQTHRVTKFALFDQFPYTHHVESG
TRMA_ACIBS      RAGIDDE-TLKLLQGFERIIYISCNPDTLYENLKTLTQTHRVTKFALFDQFPYTHHVESG
TRMA_ACIB3      RAGIDDE-TLKLLQGFERIIYISCNPDTLYENLKTLTQTHRVTKFALFDQFPYTHHVESG
TRMA_ACIBT      RAGIDDE-TLKLLQGFERIIYISCNPDTLYENLKTLTQTHRVTKFALFDQFPYTHHVESG
TRMA_ACIBY      RAGIDDE-TLKLLQGFERIIYISCNPDTLYENLKTLTQTHRVTKFALFDQFPYTHHVESG
TRMA_ACIBC      RAGIDDE-TLKLLQSFERIIYISCNPNTLYENLKTLTQTHRVTKFALFDQFPYTHHVESG
TRMA_ACIAD      RAGIDDE-TLKLLKGFKRILYISCNPDTLYNNLKTLSQTHKITRFALFDQFPFTHHVESG
TRMA_NEIG1      RAGIDEE-TLKLVSQFDNIIYISCNPETLRANLDTLTETHTVGRAALFDQFPFTHHIESG
TRMA_NEIG2      RAGIDEE-TLKLVSQFDNIIYISCNPETLRANLDTLTETHTVGRAALFDQFPFTHHIESG
TRMA_NEIM0      RAGIDEE-TLKLVSQFDNIIYISCNPETLRTNLDTLAETHTVERAALFDQFPFTHHIESG
TRMA_NEIMF      RAGIDEE-TLKLVSQFDNIIYISCNPETLRTNLDTLAETHTVERAALFDQFPFTHHIESG
TRMA_NEIMA      RAGIDEE-TLKLVSQFDNIIYISCNPETLRANLDTLVETHVVERAALFDQFPFTHHIESG
TRMA_NEIMB      RAGIDEE-TLKLVSQFDNIIYISCNPETLRANLDTLAETHAVERAALFDQFPFTHHIESG
TRMA_DICNV      RAGIDDN-TLFLLQKFPKIIYISCNPHTLAANLQTLTQTHELCAAALFDQFPDTPHIECG
TRMA_ECOBR      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
TRMA_ECOHS      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
TRMA_ECO8A      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
TRMA_ECOSE      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
TRMA_ECOLI      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
TRMA_ECODH      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
TRMA_ECOBW      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
TRMA_ECOLC      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
TRMA_ECO55      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
TRMA_ECO24      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
TRMA_SHIB3      RSGLDSE-TEKMVQAYPCILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
TRMA_SHISS      RSGLDSE-TEKMVQAYPCILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
TRMA_ECOSM      RSGLDGE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
TRMA_ECOLU      RSGLDGE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
TRMA_ECOUT      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
TRMA_ECOL5      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
TRMA_ECOK1      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
TRMA_ECO45      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
TRMA_ECOL6      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
TRMA_ECO57      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
