CLUSTAL format seed alignment for MF_01012

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RLMC_SHEB5      MSAAIVNAVKQCGYFNQGQCLSCRHIQQPLAQQVAVKTQTLQQLLAPFIPANSAELFLPP
RLMC_SHEB8      MSAAIVNAVKQCGYFNQGQCLSCRHIQQPLAQQVAVKTQTLQQLLAPFIPANSAELFLPP
RLMC_SHEB9      MSAAIVNAVKQCGYFNQGQCLSCRHIQQPLAQQVAVKTQTLLQLLAPFIPANSAELFLPP
RLMC_SHEB2      MSAAIVNAVKQCGYFNQGQCLSCRHIQQPLAQQVAVKTQTLLQLLAPFIPANSAELFLPP
RLMC_SHEPC      MSAVIVNTVEQCGYFNRGQCQSCRHIQVPMAQQLMAKSLELQQLLKPFV-APSAAIFYPP
RLMC_SHESW      MSAVIVNTVEQCGYFNRGQCQSCRHIQVPMAQQLMAKSLELQQLLKPFV-APSAAIFYPP
RLMC_SHESM      -----MSTLVQCGYFERGQCQSCRHIKLPMAQQLAAKTQELQQLLAPFV-DNAEPQFLPP
RLMC_SHESR      -----MSTLVQCGYFERGQCQSCRHIKLPMAQQLAAKTQELQQLLAPFV-DNAEAQFLPP
RLMC_SHESA      -----MSTLVQCGYFERGQCQSCRHIKLPMAQQLAAKNLELQQLLAPFV-DKTEPQFLPP
RLMC_SHEON      -----MSTLVQCGYFERGQCQSCRHIKLPMVQQLAAKTQELQQLLAPFV-VSTNTQFLPP
RLMC_SHEHH      ---------MKCAHFVQQQCLSCRHINQPMPVQVAAKSQVLSQLLSGFE----VEQWREP
RLMC_SHEPA      ---------MKCAHFDQQQCLSCRHIKQSMSVQVAAKSQVLSQLLSDFE----VEQWHEP
RLMC_SHELP      ---------MKCAYFDANQCLSCRHLKTPLSDQVAAKTATLAALLKDLS----VEQWLPP
RLMC_SHEFN      ---------MKCDYFERGDCLSCRNIQLPMVEQVSVKQQQLIDLFRGIS----VKQWLAP
RLMC_SHEAM      ---------MSCDYFNRGLCQSCRLMSKPVTEQLLEKEARLTHLLGGLP----VDERLAP
RLMC_VIBC3      ---------MQCEFFIQKRCTSCHQCAQPYSQQVENKDQQLRELIAPAM----DVQWLPP
RLMC_VIBCM      ---------MQCEFFIQKRCTSCHQCAQPYSQQVENKDQQLRELIAPAM----DVQWLPP
RLMC_VIBCH      ---------MQCEFFIQKRCTSCHLCAQPYSEQVTNKDQQLRELIAPAT----DVQWLPP
RLMC_VIBVU      ---------MSCPYFEQKSCTSCTHMNTPYSQQLETKDNALRSLFSDVE----QSAWLAP
RLMC_VIBVY      ---------MSCPYFEQKSCTSCTHMNTPYSQQLETKDNALRTLFSDVA----QSAWLAP
RLMC_HAEIN      --------MIDCRYYQQNECRSCQWLEIPCSQQLTEKQYHLKQQLISIN-YDE-AQWVAP
RLMC_HAEIG      --------MIDCRYYQQNECRSCQWLEIPYSQQLTEKQYHLKQQLISIN-CDE-AQWLAP
RLMC_HAEI8      --------MIDCRYYQQNECRSCQWLEIPYSQQLAEKQHHLKQQLISIN-CDK-AQWLAP
RLMC_HAEIE      --------MIDCQYYQQNECRSCQWLEIPYDQQIAEKQHHLKQQLISLD-CSD-VHWLAP
RLMC_MANSM      -------MTTKCPHFQTQQCQSCQWINRPYDEQLNEKQIHLKQQIAPLD-QSQ-LRWSAP
RLMC_ACTSZ      ---------MNCPHYQTQTCISCRWLETPYADQLTQKQTHLQQQISILD-QSR-LEWIPP
RLMC_PASMU      ---------MPCQHYQRGDCRSCQWLATPYSTQLAKKQQHLQQQLQKLD-CTQ-IQWQAP
RLMC_ACTP2      -------MILNCPHFQQQDCVSCQWLEKPYATQLTDKEIDLKRLISPFI-LQNFTEILPP
RLMC_ACTP7      -------MILNCPHFQQQDCVSCQWLEKPYATQLTDKEIDLKRLISPFI-LQNFTEILPP
RLMC_ACTPJ      -------MILNCPHFQQQDCVSCQWLEKPYATQLTDKEIDLKRLISPFI-LQNFTEILPP
RLMC_HAEPS      ------MPKLNCHHFEQNRCNSCQWLHKSYTEQLAEKTSDLKRLVSPYL-LQS-TEFLPA
RLMC_PECAS      ---------MHCARYSTGTCRSCQWLEKPYPQQLSDKQQHLEDLLQPHA-VQR---WLPV
RLMC_PECCP      ---------MHCARYSTGTCRSCQWLEKAYPQQLSDKQQHLEGLLQPHA-VQR---WLPV
RLMC_SERP5      ---------MHCALYTAGTCRSCQWLEKPYPQQLTDKQHHLQSLLSDRD-VAQ---WLEP
RLMC_YERPE      ---------MHCAQYTAGRCRSCQWLDKPYPQQLADKQHHLESLLAGHA-VTQ---WLAP
RLMC_YERPD      ---------MHCAQYTAGRCRSCQWLDKPYPQQLADKQHHLESLLAGHA-VTQ---WLAP
RLMC_YERPP      ---------MHCAQYTAGRCRSCQWLDKPYPQQLADKQHHLESLLAGHA-VTQ---WLAP
RLMC_YERPG      ---------MHCAQYTAGRCRSCQWLDKPYPQQLADKQHHLESLLAGHA-VTQ---WLAP
RLMC_YERPA      ---------MHCAQYTAGRCRSCQWLDKPYPQQLADKQHHLESLLAGHA-VTQ---WLAP
RLMC_YERPN      ---------MHCAQYTAGRCRSCQWLDKPYPQQLADKQHHLESLLAGHA-VTQ---WLAP
RLMC_YERPS      ---------MHCAQYTAGRCRSCQWLDKPYPQQLADKQHHLESLLAGHA-VTQ---WLAP
RLMC_YERPB      ---------MHCAQYTAGRCRSCQWLDKPYPQQLADKQHHLESLLAGHA-VTQ---WLAP
RLMC_YERP3      ---------MHCAQYAAGRCRSCQWLDKPYPQQLADKQHHLESLLAGHA-VTQ---WLAL
RLMC_YERPY      ---------MHCAQYAAGRCRSCQWLDKPYPQQLADKQHHLESLLAGHA-VTQ---WLAL
RLMC_YERE8      ---------MQCAQYTASRCRSCQWLDKPYPQQLADKQNHLENLLSDHR-VTQ---WLSP
RLMC_EDWI9      ---------MHCVQYQAGRCHSCQWLSIPYSRQLEDKQRHLSALLSGHS-VAQ---WLSA
RLMC_ECO27      ---------MQCALYDAGRCRSCQWITQPIPEQLSAKTADLKNLLADFP-VEE---WCAP
RLMC_ECO7I      ---------MQCALYDAGRCRSCQWITQPIPEQLSAKTADLKNLLADFP-VEE---WCAP
RLMC_ECOUT      ---------MQCALYDAGRCRSCQWITQPIPEQLSAKTVDLKNLLADFP-VEE---WCAP
RLMC_ECOL5      ---------MQCALYDAGRCRSCQWITQPIPEQLSAKTVDLKNLLADFP-VEE---WCAP
RLMC_ECOK1      ---------MQCALYDAGRCRSCQWITQPIPEQLSAKTVDLKNLLADFP-VEE---WCAP
RLMC_ECO45      ---------MQCALYDAGRCRSCQWITQPIPEQLSAKTVDLKNLLADFP-VEE---WCAP
RLMC_ECO81      ---------MQCALYDAGRCRSCQWITQPIPEQLSAKAADLKNLLADFP-VEE---WCAP
RLMC_ECOL6      ---------MQCALYDAGRCRSCQWITQPIPEQLSAKTADLKNLLADFP-VEE---WCAP
RLMC_SHIFL      ---------MQCALYDAGRCRSCQWITQPIPEQLSAKTADLKNLLADFP-VEE---WCAP
RLMC_SHIF8      ---------MQCALYDAGRCRSCQWITQPIPEQLSAKTADLKNLLADFP-VEE---WCAP
RLMC_SHIDS      ---------MQCALYDAGRCRSCQWITQPIPEQLSAKTADLKNLLADFP-VEE---WCAP
RLMC_ECOSM      ---------MQCALYDAGRCRSCQWITQPIPEQLSAKTADLKNLLADFP-VEE---WCAP
RLMC_ECO55      ---------MQCALYDAGRCRSCQWITQPIPEQLSAKTADLKNLLADFP-VEE---WCAP
RLMC_ECO8A      ---------MQCALYDAGRCRSCQWITQPIPEQLSAKTADLKNLLADFP-VEE---WCAP
RLMC_ECO24      ---------MQCALYDAGRCRSCQWITQPIPEQLSAKTADLKNLLADFP-VEE---WCAP