TRMA_ECO5E      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECS
TRMA_SHIBS      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
TRMA_SHIFL      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
TRMA_SHIF8      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
TRMA_SHIDS      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
TRMA_ECO27      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
TRMA_ECO7I      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
TRMA_ECO81      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
TRMA_ESCF3      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
TRMA_ENT38      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
TRMA_CITK8      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHNVSRLALFDQFPYTHHMECG
TRMA_SALA4      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHTVSRLALFDQFPYTHHMECG
TRMA_SALSV      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHTVSRLALFDQFPYTHHMECG
TRMA_SALCH      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHTVSRLALFDQFPYTHHMECG
TRMA_SALDC      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHTVSRLALFDQFPYTHHMECG
TRMA_SALEP      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHTVSRLALFDQFPYTHHMECG
TRMA_SALG2      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHTVSRLALFDQFPYTHHMECG
TRMA_SALTY      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHTVSRLALFDQFPYTHHMECG
TRMA_SALPA      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHTVSRLALFDQFPYTHHMECG
TRMA_SALPC      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHTVSRLALFDQFPYTHHMECG
TRMA_SALPK      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHTVSRLALFDQFPYTHHMECG
TRMA_SALTI      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHTVSRLALFDQFPYTHHMECG
TRMA_SALHS      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHTVSRLALFDQFPYTHHMECG
TRMA_SALNS      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHTVSRLALFDQFPYTHHMECG
TRMA_SALPB      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHTVSRLALFDQFPYTHHMECG
TRMA_SALAR      RSGLDSE-TEKMVQAYPRILYISCNPETLCKNLETLSQTHTVSRLALFDQFPYTHHMECG
TRMA_KLEP3      RSGLDSE-TEKMVQAYPRILYISCNPETLCRNLETLSQTHNVTRLALFDQFPYTHHMECG
TRMA_KLEP7      RSGLDSE-TEKMVQAYPRILYISCNPETLCRNLETLSQTHNVTRLALFDQFPYTHHMECG
TRMA_CROS8      RSGLDQE-TVKMVQAYPHILYISCNPQTLCENLDTLSQTHRVERLALFDQFPYTHHMECG
TRMA_ERWT9      RSGLDDE-TVKMVQAYPRILYISCNPQTLCENLTALSTTHDVTRLALFDQFPYTHHMECG