RLMC_ECOBW      ---------MQCALYDAGRCRSCQWIMQPIPEQLSAKTADLKNLLADFP-VEE---WCAP
RLMC_ECODH      ---------MQCALYDAGRCRSCQWIMQPIPEQLSAKTADLKNLLADFP-VEE---WCAP
RLMC_ECOLI      ---------MQCALYDAGRCRSCQWIMQPIPEQLSAKTADLKNLLADFP-VEE---WCAP
RLMC_SHISS      ---------MQCALYDAGRCRSCQWITQPIPEQLSAKTADLKNLLADFP-VEE---WCAP
RLMC_ECOLC      ---------MQCALYDAGRCRSCQWITQPIPEQLSAKTADLKNLLADFP-VEE---WCAP
RLMC_ECOHS      ---------MQCALYDAGRCRSCQWITQPIPEQLSAKTADLKNLLADFP-VEE---WCAP
RLMC_ECOSE      ---------MQCALYDAGRCRSCQWITQPIPEQLSAKTADLKNLLADFP-VEE---WCAP
RLMC_SHIB3      ---------MQCALYDAGRCRSCQWITQLIPEQLSAKTADLKNLLADFP-VEE---WCAP
RLMC_SHIBS      ---------MQCALYDAGRCRSCQWITQPIPEQLSAKTADLKNLLADFP-VEE---WCAP
RLMC_ECO57      ---------MQCALYDAGRCRSCQWITQPIPEQLSAKTADLKNLLADFP-VEE---WCAP
RLMC_ECO5E      ---------MQCALYDAGRCRSCQWITQPIPEQLSAKTADLKNLLADFP-VEE---WCAP
RLMC_ECOLU      ---------MQCALYDAGRCRSCQWITQPIPEQLSAKTADLKNLLADFP-VEE---WCAP
RLMC_ESCF3      ---------MQCALYDAGRCRSCQWITQLIPEQLSAKTADLKNLLADFS-VEE---WCES
RLMC_CITK8      ---------MQCALYDAGRCRSCQWIVQPIRDQLSAKTADLKGLLADFS-VEQ---WCAP
RLMC_SALAR      ---------MQCALYDAGRCRSCQWITQSVNEQLSAKTADLHRLLAGLP-VEQ---WRTP
RLMC_SALDC      ---------MQCALYDAGRCRSCQWITQSVNEQLSAKTADLHRLLAGLP-VEQ---WCSP
RLMC_SALSV      ---------MQCALYDAGRCRSCQWITQSVNEQLSAKTADLHRLLTGLP-VEQ---WCAS
RLMC_SALCH      ---------MQCALYDAGRCRSCQWITQSVNEQLSAKTADLHRLLAGLP-VEQ---WCAP
RLMC_SALPB      ---------MQCALYDAGRCRSCQWITQSVNEQLSAKTADLHRLLAGLP-VEQ---WCAP
RLMC_SALPC      ---------MQCALYDAGRCRSCQWITQSVNEQLSAKTADLHRLLAGLP-VEQ---WCAP
RLMC_SALTY      ---------MQCALYDAGRCRSCQWITQSVNEQLSAKTADLHRLLAGLP-VEQ---WCAP
RLMC_SALEP      ---------MQCALYDAGRCRSCQWITQSVNEQLSAKTADLHRLLAGLP-VEQ---WCAP
RLMC_SALPA      ---------MQCALYDAGRCRSCQWITQSVNEQLSAKTADLHRLLAGLP-VEQ---WCAP
RLMC_SALPK      ---------MQCALYDAGRCRSCQWITQSVNEQLSAKTADLHRLLAGLP-VEQ---WCAP
RLMC_SALA4      ---------MQCALYDAGRCRSCQWITQSVNEQLSAKTADLHRLLAGLP-VEQ---WCAP
RLMC_SALNS      ---------MQCALYDAGRCRSCQWITQSVNEQLSAKTADLHRLLAGLP-VEQ---WCAP
RLMC_SALTI      ---------MQCALYDAGRCRSCQWITQSVNEQLSAKTADLHRLLAGLP-VEQ---WCAP
RLMC_ENT38      ---------MQCALFDAGRCRSCQWIEQPVSQQLSAKMTDLQQLLAAHP-VAE---WCAP
RLMC_CROS8      ---------MHCALYDAGRCRSCQWIEQPPDTQLAAKMTDLRTLLAALP-VGE---WGAP
RLMC_XENBS      ---------MQCAQYTAGHCHSCQWLNKSYSQQLSDKQQHLQQLLRETS-ATY---WLPP
RLMC_XENNA      ---------MQCVQYTAGHCHSCQWLDKSYSHQLSDKQKHLKQLLQETS-VTH---WLSP
RLMC_PHOLL      ---------MQCAHYSAGHCHSCQWLEKPYSQQLEDKQQNLKQLLPQAI-VKQ---WLPP
RLMC_PROMH      ---------MQCARSSAGDCHSCGWLSLAYSEQINQKQHNLLDLLPKNY-AFT---QLAP
RLMC_HALNC      ---------MHCAYFERGTCRSCGWLADPYADQLQRKMARCQSALTGLG-----GVWLPI
                           *       * **         *:  *       .               

RLMC_SHEB5      ITGDDSGFRNKAKMVVLGAAHEPVLGIVGPS---GEAVDLCDCLLYPADMQALLHRLTRF
RLMC_SHEB8      ITGDDSGFRNKAKMVVLGAAHEPVLGIVSPS---GEAVDLCDCLLYPGDMQALLHRLTRF
RLMC_SHEB9      ITGDDSGFRNKAKMVVLGAAHEPVLGIVSPS---GEAVDLCDCLLYPADMQALLHRLTRF
RLMC_SHEB2      ITGDDSGFRNKAKMVVLGAAHEPVLGIVSPS---GEAVDLCDCLLYPADMQALLHRLTRF
RLMC_SHEPC      VTGEATAFRNKAKMVVLGAAHAPVLGIVSPS---GEAVSLCDCLLYPSDMQKLLHRLTQF
RLMC_SHESW      VTGEATAFRNKAKMVVLGAAHAPVLGIVSPS---GEAVSLCDCLLYPSDMQKLLHRLTQF
RLMC_SHESM      VVGDSSGFRNKAKMVALGAAHAPVLGIVSPS---GEAVSLCDCLLYPADMQALLHRLERF
RLMC_SHESR      VVGDSSGFRNKAKMVVLGAAHAPVLGIVSPS---GEAVSLCDCLLYPADMQALLHRLERF
RLMC_SHESA      VVGDSSGFRNKAKMVALGAAHAPVLGIVSPS---GEAVSLCDCLLYPTDMQALLHRLERF
RLMC_SHEON      VVGEDSGFRNKAKMVVLGAAHAPVLGIVSPN---GEAVSLCDCLLYPADMQALLYRLERF
RLMC_SHEHH      VFGPESGFRNKAKMVVLGAAHQPILGIVTPT---GEPVSLCDCNLYPIDMQQLLHRLELF
RLMC_SHEPA      VFGPDSGFRNKAKMVVLGAAHQPILGIVTPT---GEPVSLCDCNLYPEDMQLLLHRLEQF
RLMC_SHELP      VVGPESGFRNKAKMVVLGAAHQPILGLVSPS---GEAVSLCDCSLYPQDMQQLLHRLEAF
RLMC_SHEFN      ILSAESGFRNKAKMVVLGAAHKPILGLVNPK---GEPVSLCDCSLYPKDMQLLLHRLERF
RLMC_SHEAM      VSGPEFGFRNKAKMVVMGAAHAPVLGIPGPD---GQPVDLSHCPLYPQDMQALLLELTSF
RLMC_VIBC3      VTSADTAFRNKAKMVVLGAAHAPILGIEDAQ---GQPLSLVTCPLYPQPMQELLAYLENW
RLMC_VIBCM      VTSADTAFRNKAKMVVLGAAHAPILGIEDAQ---GQPLSLVTCPLYPQPMQELLAYLENW
RLMC_VIBCH      VTSADTAFRNKAKMVVLGAAHAPILGIEDAQ---GQPLSLVTCPLYPQPMQELLAYLENW
RLMC_VIBVU      VQSDSMHCRNKAKMVALGAAHQPTLGIESVQD--GTPISLVHCPLYTQESQELLAYLQEW
RLMC_VIBVY      VQSDSMHCRNKAKMVALGAAHQPTLGIESVQD--GTPISLVHCPLYTQDSQALLAYLQEW
RLMC_HAEIN      FQSNQQGFRNKAKMVVSGSVERPILGILKNPNDPQSAIDLCDCPLYPTHFSAIFSILKDF
RLMC_HAEIG      FQSNEQGFRNKAKMVVSGSVERPILGILKNPNDPQNAIDLCDCPLYPTHFSAIFSILKDF
RLMC_HAEI8      FQSNEQCFRNKAKMLVSGSVERPILGILKNPNDPQSAIDLCDCPLYPARFSIIFSILKDF
RLMC_HAEIE      FKSNEQGFRNKAKMLVSGSVERPILGILKNPNDPQSAIDLCDCPLYPAHFSIIFSILKDF
RLMC_MANSM      FQSRQSGFRNKAKMVVSGAVERPVLGILKDQNAPQSAVDLTDCLLYSAGFKPIFPVLKDF
RLMC_ACTSZ      FQSAQSGFRNKAKMVVNGTVERPILGIINERNQP---ADLTDCPLYPARFAEIFSVLKDF
RLMC_PASMU      YTSILQGFRNKAKMAVSGMVERPIL------SHPQSEADLTDCPLYPAHFTNIFTILRDF
RLMC_ACTP2      VQSSQKQFRNKAKMVVSGSVERPILGILKDQTDPQSGIDLCDCPLYPTEFEALFPILKDF
RLMC_ACTP7      VQSSQKQFRNKAKMVVSGSVERPILGILKDQTDPQSGIDLCDCPLYPTEFEALFPILKDF
RLMC_ACTPJ      VQSSQKQFRNKAKMVVSGSVERPILGILKDQIDPQSGIDLCDCPLYPTEFEAIFPILKDF
RLMC_HAEPS      VTSPLAHFRNKAKMVVTGSVERPILGILNDDG---TGTDLTDCPLYPQAFTPLFPILKTF
RLMC_PECAS      QPSAQTAFRNKAKMVVSGSVERPLLGMLHRDGTA---VDLCDCPLYPTSFAPVFDVLKVF
RLMC_PECCP      QPSAQSAFRNKAKMVVSGSVERPLLGMLHRDGTA---VDLCDCPLYPSSFASVFDVLKVF
RLMC_SERP5      IAGEQSAFRNKAKMVVSGSVERPLLGMLHRDGTA---VDLSACPLYPASFSPMFDVLKSF
RLMC_YERPE      VFGRESAFRNKAKMVVSGSVERPLLGMLHRDGTP---VDLCACPLYPPSFEPVFTVLKTF
RLMC_YERPD      VFGRESAFRNKAKMVVSGSVERPLLGMLHRDGTP---VDLCACPLYPPSFEPVFTVLKTF
RLMC_YERPP      VFGRESAFRNKAKMVVSGSVERPLLGMLHRDGTP---VDLCACPLYPPSFEPVFTVLKTF
RLMC_YERPG      VFGRESAFRNKAKMVVSGSVERPLLGMLHRDGTP---VDLCACPLYPPSFEPVFTVLKTF
RLMC_YERPA      VFGRESAFRNKAKMVVSGSVERPLLGMLHRDGTP---VDLCACPLYPPSFEPVFTVLKTF
RLMC_YERPN      VFGRESAFRNKAKMVVSGSVERPLLGMLHRDGTP---VDLCACPLYPPSFEPVFTVLKTF
RLMC_YERPS      VFGRESTFRNKAKMVVSGSVERPLLGMLHRDGTP---VDLCACPLYPPSFEPVFTVLKTF
RLMC_YERPB      VFGRESTFRNKAKMVVSGSVERPLLGMLHRDGTP---VDLCACPLYPPSFEPVFTVLKTF
RLMC_YERP3      VFGRESAFRNKAKMVVSGSVERPLLGMLHRDGTP---VDLCACPLYPPSFEPVFTVLKTF
RLMC_YERPY      VFGRESAFRNKAKMVVSGSVERPLLGMLHRDGTP---VDLCACPLYPPSFEPVFTVLKTF
RLMC_YERE8      LFGQESAFRNKAKMVVSGSVERPLLGMLHRDGTP---VDLCECPLYPTSFAPVFAVLKTF
RLMC_EDWI9      QPSAELAMRNKAKMVVSGSVERPLLGMLQRDGSG---VDLCDCPLYPDSFAVVFAALKSF
RLMC_ECO27      VSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDGTP---EDLCDCPLYPASFAPVFAALKPF
RLMC_ECO7I      VSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDGTP---EDLCDCPLYPASFAPVFAALKPF
RLMC_ECOUT      VSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDGTP---EDLCDCPLYPASFAPVFAALKPF
RLMC_ECOL5      VSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDGTP---EDLCDCPLYPASFAPVFAALKPF
RLMC_ECOK1      VSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDGTP---EDLCDCPLYPASFAPVFAALKPF
RLMC_ECO45      VSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDGTP---EDLCDCPLYPASFAPVFAALKPF
RLMC_ECO81      VSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDGTP---EDLCDCPLYPASFAPVFAALKPF
RLMC_ECOL6      VSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDGTP---EDLCDCPLYPASFAPVFAALKPF
RLMC_SHIFL      VSGPEQGFRNKAKMVVSGSVEKTLLGMLHRDGTP---EDLCDCPLYPASFAPVFAALKPF
RLMC_SHIF8      VSGPEQGFRNKAKMVVSGSVEKTLLGMLHRDGTP---EDLCDCPLYPASFAPVFAALKPF
RLMC_SHIDS      VSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDGTP---EDLCDCPLYPASFAPVFAALKPF
RLMC_ECOSM      VSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDGTP---EDLCDCPLYPASFAPVFAALKPF
RLMC_ECO55      VSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDGTP---EDLCDCPLYPASFAPVFAALKPF
RLMC_ECO8A      VSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDGTP---EDLCDCPLYPASFAPVFAALKPF
RLMC_ECO24      VSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDGTP---EDLCDCPLYPASFAPVFAALKPF
RLMC_ECOBW      VSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDGTP---EDLCDCPLYPASFAPVFAALKPF
RLMC_ECODH      VSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDGTP---EDLCDCPLYPASFAPVFAALKPF
RLMC_ECOLI      VSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDGTP---EDLCDCPLYPASFAPVFAALKPF
RLMC_SHISS      VSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDGTP---EDLCDCPLYPASFAPVFAALKPF
RLMC_ECOLC      VSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDGTP---EDLCDCPLYPASFAPVFAALKPF
RLMC_ECOHS      VSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDGTP---EDLCDCPLYPASFAPVFAALKPF
RLMC_ECOSE      VSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDGTP---EDLCDCPLYPASFAPVFAALKPF
RLMC_SHIB3      VSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDGTP---EDLCDCPLYPASFAPVFAALKPF
RLMC_SHIBS      VSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDGTP---EDLCDCPLYPASFAPVFAALKPF
RLMC_ECO57      VSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDGTP---EDLCDCPLYPASFAPVFAALKPF
RLMC_ECO5E      VSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDGTP---EDLCDCPLYPASFAPVFAALKPF
RLMC_ECOLU      VSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDGTP---EDLCDCPLYPASFAPVFAALKPF
RLMC_ESCF3      VSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDGTP---EDLCDCPLYPSSFAPVFAALKPF
RLMC_CITK8      VSGPEQAFRNKAKMVVSGSVEKPLLGMLHRDGTP---EDLSDCPLYPDTFAPVFATLKPF
RLMC_SALAR      IGGPEQHFRNKAKMVVSGSVEKPLFGMLHRDGTP---VDLCGCPLYPASFAPVFSALKPF
RLMC_SALDC      IGGPEQHFRNKAKMVVSGSVEKPLFGMLHRDGTP---VDLCGCPLYPASFAPVFSALKPF
RLMC_SALSV      IGGPEQHFRNKAKMVVSGSVEKPLFGMLHRDGTP---VDLCGCPLYPASFAPVFSALKPF
RLMC_SALCH      IGGPEQHFRNKAKMVVSGSVEKPLFGMLHRDGTP---VDLCGCPLYPASFAPVFSALKPF
RLMC_SALPB      IGGPEQHFRNKAKMVVSGSVEKPLFGMLHRDGTP---VDLCGCPLYPASFAPVFSALKPF
RLMC_SALPC      IGGPEQHFRNKAKMVVSGSVEKPLFGMLHRDGTP---VDLCGCPLYPASFAPVFSALKPF