TRMA_PHOLL      RSGLDEK-TLEMVRAYPRILYISCNPETLCHNLETLTQTHKISHLALFDQFPYTHHMECG
TRMA_PROMH      RSGLDEK-TVELVKNYSRILYISCNPQTLCQNLETLIKTHKISKLALFDQFPYTHHMECG
TRMA_PECAS      RSGLDDE-TVKLVQAYPRILYISCNPETLSNNLKTLSETHDIRRLALFDQFPYTHHMECG
TRMA_PECCP      RSGLDDE-TVKLVQAYPRILYISCNPETLSHNLQTLSETHDIRRLALFDQFPYTHHMECG
TRMA_DICP7      RSGLDEE-TVRLVQEYPRILYISCNPETLCANLATLTQTHRVSQLALFDQFPYTHHMECG
TRMA_DICC1      RSGLDDG-TAKLVQAYPRILYISCNPETLCANLETLSQTHRISQLALFDQFPYTHHMECG
TRMA_EDWI9      RSGLDTE-TLGMVQGYPNILYISCNPLTLCDNLHTLNQSHRITRLALFDQFPYTHHMECG
TRMA_YERPE      RSGLDHE-TVKLVQAYPRILYISCNPETLCANLEQLQHTHKISRLALFDQFPYTHHMECG
TRMA_YERPP      RSGLDHE-TVKLVQAYPRILYISCNPETLCANLEQLQHTHKISRLALFDQFPYTHHMECG
TRMA_YERPY      RSGLDHE-TVKLVQAYPRILYISCNPETLCANLEQLQHTHKISRLALFDQFPYTHHMECG
TRMA_YERPG      RSGLDHE-TVKLVQAYPRILYISCNPETLCANLEQLQHTHKISRLALFDQFPYTHHMECG
TRMA_YERPA      RSGLDHE-TVKLVQAYPRILYISCNPETLCANLEQLQHTHKISRLALFDQFPYTHHMECG
TRMA_YERPN      RSGLDHE-TVKLVQAYPRILYISCNPETLCANLEQLQHTHKISRLALFDQFPYTHHMECG
TRMA_YERPS      RSGLDHE-TVKLVQAYPRILYISCNPETLCANLEQLQHTHKISRLALFDQFPYTHHMECG
TRMA_YERPB      RSGLDHE-TVKLVQAYPRILYISCNPETLCANLEQLQHTHKISRLALFDQFPYTHHMECG
TRMA_YERP3      RSGLDHE-TVKLVQAYPRILYISCNPETLCANLEQLQHTHKISRLALFDQFPYTHHMECG
TRMA_YERE8      RSGLDDE-TVKLVQAYPRILYISCNPETLCANLEQLQYTHKISRLALFDQFPYTHHMECG
TRMA_SERP5      RSGLDDE-TVKMVQAYPRILYISCNPETLCANLETLQQTHSISRLALFDQFPYTHHMECG
TRMA_SODGM      RSGLDEA-TVSMVQAYPQILYISCNPDSLCRNLSTLSTTHTIERLALFDQFPYTHHMECG
TRMA_ACTP2      RAGLDQD-TLNMVQAYERILYISCNPYTLAENLRQLSLTHRIERAALFDQFPYTHHVESG
TRMA_ACTP7      RAGLDQD-TLNMVQAYERILYISCNPYTLAENLRQLSLTHRIERAALFDQFPYTHHVESG
TRMA_ACTPJ      RAGLDQD-TLNMVQAYERILYISCNPHTLADNLQQLTQTHRIERAALFDQFPYTHHVESG
TRMA_HAEDU      RAGLDQA-TLNMVQNYPRILYISCNPATLADNLRQLTTTHRIERVALFDQFPYTHHIESG
TRMA_HAEPS      RVGLDQA-TLEMVQGYEKILYISCNPHTLADNLKQLTQTHRIERCALFDQFPYTEHIESG
TRMA_HAEIN      RAGLDPD-TVKLVQNYDRILYISCNPHTLCDNLVELSKTHRIEKAALFDQFPYTDHMESG
TRMA_HAEI8      RAGLDPD-TVKLVQNYDRILYISCNPHTLCDNLVELSKTHRIEKAALFDQFPYTDHMESG
TRMA_HAEIE      RAGLDPD-TVKLVQNYDRILYISCNPHTLCDNLVELSKTHRIEKAALFDQFPYTDHMESG
TRMA_MANSM      RAGLDPD-TVKLVQNYDRILYISCNPNTLCNNLTELTKTHRIEKAALFDQFPYTDHMESG
TRMA_HAES1      RAGLDMA-TVKLVQNYERILYISCNPYTLCENLQELTKTHRIEKAALFDQFPYTEHMESG
TRMA_HISS2      RSGLDMA-TVKLVQNYERILYISCNPYTLCENLQELTKTHRIEKAALFDQFPYTEHMESG
TRMA_PASMU      RAGLDEE-TVKLVQNYDRILYISCNPHTLCDNLQHLCQTHRIEKAALFDQFPYTEHMEAG