RLMC_SALTY      IGGPEQHFRNKAKMVVSGSVEKPLFGMLHRDGTP---VDLCGCPLYPASFDPVFSALKPF
RLMC_SALEP      IGGPEQHFRNKAKMVVSGSVEKPLFGMLHRDGTP---VDLCGCPLYPASFAPVFSALKPF
RLMC_SALPA      TGGPEQHFRNKAKMVVSGSVEKPLFGMLHRDGTP---VDLCGCPLYPASFAPVFSALKPF
RLMC_SALPK      TGGPEQHFRNKAKMVVSGSVEKPLFGMLHRDGTP---VDLCGCPLYPASFAPVFSALKPF
RLMC_SALA4      TGGPEQRFRNKAKMVVSGSVEKPLFGMLHRDGTP---VDLCGCPLYPASFAPVFSALKPF
RLMC_SALNS      ISGPEQHFRNKAKMVVSGSVEKPLFGMLHRDGTP---VDLCACPLYPASFAPVFSTLKPF
RLMC_SALTI      ISGPEQHFRNKAKMVVSGSVEKPLFGMLHRDGTP---VDLCACPLYPASFAPVFSALKPF
RLMC_ENT38      VSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDGTP---EDLTDCPLYPASFEPVFAALKPF
RLMC_CROS8      VSGPELAFRNKAKMVVSGSVEKPLLGMLHRDGTP---VDLTECPLYPASFYAVFAALKPF
RLMC_XENBS      VSSLISGFRNKAKMVVSGSVERPQLGMLHRDGRT---VDLCDCPLYPQYFQLVFESIKIF
RLMC_XENNA      VMSKTSGFRNKAKMVVNGSVERPLLGMLHRDGRT---VDLCDCPLYPQHFQAVFEVIKVF
RLMC_PHOLL      IASQQDAFRNKAKMVVSGSVERPLLGMLHRDGTA---VDLCHCPLYPAHFQPVFDVVKSF
RLMC_PROMH      VESQQVKFRNKAKMVVSGSVEKPILGLRKPEGEG---VDLCQCPLYPASFEPVFPILKTF
RLMC_HALNC      VPSAETAFRNKAKMVVCGDASSPCLGILDADDDG---IDLSNCPLYPTAITEAFEPLKQM
                  .     ****** . * .  . :             .*  * **.      :  :   

RLMC_SHEB5      VQQAGLPPYRVDKAKGELKFILLTRSQVRGEYLLRFVLRSHNGIERIERELPALLAEYPQ
RLMC_SHEB8      VQQAGLPPYRVDKAKGELKFILLTRSQVRGEYLLRFVLRSHNGIERIERELPALLAEYPQ
RLMC_SHEB9      VQQAGLPPYRVDKAKGELKFILLTRSQVRGEYLLRFVLRSHNGIERIERELPALLAEYPQ
RLMC_SHEB2      VQQAGLPPYRVDKAKGELKFILLTRSQVRGEYLLRFVLRSHNGIERIERELPALLAEYPQ
RLMC_SHEPC      VQQAGIPPYRVDKAKGELKFILLTRSQVRGEYLLRFVLRSHNSIERIERALPTLLAEYPQ
RLMC_SHESW      VQQAGIPPYRVDKAKGELKFILLTRSQVRGEYLLRFVLRSHNSIERIERALPTLLAEYPQ
RLMC_SHESM      VQQAGIPPYRVDKAKGELKFILLTRSQVRGEYMLRFVLRSRDAIARIERELPALMAEYPQ
RLMC_SHESR      VQQAGIPPYRVDKAKGELKFILLTRSQVRGEYMLRFVLRSRDAIARIERELPALMAEYPQ
RLMC_SHESA      VQQAGIPPYRVDKAKGELKFILLTRSQVRGEYMLRFVLRSRDAIARIERELPTLMAEYPQ
RLMC_SHEON      VQQAGIPPYRIDKAKGELKYILLTRSQVRGEYMLRFVLRSPDAIARIERELPALMAEYPQ
RLMC_SHEHH      VRQAGIPPYNVDKVKGELKFILLTRSQIKGEYLLRFVLRSHKSIERIERELPQLLSEYPQ
RLMC_SHEPA      VRQAGIPPYNVDKAKGELKFILLTRSQIKGEYLLRFVLKSHKSIERIERELPKLLSEYPQ
RLMC_SHELP      VRQAGIPPYRVDKAKGELKFILLTRSQVRGEYMLRFVMRSEQAIPRIERELPRLLAEHPE
RLMC_SHEFN      VQQAGIPPYRVDKSKGELKFILLTRSQSSGQFMLRFVLRSDQAIVRIERELPQLLQEFPE
RLMC_SHEAM      VRRAGIPPYRVDKAKGELKFILLTRSAVRGEFMLRFVLRSKDAIPRIERELPKLLADFPA
RLMC_VIBC3      IRIAGIPPYNKLKKKGELKFILLTRSENSGQFMLRFVARSHAVLERIERNLPTLIAAFPT
RLMC_VIBCM      IRIAGIPPYNKLKKKGELKFILLTRSENSGQFMLRFVARSHAVLERIERNLPTLIAAFPT
RLMC_VIBCH      IRIAGIPPYNKLKKKGELKFILLTRSENSGQFMLRFVARSHAVLERIERNLPTLIAAFPM
RLMC_VIBVU      IRTSGIPPYNKVKKKGELKFVLLTRSQARGEFMLRFVVRSEAALERIRHNLPRLQQAFPA
RLMC_VIBVY      IRTSGIPPYNKVKKKGELKFVLLTRSQARGEFMLRFVVRSEAALERIRHNLPRLQQAFPA
RLMC_HAEIN      IGRAGLVPYNIAKQKGELKYILLTESIATEKLMLRFVLRTENKLPLIRRELPKLLEKLPH
RLMC_HAEIG      IGRAGLVPYNIAKQKGELKYILLTESIATEKLMLRFVLRTENKLPLIRRELPKLLEKLPH
RLMC_HAEI8      IGRAGLVPYNIAKQKGELKYILLTESIATGKLMLRFVLRTENKLPLIRRELPKLLEKLPH
RLMC_HAEIE      IGRAGLVPYNIAKQKGELKYILLTESIATGKLMLRFVLRTENKLPLIRRELPKLLEKLPH
RLMC_MANSM      IGRAGLVPYNVAKQKGELKYILLTESGYQGDIMLRFVLRSENKIPLIRRELAKLREKLPQ
RLMC_ACTSZ      IGRAGLVPYNIAKQKGELKYILLTESRANQTLMLRFVLRSETKLPLMRRELAGLSTKIPD
RLMC_PASMU      IARAGLVPYNIQKQKGELKYILLTESQLDGGLMLRFVLRSEKKLPLVQRELPGLLAKLPQ
RLMC_ACTP2      IARAGLVPYNISKKKGELKYILITQSRYNQSIMLRFVLKSEQKRPLVERELPNLLAKLPK
RLMC_ACTP7      IARAGLVPYNIAKKKGELKYILLTQSRYNQSIMLRFVLKSEQKRPLVERELPNLLAKLPK
RLMC_ACTPJ      IARAGLVPYNIAKKKGELKYILLTQSRYNQSVMLRFVLRSEQKRPLVERELPNLLAKLPK
RLMC_HAEPS      IGRAGLVPYNVAKKRGELKYILITQSQHNQSLMIRFVLRSELKRPLVERELPMLLAQLPE
RLMC_PECAS      IARAGLTPYNVARRRGELKYLLLTESTQRGTFMLRFVLRSETKLAQLRAAMPWLQQQLPQ
RLMC_PECCP      IARAGLTPYNVARRRGELKYLLLTESTQRGTFMLRFVLRSETKLAQLRAALPWLQQQLPQ
RLMC_SERP5      IARAGLTPYNVARKRGELKYLLLTESTHSGGVMLRFVLRSDNKLAQLRAALPWLQQQLPQ
RLMC_YERPE      IARAGLTPYNVARKRGELKFLLLTESTYNGELMLRFVLRSETKLAQLIAALPWLQQQLPQ
RLMC_YERPD      IARAGLTPYNVARKRGELKFLLLTESTYNGELMLRFVLRSETKLAQLIAALPWLQQQLPQ
RLMC_YERPP      IARAGLTPYNVARKRGELKFLLLTESTYNGELMLRFVLRSETKLAQLIAALPWLQQQLPQ
RLMC_YERPG      IARAGLTPYNVARKRGELKFLLLTESTYNGELMLRFVLRSETKLAQLIAALPWLQQQLPQ
RLMC_YERPA      IARAGLTPYNVARKRGELKFLLLTESTYNGELMLRFVLRSETKLAQLIAALPWLQQQLPQ
RLMC_YERPN      IARAGLTPYNVARKRGELKFLLLTESTYNGELMLRFVLRSETKLAQLIAALPWLQQQLPQ
RLMC_YERPS      IARAGLTPYNVARKRGELKFLLLTESTYNGELMLRFVLRSETKLAQLIAALPWLQQQLPQ
RLMC_YERPB      IARAGLTPYNVARKRGELKFLLLTESTYNGELMLRFVLRSETKLAQLIAALPWLQQQLPQ
RLMC_YERP3      IARAGLTPYNVARKRGELKFLLLTESTYNGELMLRFVLRSETKLAQLTAALPWLQQQLPQ
RLMC_YERPY      IARAGLTPYNVARKRGELKFLLLTESTYNGELMLRFVLRSETKLAQLTAALPWLQQQLPQ
RLMC_YERE8      IARAGLTPYNVARKRGELKFLLLTESTYSGELMLRFVLRSQTKLSQLQAALPWLQQQLPQ
RLMC_EDWI9      IPRAGLTPYSVARRRGELKYLLLTESRLNGEMMLRFVLRSETKLAQLRQALPWLQAQLPQ
RLMC_ECO27      IARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSDTKLAQLRKALPWLQEQLPQ
RLMC_ECO7I      IARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSDTKLAQLRKALPWLQEQLPQ
RLMC_ECOUT      IARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSDTKLAQLRKALPWLQEQLPQ
RLMC_ECOL5      IARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSDTKLAQLRKALPWLQEQLPQ
RLMC_ECOK1      IARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSDTKLAQLRKALPWLQEQLPQ
RLMC_ECO45      IARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSDTKLAQLRKALPWLQEQLPQ
RLMC_ECO81      IARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSDTKLAQLRKALPWLQEQLPQ
RLMC_ECOL6      IARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSDTKLAQLRKALPWLQEQLPQ
RLMC_SHIFL      IARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSDTKLAQLRKALPWLHEQLPQ
RLMC_SHIF8      IARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSDTKLAQLRKALPWLHEQLPQ
RLMC_SHIDS      IARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSDTKLAQLRKALPWLHEQLPQ
RLMC_ECOSM      IARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSDTKLAQLRKALPWLQEQLPQ
RLMC_ECO55      IARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSETKLAQLRKALPWLQEQLPQ
RLMC_ECO8A      IARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSETKLAQLRKALPWLQEQLPQ
RLMC_ECO24      IARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSETKLAQLRKALPWLQEQLPQ
RLMC_ECOBW      IARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSDTKLAQLRKALPWLHEQLPQ
RLMC_ECODH      IARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSDTKLAQLRKALPWLHEQLPQ
RLMC_ECOLI      IARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSDTKLAQLRKALPWLHEQLPQ
RLMC_SHISS      IARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSETKLAQLRKALPWLQEQLPQ
RLMC_ECOLC      IARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSETKLAQLRKALPWLQEQLPQ
RLMC_ECOHS      IARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSETKLAQLRKALPWLQEQLPQ
RLMC_ECOSE      IARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSETKLAQLRKALPWLQEQLPQ
RLMC_SHIB3      IACAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSETKLAQLRKALPWLQEQLPQ
RLMC_SHIBS      IARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSETKLAQLRKALPWLQEQLPQ
RLMC_ECO57      IARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSETKLAQLRKALPWLQAQLPQ
RLMC_ECO5E      IARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSETKLAQLRKALPWLQAQLPQ
RLMC_ECOLU      IARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSETKLAQLRKALPWLQEQLPQ
RLMC_ESCF3      IARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSETKLAQLRKALPWLQEQLPQ
RLMC_CITK8      IARAGLTPYNVARKRGELKYILLTESQFDGGMMLRFVLRSETKLAQLRAALPWLQAQLPQ
RLMC_SALAR      IARAGLTPYNVARKRGELKYLLLTESQFDGGMMLRFVLRSETKLTQLRAALPWLRAQLPQ
RLMC_SALDC      IARAGLTPYNVARKRGELKYLLLTESQFDGGMMLRFVLRSETKLTQLRAALPWLRAQLPQ
RLMC_SALSV      IARAGLTPYNVARKRGELKYLLLTESQFDGGMMLRFVLRSETKLTQLRAALPWLRAQLPQ
RLMC_SALCH      IARAGLTPYNVARKRGELKYLLLTESQFDGGMMLRFVLRSETKLTQLRAALPWLRAQLPQ
RLMC_SALPB      IARAGLTPYNVARKRGELKYLLLTESQFDGGMMLRFVLRSETKLTQLRAALPWLRAQLPQ
RLMC_SALPC      IARAGLTPYNVARKRGELKYLLLTESQFDGGMMLRFVLRSETKLTQLRAALPWLRAQLPQ
RLMC_SALTY      IARAGLTPYNVARKRGELKYLLLTESQFDGGMMLRFVLRSETKLTQLRAALPWLRAQLPQ
RLMC_SALEP      IARAGLTPYNVARKRGELKYLLLTESQFDGGMMLRFVLRSETKLTQLRAALPWLRAQLPQ
RLMC_SALPA      IARAGLTPYNVARKRGELKYLLLTESQFDGGMMLRFVLRSETKLTQLRAALPWLRAQLPQ
RLMC_SALPK      IARAGLTPYNVARKRGELKYLLLTESQFDGGMMLRFVLRSETKLTQLRAALPWLRAQLPQ
RLMC_SALA4      IARAGLTPYNVARKRGELKYLLLTESQFDGGMMLRFVLRSETKLTQLRAALPWLRAQLPQ
RLMC_SALNS      IARAGLTPYNVARKRGELKYLLLTESQFDGGMMLRFVLRSETKLTQLRAALPWLRAQLPQ
RLMC_SALTI      IARAGLTPYNVARKRGELKYLLLTESQFDGGMMLRFVLRSETKLTQLRAALPWLRAQLPQ
RLMC_ENT38      IARAGLTPYNVERKRGELKYLLLTESQLDGGMMLRFILRSEAKLEQLRAALPWLQQQLPQ
RLMC_CROS8      IARAGLTPYNVARKRGELKYLLLTQSTLDGGLMLRFVLRSKEKLEQLRAALPGLLAELPQ
RLMC_XENBS      IAKAGLVPYNVARKKGELKYILLTESRASGEMMLRFVLRSETKLAQLEHALPWLQEQLPQ
RLMC_XENNA      IAKAGLVPYNVERRKGELKYILLTESRANNEMMLRFVLRSETKLAQLERVLPWLQEQLPQ
RLMC_PHOLL      IACAGLTPYNVARKRGELKYLLLTESRHSGEMMLRFVLRSETKIAQLERALPRLHEQLPQ
RLMC_PROMH      IAKAGLVPYNVERRRGELKFILLTESRHNHSMMLRFVLRSEKKLAQLRQALPWLQAQLPQ
RLMC_HALNC      IRRLGIPPYDVKKRQGELKYLLITVSEDDDSLMVRLVLRSDIWIERLRADLSTLTADLPH
                :   *: **   : :****::*:* *      ::*:: ::      :   :. *    * 

RLMC_SHEB5      IKVVSVNIQPIHMAILEGDEEIFLTENTRLEERFNHVPLFIRPKSFFQTNPQVAAQLYQT
RLMC_SHEB8      IKVVSVNIQPIHMAILEGDEEIFLTENTRLEERFNHVPLFIRPKSFFQTNPQVAAQLYQT
RLMC_SHEB9      IKVVSVNIQPVHMAILEGDEEIFLTENTRLEERFNHVPLFIRPKSFFQTNPQVAAQLYQT
RLMC_SHEB2      IKVVSVNIQPVHMAILEGDEEIFLTENTRLEERFNHVPLFIRPKSFFQTNPQVAAQLYQT
RLMC_SHEPC      INVVSVNIQPIHMAILEGGEEIFLTENTRLEERFNDVPLFIRPKSFFQTNPQVAAQLYQT
RLMC_SHESW      INVVSVNIQPIHMAILEGDEEIFLTENTRLEERFNDVPLFIRPKSFFQTNPQVAAQLYQT
RLMC_SHESM      IKVVSVNLQPVHMAILEGEEEIFLTENTRLEERFNDVPLFIRPKSFFQTNPQVAAKLYQT