TRMA_AGGAN      RAGLDAD-TVKLVQQYERILYISCNPHTLCDNLQTLSQTHRIEKAALFDQFPYTEHMEAG
TRMA_ACTSZ      RAGLDSD-TVKLVQKYDRILYISCNPQTLCENLQILSQTHRIERAALFDQFPYTEHMEAG
TRMA_TOLAT      RAGLDPA-TVAMIQAYEQILYISCNPETLCDNLKTLCQTHNIARCALFDQFPFTHHMESG
TRMA_AERHH      RAGLDDA-TVKLVQDYDNILYISCNPETLQANMAVLGETHEIARFALFDQFPWTHHMEAG
TRMA_AERS4      RAGLDDA-TVKLVQEYDNILYISCNPETLQANMAVLGETHEVARFALFDQFPWTHHMEAG
TRMA_ALIF1      RSGMDEG-TCKMVQGYERIMYISCNPETLKENLEILSQTHNITRFALFDQFPYTHHMEAG
TRMA_ALIFM      RSGMDEG-TCKMVQGYERIMYISCNPETLKENLEILSQTHNITRFALFDQFPYTHHMEAG
TRMA_ALISL      RSGMDEG-TCKMVQGYERIMYISCNPDTLKENLAILSKTHNITRFALFDQFPYTHHMEAG
TRMA_PHOPR      RSGMDEG-TCRMVQGYERIMYISCNPDTLKENLEILSQTHKITRFALFDQFPYTHHMEAG
TRMA_VIBCH      RSGMDID-TCKMVQGYERILYISCNPETLQENLQVLGETHQVVRFALFDQFPYTHHMEAG
TRMA_VIBC3      RSGMDID-TCKMVQGYERILYISCNPETLQENLQVLGETHQVVRFALFDQFPYTHHMEAG
TRMA_VIBCM      RSGMDID-TCKMVQGYERILYISCNPETLQENLQVLGETHQVVRFALFDQFPYTHHMEAG
TRMA_VIBCB      RSGMDVD-TCKMVQGYERIMYISCNPETLKENLDILCETHNVTRFALFDQFPYTHHMEAG
TRMA_VIBPA      RAGMDVD-TCKMVQGYERIMYISCNPETLKENLDILSETHNVTRFALFDQFPYTHHMEAG
TRMA_VIBVU      RSGMDVD-TCKMVQGYERILYISCNPETLKENLDILSETHHITRFALFDQFPYTHHMEAG
TRMA_VIBVY      RSGMDVD-TCKMVQGYERILYISCNPETLKENLDILSETHHITRFALFDQFPYTHHMEAG
TRMA_VIBTL      RSGMDVD-TCKMVQGYERIMYISCNPETLKENLDILSETHDITRFALFDQFPYTHHMEAG
TRMA_SHEB5      RAGIDPD-TLALVQGYERILYISCNPETLKDNLQQLNETHKVTRFALFDQFPYTDHMETG
TRMA_SHEB9      RAGIDPD-TLALVQGYERILYISCNPETLKDNLQQLNETHKVTRFALFDQFPYTDHMETG
TRMA_SHEB2      RAGIDPD-TLALVQGYERILYISCNPETLKDNLQQLNETHKVTRFALFDQFPYTDHMETG
TRMA_SHEB8      RAGIDPD-TLALVQGYERILYISCNPETLKDNLQLLNETHKVTRFALFDQFPYTEHMETG
TRMA_SHEPC      RAGIDPD-TLALVQGYERILYISCNPDTLKDNLEQLYKTHRVTQFALFDQFPYTDHMETG
TRMA_SHESW      RAGIDPD-TLALVQGYERILYISCNPDTLKDNLEQLYKTHRVTQFALFDQFPYTDHMETG
TRMA_SHESA      RAGIDPA-TLELVRGYERILYISCNPDTLKDNLQQLNQTHKVTRFALFDQFPYTDHMETG
TRMA_SHESR      RAGIDPA-TLELVQGYERILYISCNPDTLKDNLQQLNQTHKVTRFALFDQFPYTDHMETG
TRMA_SHESM      RAGIDPA-TLELVQGYERILYISCNPDTLKDNLQQLNQTHKVTRFALFDQFPYTDHMETG
TRMA_SHEON      RAGIDPA-TLDLVQGYERILYISCNPDTLKDNLQQLYKTHKVTRFALFDQFPYTDHMETG
TRMA_SHEDO      RAGIDDE-TLKLIQGYERILYISCNPETLKDNLQTLSSSHKITRFALFDQFPYTHHMESG
TRMA_SHEFN      RAGIDPE-TLKLIQGYERILYISCNPETLNDNLLTLGQTHKITRFALFDQFPYTDHMESG
TRMA_SHEHH      RAGLDAD-TVKLVQGYERIVYISCNPHTLLDNLAELSKTHKITRFALFDQFPYTDHMESG
TRMA_SHEPA      RAGLDAD-TVKLVQGYERIVYISCNPNTLIDNLAELSKTHKITRFALFDQFPYTDHMESG
TRMA_SHEPW      RAGLDEN-TVKLVQGYERIVYISCNPNTLLDNLKELSKTHNITRFVLFDQFPYTDHMESG
TRMA_SHESH      RAGMDPD-TVKLVQGYDRIVYISCNPNTLIDNLAELSKTHKITRFALFDQFPYTDHMESG
TRMA_SHEWM      RAGMDPD-TVKLVQGYERIVYISCNPNTLIDNLVELSKTHKITRFALFDQFPYTDHMESG
TRMA_SHELP      RAGLDDN-TLSMVQGYERILYISCNPNTLLDNLKVLDKTHKITRFALFDQFPYTDHMESG
TRMA_SHEAM      RAGLDDE-TVKLVQGYENILYISCNPDTLNDNLKVLSETHEVVRFALFDQFPYTHHTEAG
TRMA_ALTMD      RAGLDED-SLRMIQDYDNIVYISCNPETLAQNLELLSETHDVAQSALFDQFPFTHHIEAG
TRMA_PSEA6      RSGLDDD-TLDMIKEYQNIVYISCNPETLNNNLAVLSETHNVVRFALFDQFPYTHHVESG
TRMA_PSYIN      RSGLDDE-TVKMVQHYDNILYISCNADTLSRNLEVLSKTHEIKRFALFDQFPYTYHSEAG
TRMA_PSEHT      RAGMDTL-TCDLVANYESIIYISCNPETLERDLDHLTRTHEVKRFAIFDQFPYTHHIESG
TRMA_COLP3      RAGLDRD-SVELVRRFNKIIYISCNPETLKDNLALLVETHQIDKFALFDQFPYTDHIETG
TRMA_IDILO      RAGLDKD-TLKLVSQYQRIIYISCNPETLTENIHDLSSSHKVTAAAMFDQFPYTDHIETG
TRMA_MARMS      RAGLDDA-TVELIRKIDSILYISCNPETLKANLEALSNTHEVVRYAMFDQFPYTHHVETG
TRMA_HYDCU      RSGLDDL-TRQMVTEFDYIIYISCNPETLAHDLEAIRQTHEVLETALFDQFPYTHHIESG
TRMA_CELJU      RAGLDPA-TCHLAQRFDNIVYISCNPETLKDNLQTLTQTHQICTFAAFDQFPYTHHLECG
TRMA_AROAE      RSGLDAP-TVELARGFDRILYISCNPQTLQENVAALQATHGIAGAAVFDQFPYTRHLECG
TRMA_AZOSB      RSGLDEA-TVALARRFDRILYISCNPQTLHDNIAALRDTHGIAAAAAFDQFPYTHHLECG
TRMA_DECAR      RSGLDAV-TLELARGFDRILYISCNQETLRENVIALQDTHEIKASAVFDQFPYTHHLECG
TRMA_PSEAE      RAGMDPD-TCELARRFERILYISCNPETLAQNIAQLHDTHRISRCALFDQFPYTHHMESG
TRMA_PSEA8      RAGMDPD-TCELARRFERILYISCNPETLAQNIAQLHDTHRISRCALFDQFPYTHHMESG
TRMA_PSEAB      RAGMDPD-TCELTRRFERILYISCNPETLAQNIAQLHDTHRISRCALFDQFPYTHHMESG
TRMA_PSEA7      RAGMDPD-TCELTRRFERILYISCNPETLAQNIAQLHDTHRISRCALFDQFPYTHHMESG
TRMA_AZOVD      RAGMDPD-TCELARRFGRILYISCNPETLAANIARLHDTHRVVRCALFDQFPYTHHMESG
TRMA_PSEMY      RAGMDPD-TCELTRRFERILYISCNPETLAANIAQLSDTHQVTRCALFDQFPYTHHMEAG
TRMA_PSEU5      RAGMDPD-TCELTRRFERILYISCNPETLAQNIAQLADTHRIERCALFDQFPYTHHMEAG
TRMA_PSEP1      RAGMDPD-TCELTRRFERILYISCNPETLAANIAQLQDTHRIERCALFDQFPYTHHMESG
TRMA_PSEPK      RAGMDPD-TCELTRRFERILYISCNPETLAANIAQLQDTHRIERCALFDQFPYTHHMESG
TRMA_PSEPG      RAGMDPD-TCELTRRFERILYISCNPETLAANIAQLQDTHRIERCALFDQFPYTHHMESG
TRMA_PSEPW      RAGMDPD-TCELTRRFERILYISCNPETLAQNISQLQDTHRIERCALFDQFPYTHHMESG
TRMA_PSEE4      RAGMDPD-TCELTRRFERILYISCNPETLAQNIAQLQDTHRIERCALFDQFPYTHHMESG
TRMA_PSEFL      RAGMDPD-TCELTRRFENILYISCNPETLAANIAQLHDTHRITQCAMFDQFPWTHHMESG
TRMA_PSEFS      RAGMDPD-TCELTRRFDNILYISCNPETLAANIAQLHDTHRITKCAMFDQFPWTHHMESG
TRMA_PSEPF      RAGMDPD-TCELTRRFDNILYISCNPETLAANIAQLHDTHRITRCALFDQFPWTHHMESG
TRMA_PSEF5      RAGMDPD-TCELTRRFDNILYISCNPETLAANIAQLHDTHRITRCALFDQFPWTHHMESG