RLMC_SHESR      IKVVSVNLQPIHMAILEGEEEIFLTENTRLEERFNDVPLFIRPKSFFQTNPQVAAKLYQT
RLMC_SHESA      IKVVSVNLQPVHMAILEGEEEIFLTENTRLEERFNDVPLFIRPKSFFQTNPQVAAKLYQT
RLMC_SHEON      INVVSVNIQPIHMAILEGDEEIFLTENTRLEERFNDVPLFIRPKSFFQTNPHVAAKLYQT
RLMC_SHEHH      IKVVSVNIQPVHMAILEGEEELFLTEETRLSEQFNDVPLFIRPKSFFQTHPEIAAKLYQT
RLMC_SHEPA      IKVVSVNIQPVHMAILEGEEEIFLTEETRLSEQFNDVPLFIRPKSFFQTHPQIAAKLYQT
RLMC_SHELP      IKVVSVNLQPVHMAILEGEEEIFLTEATRLEEEFNGVPLYIRPKSFFQTHPEVAAKLYLS
RLMC_SHEFN      ITLVSANIQPIHMAILEGEREIFLTETTRLEEQLNNVPLFIRPKSFFQTNPEVAAQLYQI
RLMC_SHEAM      IKVVSVNLQPVHMARLEGEEEIFLTQATRLDEVFNGVPLFIRPKSFFQTNPEVASRLYAT
RLMC_VIBC3      IEVVSVNIQPVHMARLEGEEEIFLTETQSLLEQFNDVPMVIRPKSFFQTNPQVAEQLYAT
RLMC_VIBCM      IEVVSVNIQPVHMARLEGEEEIFLTETQSLLEQFNDVPMVIRPKSFFQTNPQVAEQLYAT
RLMC_VIBCH      IEVISVNIQPVHMARLEGEEEIFLTETQSLLEHFNDVPMVIRPKSFFQTNPKVAEQLYAT
RLMC_VIBVU      VRVISANIQPIHMARLEGEQEIFLTDAHYLLEEFNGVPMVVRPKSFFQTNPHVAAQLYAT
RLMC_VIBVY      VRVISANIQPIHMARLEGEQEIFLTDAHYLLEEFNGVPMVVRPKSFFQTNPHVAAQLYAT
RLMC_HAEIN      LEVISINLQPQHAAILEGEQEIFLTEQQFLPENFNGIPLFIRPRGFFQTNPKVAAGLYAT
RLMC_HAEIG      LEVISINLQPQHAAILEGEQEIFLTEQQFLPENFNGIPLFIRPQGFFQTNPKVAAGLYAS
RLMC_HAEI8      LEVVSVNLQPLHAAILEGEQEIFLTEQQFLPENFNSIPLFIRPQGFFQTNPKVAEGLYAT
RLMC_HAEIE      LEVISINLQPQHAAILEGEQEIFLTEQQFLPENFNGIPLFIRPQGFFQTNPKVAAGLYAT
RLMC_MANSM      LKVISANIQPQHAAILEGEKEIFFTERQVLEERFNRIPLFIRPQGFFQTNPQVAEGLYGT
RLMC_ACTSZ      LAVVTANIQPQHAAILEGQKEIFLTEQQVLEERFNGIPLFIRPQGFFQTNPAVAEGLYGT
RLMC_PASMU      LKVVSLNIQPQHAAILEGEKEIFLTEQHTLEECFNQIPLFIRPQGFFQTNPQVAQGLYGT
RLMC_ACTP2      DSVVSLNIQPQHAAILEGETEIFLTEKTTIEENFNDIPLFIRPQGFFQTNPNVASQLYAT
RLMC_ACTP7      DSVVSLNIQPQHAAILEGETEIFLTEKTTIEENFNDIPLFIRPQGFFQTNPNVASQLYAT
RLMC_ACTPJ      DSVVSLNIQPQHAAILEGETEIFLTEKTTIEENFNDIPLFIRPQGFFQTNPNVASRLYAT
RLMC_HAEPS      KSVVSLNIQPQHSAILEGEQEIFLTEQQVLEERFNQIPLFIRPQGFFQTNPTVASQLYHT
RLMC_PECAS      LEVISANIQPVHQAIMEGKTEIILSDAAALAEQFNQVPLYIRPQSFFQTNPQVAAALYAT
RLMC_PECCP      LEVISANIQPVHQAIMEGKTEIILSEAAALAEQFNQVPLYIRPQSFFQTNPQVAAALYAT
RLMC_SERP5      LRVISANIQPVHMAIMEGEREIPLTEQQALEEQFNQVPLYIRPQSFFQTNPQVAAELYAT
RLMC_YERPE      LAVISANIQPVHMAILEGEREIPLTEQQALPERFNQVPLYIRPQSFFQTNPQVAASLYAT
RLMC_YERPD      LAVISANIQPVHMAILEGEREIPLTEQQALPERFNQVPLYIRPQSFFQTNPQVAASLYAT
RLMC_YERPP      LAVISANIQPVHMAILEGEREIPLTEQQALPERFNQVPLYIRPQSFFQTNPQVAASLYAT
RLMC_YERPG      LAVISANIQPVHMAILEGEREIPLTEQQALPERFNQVPLYIRPQSFFQTNPQVAASLYAT
RLMC_YERPA      LAVISANIQPVHMAILEGEREIPLTEQQALPERFNQVPLYIRPQSFFQTNPQVAASLYAT
RLMC_YERPN      LAVISANIQPVHMAILEGEREIPLTEQQALPERFNQVPLYIRPQSFFQTNPQVAASLYAT
RLMC_YERPS      LAVISANIQPVHMAILEGEREIPLTEQQALPERFNQVPLYIRPQSFFQTNPPVAASLYAT
RLMC_YERPB      LAVISANIQPVHMAILEGEREIPLTEQQALPERFNQVPLYIRPQSFFQTNPPVAASLYAT
RLMC_YERP3      LAVISANIQPVHMAILEGEREIPLTEQQALPERFNQVPLYIRPQSFFQTNPPVAASLYAT
RLMC_YERPY      LAVISANIQPVHMAILEGEREIPLTEQQALPERFNQVPLYIRPQSFFQTNPPVAASLYAT
RLMC_YERE8      LAVISVNIQPVHMAILEGEQEMPLTEQQALPEIFNQVPLFIRPQSFFQTNPQVAASLYAT
RLMC_EDWI9      LAVISVNIQPVHMAILEGEREIFLTSQQVLSESFNGVPLYIRPQSFFQTNPAVAQALYAQ
RLMC_ECO27      LKVITVNIQPVHMAIMEGETEIYLTEQQALAERFNDVPLWIRPQSFFQTNPAVASQLYAT
RLMC_ECO7I      LKVITVNIQPVHMAIMEGETEIYLTEQQALAERFNDVPLWIRPQSFFQTNPAVASQLYAT
RLMC_ECOUT      LKVITVNIQPVHMAIMEGETEIYLTEQQALAERFNDVPLWIRPQSFFQTNPAVASQLYAT
RLMC_ECOL5      LKVITVNIQPVHMAIMEGETEIYLTEQQALAERFNDVPLWIRPQSFFQTNPAVASQLYAT
RLMC_ECOK1      LKVITVNIQPVHMAIMEGETEIYLTEQQALAERFNDVPLWIRPQSFFQTNPAVASQLYAT
RLMC_ECO45      LKVITVNIQPVHMAIMEGETEIYLTEQQALAERFNDVPLWIRPQSFFQTNPAVASQLYAT
RLMC_ECO81      LKVITVNIQPVHMAIMEGETEIYLTEQQALAERFNDVPLWIRPQSFFQTNPAVASQLYAT
RLMC_ECOL6      LKVITVNIQPVHMAIMEGETEIYLTEQQALAERFNDVPLWIRPQSFFQTNPAVASQLYAT
RLMC_SHIFL      LKVITVNIQPVHMAIMEGETEIYLTEQQALAERFNDVPLWIRPQSFFQTNPAVASQLYAT
RLMC_SHIF8      LKVITVNIQPVHMAIMEGETEIYLTEQQALAERFNDVPLWIRPQSFFQTNPAVASQLYAT
RLMC_SHIDS      LKVITVNIQPVHMAIMEGETEIYLTEHQALAERFNDVPLWIRPQSFFQTNPAVASQLYAT
RLMC_ECOSM      LKVITVNIQPVHMAIMEGETEIYLTEQQALAERFNDVPLWIRPQSFFQTNPAVASQLYAT
RLMC_ECO55      LKVITVNIQPVHMAIMEGETEIYLTEQQALAERFNDVPLWIRPQSFFQTNPAVASQLYAT
RLMC_ECO8A      LKVITVNIQPVHMAIMEGETEIYLTEQQALAERFNDVPLWIRPQSFFQTNPAVASQLYAT
RLMC_ECO24      LKVITVNIQPVHMAIMEGETEIYLTEQQALAERFNDVPLWIRPQSFFQTNPAVASQLYAT
RLMC_ECOBW      LKVITVNIQPVHMAIMEGETEIYLTEQQALAERFNDVPLWIRPQSFFQTNPAVASQLYAT
RLMC_ECODH      LKVITVNIQPVHMAIMEGETEIYLTEQQALAERFNDVPLWIRPQSFFQTNPAVASQLYAT
RLMC_ECOLI      LKVITVNIQPVHMAIMEGETEIYLTEQQALAERFNDVPLWIRPQSFFQTNPAVASQLYAT
RLMC_SHISS      LKVITVNIQPVHMAIMEGETEIYLTEQQALAERFNDVPLWIRPQSFFQTNPAVASQLYAT
RLMC_ECOLC      LKVITVNIQPVHMAIMEGETEIYLTEQQALAERFNDVPLWVRPQSFFQTNPAVASQLYAT
RLMC_ECOHS      LKVITVNIQPVHMAIMEGETEIYLTEQQALAERFNDVPLWVRPQSFFQTNPAVASQLYAT
RLMC_ECOSE      LKVITVNIQPVHMAIMEGETEIYLTEQQALAERFNDVPLWIRPQSFFQTNPAVASQLYAT
RLMC_SHIB3      LKVITVNIQPVHMAIMEGETEIYLTEQQALAERFNDVPLWIRPQSFFQTNPAVASQLYAT