TRMA_PSE14      RAGMDPD-TCELTRRFERILYISCNPETLAANIAQLHDTHRVERCALFDQFPYTHHMESG
TRMA_PSEU2      RAGMDPD-TCELTRRFERILYISCNPETLAANIAQLHDTHRVERCALFDQFPYTHHMESG
TRMA_PSESM      RAGMDPD-TCELTRRFERILYISCNPETLAANIAQLYDTHRIERCALFDQFPYTHHMESG
TRMA_CHRSD      RAGLDAH-SCEQLKVYERIVYISCNPDTLEANLEQLSATHVVTRFALFDQFPYTDHCECG
TRMA_SACD2      RAGLDED-TEALISRFDNIIYISCNPDTLANNLANLCKTHKVERFALFDQFPYTDHRECG
TRMA_TERTT      RAGLDTD-TVKLASRFDNIIYISCNPDTLADNLASLATTHEVTRLALFDQFPYTEHRECG
TRMA_SULNB      RAGLDEG-TIELISNIDNIIYISCNPETLARDLETLIKTHTVMEAALFDQFPHTEHVESG
TRMA_NITSB      RCGLDDD-TRELVREFDNIVYISCNPQTLHRDLEELSKTHTVQKVAVFDQFPYTPHLESG
TRMA_SULDN      RSGMDEA-TCRFASRYENIIYISCNPQTLLRDLELLTKTHNVIDMALFDQFPYTHHAEMG
TRMA_WOLSU      RAGLGAE-VASFLRRFDQILYISCNPKTLQSDLEVLQLSHDVERFALFDQFPYTPHLESG
TRMA_HELHP      RSGVGEEEVLYFLQNFNTIIYVSCNPHTLLNDLRILSQSHYVMRFGLFDQFPHTYHRECI
TRMA_CAMC1      RAGLSES-VINFIRNFKNIIYISCNPETLKENLNELTKSHKVIKFALFDQFANTHHIECG
TRMA_CAMC5      RAGLEAS-VINFIKNYENIVYISCNPQTLYENLKELSLTHKATKFAMFDQFANTNHIECG
TRMA_CAMFF      RAGCDKS-VLDFIRNYENIIYISCNPLTLKENLKLLCKTHSVDKFAIFDQFVHTNHIECA
TRMA_CAMHC      RAGIEPE-VLDFIQNFKNIIYISCNPASLKQNLQILCETHKITKFALFDQFVHTEHIECG
TRMA_CAMJE      RAGLDKS-VIDLIKKYGNIIYISCNPMTLKENLKELSLTHRVEEFALFDQFVNTPHLECG
TRMA_CAMJ8      RAGLDKS-VIDLIKKYENIIYISCNPITLKENLKELSLTHRVEEFALFDQFVNTPHLECG
TRMA_CAMJJ      RAGLDKS-VIDLIKKYENIIYISCNPITLKENLKELSLTHRVEEFALFDQFVNTPHLECG
TRMA_CAMJR      RAGLDKS-VIDLIKKYENIIYISCNPITLKENLKELSLTHRVEEFALFDQFVNTPHLECG
TRMA_CAMJD      RAGLDKS-VIDLIKKYENIIYISCNPITLKENLKELSLTHRVENFALFDQFVNTPHLECG
TRMA_CAMLR      RAGLDVS-VIELIKKYENIIYISCNPITLRENLEILSQSHEILNLAFFDQFANTSHLECG
TRMA_ARCB4      RSGLDDT-TRNLAKDFENIIYISCNPETLHRDLEELTKTHEIEKFALFDQFAFTNHIESG
TRMA_NAUPA      RAGLDDK-SREFVNEFDNIIYISCNPETLQRDLKTLAKGREIKAFAFFDQFPYTNHAECG
                * *               *:*:***  :*  ::  :   :       ****  * * *  

TRMA_ACIB5      VLLEKI-------
TRMA_ACIBS      VLLEKI-------
TRMA_ACIB3      VLLEKI-------
TRMA_ACIBT      VLLEKI-------
TRMA_ACIBY      VLLEKI-------
TRMA_ACIBC      VLLEKI-------
TRMA_ACIAD      VLLELI-------
TRMA_NEIG1      VLLKKKIL-----
TRMA_NEIG2      VLLKKKIL-----
TRMA_NEIM0      VLLKKKILGKSKR
TRMA_NEIMF      VLLKKKILGKSKR
TRMA_NEIMA      VLLKKKIL-----
TRMA_NEIMB      VLLKKKIL-----
TRMA_DICNV      VVLRKK-------
TRMA_ECOBR      VLLTAK-------
TRMA_ECOHS      VLLTAK-------
TRMA_ECO8A      VLLTAK-------
TRMA_ECOSE      VLLTAK-------
TRMA_ECOLI      VLLTAK-------
TRMA_ECODH      VLLTAK-------
TRMA_ECOBW      VLLTAK-------
TRMA_ECOLC      VLLTAK-------
TRMA_ECO55      VLLTAK-------
TRMA_ECO24      VLLTAK-------
TRMA_SHIB3      VLLTAK-------
TRMA_SHISS      VLLTAK-------
TRMA_ECOSM      VLLTAK-------
TRMA_ECOLU      VLLTAK-------
TRMA_ECOUT      VLLTAK-------
TRMA_ECOL5      VLLTAK-------
TRMA_ECOK1      VLLTAK-------
TRMA_ECO45      VLLTAK-------
TRMA_ECOL6      VLLTAK-------
TRMA_ECO57      VLLTAK-------
TRMA_ECO5E      VLLTAK-------
TRMA_SHIBS      VLLTAK-------
TRMA_SHIFL      VLLTAK-------
TRMA_SHIF8      VLLTAK-------
TRMA_SHIDS      VLLTAK-------
TRMA_ECO27      VLLTAK-------
TRMA_ECO7I      VLLTAK-------
TRMA_ECO81      VLLTAK-------
TRMA_ESCF3      VLLTAK-------
TRMA_ENT38      VLLTLK-------
TRMA_CITK8      VLLTAR-------
TRMA_SALA4      VLLTAR-------
TRMA_SALSV      VLLTAR-------
TRMA_SALCH      VLLTAR-------
TRMA_SALDC      VLLTAR-------
TRMA_SALEP      VLLTAR-------
TRMA_SALG2      VLLTAR-------
TRMA_SALTY      VLLTAR-------
TRMA_SALPA      VLLTAR-------
TRMA_SALPC      VLLTAR-------
TRMA_SALPK      VLLTAR-------
TRMA_SALTI      VLLTAR-------
TRMA_SALHS      VLLTAR-------
TRMA_SALNS      VLLTAR-------
TRMA_SALPB      VLLTAR-------
TRMA_SALAR      VLLTAK-------
TRMA_KLEP3      VLLTRK-------
TRMA_KLEP7      VLLTRK-------
TRMA_CROS8      VLLTRR-------
TRMA_ERWT9      VLLTRRH------
TRMA_PHOLL      VLLEKLN------
TRMA_PROMH      VLLEKR-------
TRMA_PECAS      VLLEKRQ------
TRMA_PECCP      VLLEKRQ------
TRMA_DICP7      VLLEKRT------
TRMA_DICC1      VLLEKRQ------
TRMA_EDWI9      VLLERR-------
TRMA_YERPE      VLLEKRH------
TRMA_YERPP      VLLEKRH------
TRMA_YERPY      VLLEKRH------
TRMA_YERPG      VLLEKRH------
TRMA_YERPA      VLLEKRH------
TRMA_YERPN      VLLEKRH------
TRMA_YERPS      VLLEKRH------
TRMA_YERPB      VLLEKRH------
TRMA_YERP3      VLLEKRH------
TRMA_YERE8      VLLEKRD------
TRMA_SERP5      VLLEKRV------
TRMA_SODGM      VLLVRKATAV---
TRMA_ACTP2      VWLIRK-------
TRMA_ACTP7      VWLIRK-------
TRMA_ACTPJ      VWLIRK-------
TRMA_HAEDU      VWLIRK-------
TRMA_HAEPS      VWLIRNNQVGEK-
TRMA_HAEIN      LWLIRK-------
TRMA_HAEI8      LWLIRK-------
TRMA_HAEIE      VWLIRK-------
TRMA_MANSM      VWLIRK-------
TRMA_HAES1      VWLIKKSN-----
TRMA_HISS2      VWLIKKSN-----
TRMA_PASMU      VWLIRK-------
TRMA_AGGAN      VWLVRKG------
TRMA_ACTSZ      VWLMRK-------
TRMA_TOLAT      VWLVRK-------
TRMA_AERHH      VYLKRKAG-----
TRMA_AERS4      VYLKRKAG-----
TRMA_ALIF1      VFLERK-------