RLMC_SHIBS      LKVITVNIQPVHMAIMEGETEIYLTEQQALAERFNDVPLWIRPQSFFQTNPAVASQLYAT
RLMC_ECO57      LKVITVNIQPVHMAIMEGETEIYLTEQQALVERFNDVPLWIRPQSFFQTNPAVASQLYAT
RLMC_ECO5E      LKVITVNIQPVHMAIMEGETEIYLTEQQALVERFNDVPLWIRPQSFFQTNPAVASQLYAT
RLMC_ECOLU      LKVITVNIQPVHMAIMEGETEIYLTEQQALADRFNDVPLWIRPQSFFQTNPAVASQLYAT
RLMC_ESCF3      LKVITANIQPIHMAIMEGETEIYLTEQQALAERFNDVPLWIRPQSFFQTNPVVASQLYAT
RLMC_CITK8      LKVITANIQPVHMAIMEGETEIFLTEQQALAERFNDVPLWIRPQSFFQTNPVVASHLYAT
RLMC_SALAR      LRVITANIQPVHMAIMEGETEIYLTDQHALAERFNDVPLWIRPQSFFQTNPTVASRLYAT
RLMC_SALDC      LRVITANIQPVHMAIMEGETEIYLTDQQALAERFNDVPLWIRPQSFFQTNPTVASRLYAT
RLMC_SALSV      LRVITANIQPVHMAIMEGETEIYLTDQQALAERFNDVPLWIRPQSFFQTNPTVASRLYAT
RLMC_SALCH      LRVITANIQPVHMAIMEGETEIYLTDQQALVERFNDVPLWIRPQSFFQTNPTVASRLYAT
RLMC_SALPB      LRVITANIQPVHMAIMEGETEIYLTDQQALVERFNDVPLWIRPQSFFQTNPTVASRLYAT
RLMC_SALPC      LRVITANIQPVHMAIMEGETEIYLTDQQALVERFNDVPLWIRPQSFFQTNPTVASRLYAT
RLMC_SALTY      LRVITANIQPVHMAIMEGETEIYLTDQQALAERFNDVPLWIRPQSFFQTNPTVASRLYAT
RLMC_SALEP      LRVITANIQPVHMAIMEGETEIYLTDQQALAERFNDVPLWIRPQSFFQTNPTVASRLYAT
RLMC_SALPA      LRVITANIQPVHMAIMEGETEIYLTDQQALAERFNDVPLWIRPQSFFQTNPTVASRLYAT
RLMC_SALPK      LRVITANIQPVHMAIMEGETEIYLTDQQALAERFNDVPLWIRPQSFFQTNPTVASRLYAT
RLMC_SALA4      LKVITANIQPVHMAIMEGETEIYLTDQQALAERFNDVPLWIRPQSFFQTNPTVASRLYAT
RLMC_SALNS      LRVITANIQPVHMAIMEGETEIYLTDQQALAERFNDVPLWIRPQSFFQTNPTVASRLYAT
RLMC_SALTI      LRVITANIQPVHMAIMEGETEIYLTDQQALAERFNDVPLWIRPQSFFQTNPTVASRLYAT
RLMC_ENT38      LKVITANIQPVHMAIMEGEREVFFTDQQALAERFNDVPLWIRPHSFFQTNPTVASQLYAT
RLMC_CROS8      LKVVTANIQPVHMAIMEGDEEIWLTQQQALAESFNGVPLWIRPQSFFQTNPTVASALYAT
RLMC_XENBS      LTVISANIQPTHMAILEGEKEVIFTEHKMLKEIFNGIPLYIRPRSFFQTNPEIASALYAT
RLMC_XENNA      LTVISANIQPTHMAILEGEKEIIFTGQTMLKETFNGIPLYIRPRSFFQTNPDIASELYAT
RLMC_PHOLL      LTVISANIQPIHMAILEGEKEILFTEQKAFKEQFNGIPLYIRPHSFFQTNPKMASELYAT
RLMC_PROMH      LAVISVNIQPVHMAILEGEQEIVLTEKTFLDEYFNEIPLHIRPKGFFQTNPDVAASLYAT
RLMC_HALNC      LAVLSVNIQPVHQAILEGEQEVILTDRETLTVHLNGLPFHLRPKSFFQTNTRVAEQLYAT
                  ::: *:** * * :**  *: ::    :   :* :*: :**:.****:. :*  **  

RLMC_SHEB5      AREWVAEFSPRSLWDLFCGVGGFGLHCA--------SNDITLTGIEIEAEAIACAQMSAQ
RLMC_SHEB8      ARDWVAEFSPRSLWDLFCGVGGFGLHCA--------SNDITLTGIEIEAEAIACAQMSAQ
RLMC_SHEB9      AREWVAEFSPRSLWDLFCGVGGFGLHCA--------SKDITLTGIEIEAEAIACAQMSAQ
RLMC_SHEB2      AREWVAEFSPRSLWDLFCGVGGFGLHCA--------SKDITLTGIEIEAEAIACAQMSAQ
RLMC_SHEPC      AREWVAEFAPKSLWDLFCGVGGFGLHCA--------TKDIALTGIEIEAEAISCAQISAN
RLMC_SHESW      AREWVAEFAPKSLWDLFCGVGGFGLHCA--------TKDIALTGIEIEAEAISCAQISAN
RLMC_SHESM      AREWVADFAPASLWDLFCGVGGFGLHCA--------AKDIPLTGIEIEAEAIACAKMSAQ
RLMC_SHESR      AREWVADFAPASLWDLFCGVGGFGLHCA--------AKDIPLTGIEIEAEAIACAKMSAQ
RLMC_SHESA      AREWVADFAPASLWDLFCGVGGFGLHCA--------AKDIPLTGIEIEAEAIACAKMSAQ
RLMC_SHEON      AREWVGEFAPKSLWDLFCGVGGFGLHCA--------SKDIPLTGIEIEAEAIACAKMSAQ
RLMC_SHEHH      AREWVAELKPDTLWDLFCGVGGFGLHCA--------SKQSALTGIEISAEAITCAKLSAE
RLMC_SHEPA      AREWVAELKPSSLWDLFCGVGGFGLHCA--------SKTIPLTGIEISSEAIACAKISAE
RLMC_SHELP      ARKWTRELAPTSIWDLFCGVGGFGLHCA--------SKEVALTGIEIEAEAIACAKMSAE
RLMC_SHEFN      AREWVTEFKPNYIWDLFCGVGGFGLHCA--------DSNIRLTGIEIESEAIECAILSAT
RLMC_SHEAM      AAKWVDELSPKSLWDLFCGVGGFGLHCA--------NESLPVTGIEIEAEAIDCAKTSAA
RLMC_VIBC3      ARAWVREIAPTQMWDLFCGVGGFALHCA--------APNTAVTGIEIEPEAIASAQRSAQ
RLMC_VIBCM      ARAWVREIAPTQMWDLFCGVGGFALHCA--------APNTAVTGIEIEPEAIASAQRSAQ
RLMC_VIBCH      ARTWVREIAPTQMWDLFCGVGGFALHCA--------APDTAVTGIEIEPEAIASAQRSAQ
RLMC_VIBVU      ARNWVAELKPRQMWDLFCGVGGFALHCA--------PHAEQVIGIEIEEEAINSAKLSAQ
RLMC_VIBVY      ARDWVAELKPRQMWDLFCGVGGFALHCA--------PHAEQVIGIEIEEEAINSAKLSAQ
RLMC_HAEIN      AQQWVAEFPIYNLWDLFCGVGGFGLHCAKALQEKW-GKPIKLTGIEISSSAILAASHSAK
RLMC_HAEIG      AQQWVAEFPIYNLWDLFCGVGGFGLHCAKALQEKW-GKPIKLTGIEISSSAILAASHSAK
RLMC_HAEI8      AQQWVSELPIYNLWDLFCGVGGFGLHCAKALQEKW-GKPIKLTGIEISSSAILAASHSAK
RLMC_HAEIE      AQQWVAEFPIYNLWDLFCGVGGFGLHCAKALQEKW-GKPIKLTGIEISSSAILAASHSAK
RLMC_MANSM      AQQWVKDLPVNKLWDLFCGVGGFGLHCAKALQEK--NPDIELTGIEIAPSAIYCAGLSAQ
RLMC_ACTSZ      AQNWVKNLPVQRLWDLFCGVGGFGLHCAAALQAN--TPDVALTGIEISPSAIYSAALSAE
RLMC_PASMU      AQHWVQELPVHRLWDLFCGVGGFGLHCAQALQTQYPDRIIQLTGIEISASAIEAATLSAQ
RLMC_ACTP2      AQNWIKDLAIQQFWDLFCGVGGFGLHCAKALQEK--NENVQLTGIEISASAIASATKSAE
RLMC_ACTP7      AQNWIKDLAIQQFWDLFCGVGGFGLHCAKALQEK--NENVQLTSIEISASAIASATKSAE
RLMC_ACTPJ      AQNWIKDLPIQQFWDLFCGVGGFGLHCAKALQEK--NENVQLTGIEISASAIASATQSAA
RLMC_HAEPS      AQEWIKERPITQLWDLFCGVGGFGLHCANTLQTN--NPNVALTGIEISASAIASATKSAQ
RLMC_PECAS      ARDWVAELKITSMWDLFCGVGGFGLHCA--------SSEMRLTGIEISAEAIACARRSAE
RLMC_PECCP      ARDWVAELNITSMWDLFCGVGGFGLHCA--------SPEMRLTGIEISAEAIACARRSAE
RLMC_SERP5      ARDWVRALAIDSMWDLFCGVGGFGLHCA--------LPETRLTGIEISAEAIACARQSAK
RLMC_YERPE      ARQWVQEHEVHSMWDLFCGVGGFGLHCA--------GPETQLTGIEINAEAIACARQSAE
RLMC_YERPD      ARQWVQEHEVHSMWDLFCGVGGFGLHCA--------GPETQLTGIEINAEAIACARQSAE