TRMA_ALIFM      VFLERK-------
TRMA_ALISL      IFLERK-------
TRMA_PHOPR      VLLERK-------
TRMA_VIBCH      VMLERKK------
TRMA_VIBC3      VMLERKK------
TRMA_VIBCM      VMLERKK------
TRMA_VIBCB      VLLERKA------
TRMA_VIBPA      VLLERKA------
TRMA_VIBVU      VMLERKA------
TRMA_VIBVY      VMLERKA------
TRMA_VIBTL      VFLERKA------
TRMA_SHEB5      VLLERR-------
TRMA_SHEB9      VLLERR-------
TRMA_SHEB2      VLLERR-------
TRMA_SHEB8      VLLERR-------
TRMA_SHEPC      VLLERTQ------
TRMA_SHESW      VLLERR-------
TRMA_SHESA      VLLERR-------
TRMA_SHESR      VLLERR-------
TRMA_SHESM      VLLERR-------
TRMA_SHEON      VLLERIK------
TRMA_SHEDO      VLLERK-------
TRMA_SHEFN      VLLVRK-------
TRMA_SHEHH      VFLEKR-------
TRMA_SHEPA      VFLEKK-------
TRMA_SHEPW      VFLEKK-------
TRMA_SHESH      VFLERR-------
TRMA_SHEWM      VFLERK-------
TRMA_SHELP      VLLERR-------
TRMA_SHEAM      VMLKRR-------
TRMA_ALTMD      VLLTRKG------
TRMA_PSEA6      VYLQKR-------
TRMA_PSYIN      VYLVKR-------
TRMA_PSEHT      VFLQKKNT-----
TRMA_COLP3      VILTRK-------
TRMA_IDILO      VVLERKS------
TRMA_MARMS      VFLRRKAS-----
TRMA_HYDCU      VFLKRKPK-----
TRMA_CELJU      VLLQRR-------
TRMA_AROAE      LLLTRRGGPRAP-
TRMA_AZOSB      VLLQKTAA-----
TRMA_DECAR      LLLTRR-------
TRMA_PSEAE      VLLERR-------
TRMA_PSEA8      VLLERR-------
TRMA_PSEAB      VLLERR-------
TRMA_PSEA7      VLLERR-------
TRMA_AZOVD      VLLERR-------
TRMA_PSEMY      VLLERR-------
TRMA_PSEU5      VLLVRR-------
TRMA_PSEP1      VLLVRR-------
TRMA_PSEPK      VLLVRR-------
TRMA_PSEPG      VLLVRR-------
TRMA_PSEPW      VLLVRR-------
TRMA_PSEE4      VLLVRR-------
TRMA_PSEFL      VLLTRR-------
TRMA_PSEFS      VLLTRR-------
TRMA_PSEPF      VLLTRR-------
TRMA_PSEF5      VLLTRR-------
TRMA_PSE14      VLLVRR-------
TRMA_PSEU2      VLLVRR-------
TRMA_PSESM      VLLVRR-------
TRMA_CHRSD      VLLERRAPAARA-
TRMA_SACD2      VILTKK-------
TRMA_TERTT      VILRRR-------
TRMA_SULNB      VFLQKK-------
TRMA_NITSB      VYLTR--------
TRMA_SULDN      AKLVKK-------
TRMA_WOLSU      VILRQRR------
TRMA_HELHP      VILRKSNKIL---
TRMA_CAMC1      VLLEAKR------
TRMA_CAMC5      VVLKKR-------
TRMA_CAMFF      VVLKKY-------
TRMA_CAMHC      VVLQK--------
TRMA_CAMJE      VFLSKV-------
TRMA_CAMJ8      VFLSKV-------
TRMA_CAMJJ      VFLSKV-------
TRMA_CAMJR      VFLSKV-------
TRMA_CAMJD      VFLSKV-------
TRMA_CAMLR      VHLRLKA------
TRMA_ARCB4      VILRKLKD-----
TRMA_NAUPA      VILKKN-------
                  *