RLMC_YERPP      ARQWVQEHEVHSMWDLFCGVGGFGLHCA--------GPETQLTGIEINAEAIACARQSAE
RLMC_YERPG      ARQWVQEHEVHSMWDLFCGVGGFGLHCA--------GPETQLTGIEINAEAIACARQSAE
RLMC_YERPA      ARQWVQEHEVHSMWDLFCGVGGFGLHCA--------GPETQLTGIEINAEAIACARQSAE
RLMC_YERPN      ARQWVQEHEVHSMWDLFCGVGGFGLHCA--------GPETQLTGIEINAEAIACARQSAE
RLMC_YERPS      ARQWVQEHEVHSMWDLFCGVGGFGLHCA--------GPETQLTGIEISAEAIACARQSAE
RLMC_YERPB      ARQWVQEHEVHSMWDLFCGVGGFGLHCA--------GPETQLTGIEISAEAIACARQSAE
RLMC_YERP3      ARQWVQEHEVHSMWDLFCGVGGFGLHCA--------GPETQLTGIEISAEAIACARQSAE
RLMC_YERPY      ARQWVQEHEVHSMWDLFCGVGGFGLHCA--------GPETQLTGIEISAEAIACARQSAE
RLMC_YERE8      ARQWVRELKIDSMWDLFCGVGGFGLHCA--------DTETRLTGIEISAEAIACARQSAD
RLMC_EDWI9      ARDWVQALGVTEMWDLFCGVGGFGLHCA--------TPEMTLTGIEISAGAIACARRSAA
RLMC_ECO27      ARDWVRQLPVKHMWDLFCGVGGFGLHCA--------TPDMQLTGIEIAPEAIACAKQSAA
RLMC_ECO7I      ARDWVRQLPIKHMWDLFCGVGGFGLHCA--------TPDMQLTGIEIAPEAIACAKQSAA
RLMC_ECOUT      ARDWVRQLPVKHMWDLFCGVGGFGLHCA--------TPDMQLTGIEIAPEAIACAKQSAA
RLMC_ECOL5      ARDWVRQLPVKHMWDLFCGVGGFGLHCA--------TPDMQLTGIEIAPEAIACAKQSAA
RLMC_ECOK1      ARDWVRQLPVKHMWDLFCGVGGFGLHCA--------TPDMQLTGIEIAPEAIACAKQSAA
RLMC_ECO45      ARDWVRQLPVKHMWDLFCGVGGFGLHCA--------TPDMQLTGIEIAPEAIACAKQSAA
RLMC_ECO81      ARDWVRQLPVKHMWDLFCGVGGFGLHCA--------TPDMQLTGIEIAPEAIACAKQSAA
RLMC_ECOL6      ARDWVRQLPVKHMWDLFCGVGGFGLHCA--------TPDMQLTGIEIAPEAIACAKQSAA
RLMC_SHIFL      ARDWVRQLPVKHMWDLFCGVGGFGLHCA--------TPDMQLTGIEIAPEAIACAKQSAA
RLMC_SHIF8      ARDWVRQLPVKHMWDLFCGVGGFGLHCA--------TPDMQLTGIEIAPEAIACAKQSAA
RLMC_SHIDS      ARDWVRQLPVTHMWDLFCGVGGFGLHCA--------TPDMQLTGIEIAPEAIACAKQSAA
RLMC_ECOSM      ARDWVRQLPVNHMWDLFCGVGGFGLHCA--------TPDIQLTGIEIAPEAIACAKQSAA
RLMC_ECO55      ARDWVRQLPVKHMWDLFCGVGGFGLHCA--------TPDMQLTGIEIASEAIACAKQSAA
RLMC_ECO8A      ARDWVRQLPVKHMWDLFCGVGGFGLHCA--------TPDMQLTGIEIASEAIACAKQSAA
RLMC_ECO24      ARDWVRQLPVKHMWDLFCGVGGFGLHCA--------TPDMQLTGIEIASEAIACAKQSAA
RLMC_ECOBW      ARDWVRQLPVKHMWDLFCGVGGFGLHCA--------TPDMQLTGIEIASEAIACAKQSAA
RLMC_ECODH      ARDWVRQLPVKHMWDLFCGVGGFGLHCA--------TPDMQLTGIEIASEAIACAKQSAA
RLMC_ECOLI      ARDWVRQLPVKHMWDLFCGVGGFGLHCA--------TPDMQLTGIEIASEAIACAKQSAA
RLMC_SHISS      ARDWVRQLPVKHMWDLFCGVGGFGLHCA--------TPDMQLTGIEIASEAIACAKQSAA
RLMC_ECOLC      ARDWVRQLPVKHMWDLFCGVGGFGLHCA--------TPDMQLTGIEIAPEAIACAKQSAA
RLMC_ECOHS      ARDWVRQLPVKHMWDLFCGVGGFGLHCA--------TPDMQLTGIEIAPEAIACAKQSAA
RLMC_ECOSE      ARDWVRQLPVKHMWDLFCGVGGFGLHCA--------TPDMQLTGIEIASEAIACAKQSAA
RLMC_SHIB3      VRDWVRQLPVKHMWDLFCGVGGFGLHCA--------TPDMQLTGIEIAPEAIACAKQSAA
RLMC_SHIBS      ARDWVRQLPVKHMWDLFCGVGGFGLHCA--------TPDMQLTGIEIAPEAIACAKQSAA
RLMC_ECO57      ARDWVRQLPVKHMWDLFCGVGGFGLHCA--------TPDMQLTGIEIALEAIACAKQSAA
RLMC_ECO5E      ARDWVRQLPVKHMWDLFCGVGGFGLHCA--------TPDMQLTGIEIALEAIACAKQSAA
RLMC_ECOLU      ARDWVRQLPVNHMWDLFCGVGGFGLHCA--------TPDMQLTGIEIAPEAIACAKQSAA
RLMC_ESCF3      ARDWVRQLPVKHMWDLFCGVGGFGLHCA--------TPDMQLTGIEIAPEAIACAKQSAA
RLMC_CITK8      ARDWVRQLPVHHMWDLFCGVGGFGLHCA--------TPEMTLTGIEIAPEAIACAKQSAA
RLMC_SALAR      ARDWVGQLPVRHMWDLFCGVGGFGLHCA--------TPQMQLTGIEIAPEAIACARQSAA
RLMC_SALDC      ARDWVGQLPVRHMWDLFCGVGGFGLHCA--------TPQMQLTGIEIAPEAIACAKQSAA
RLMC_SALSV      ARDWVGQLPVRHMWDLFCGVGGFGLHCA--------TPQMQLTGIEIAPEAIACAKQSAA
RLMC_SALCH      ARDWVGQLPVRHMWDLFCGVGGFGLHCA--------TPQMQLTGIEIAPEAIACAKQSAA
RLMC_SALPB      ARDWVGQLPVRHMWDLFCGVGGFGLHCA--------TPQMQLTGIEIAPEAIACAKQSAA
RLMC_SALPC      ARDWVGQLPVRHMWDLFCGVGGFGLHCA--------TPQMQLTGIEIAPEAIACAKQSAA
RLMC_SALTY      ARDWVGQLPVRHMWDLFCGVGGFGLHCA--------TPQMQLTGIEIAPEAIACAKQSAA
RLMC_SALEP      ARDWVGQLPVRHMWDLFCGVGGFGLHCA--------TPQMQLTGIEIAPEAIACAKQSAA
RLMC_SALPA      ARDWVGQLPVRHMWDLFCGVGGFGLHCA--------TPQMQLTGIEIAPEAIACAKQSAA
RLMC_SALPK      ARDWVGQLPVRHMWDLFCGVGGFGLHCA--------TPQMQLTGIEIAPEAIACAKQSAA
RLMC_SALA4      ARDWVGQLPVRHMWDLFCGVGGFGLHCA--------TPQMQLTGIEIAPEAIACAKQSAA
RLMC_SALNS      ARDWVGQLPVRHMWDLFCGVGGFGLHCA--------TPQMQLTGIEIAPEAIACAKQSAA
RLMC_SALTI      ARDWVGQLPVRHMWDLFCGVGGFGLHCA--------TPQMQLTGIEIAPEAIACAKQSAA
RLMC_ENT38      ARDWVRALNIHHMWDLFCGVGGFGLHCA--------TPQMTLTGIEISPEAIACAKQSAA
RLMC_CROS8      ARDWVRALPVNHMWDLFCGVGGFGLHCA--------TPEMTLTGIEIAPEAIASARASAQ
RLMC_XENBS      AGRWVRELNISSMWDLFCGAGGFGLHCA--------DKETRLTGIEISAEAIACAKNSAK
RLMC_XENNA      AGRWVRELNISSMWDLFCGAGGFGLHCA--------DKETKLTGIEISAEAIDCAKSSAK
RLMC_PHOLL      AGRWVRELKISSMWDLFCGVGGFGLHCA--------DKNTCLTGIEISSEAIDCARDSAK
RLMC_PROMH      AGHWVKELQINRLWDLFCGSGGFGLHCA--------QKNTELTGIEISPEAIECARLSAN
RLMC_HALNC      ARSWVAEVAPVHMWDLFCGVGGFALHCAD-------VIPGQVTGIEISAEAIASAQQSAL
                .  *        :****** ***.****             : .***   ** .*  ** 

RLMC_SHEB5      MMGLENVQFMALDSTDFAKGKS---AADKPDLIIVNPPRRGIGEALCQSLSEFAPKAILY
RLMC_SHEB8      MMGLENVQFMALDSTDFAKGKS---AADKPDLIIVNPPRRGIGEALCQSLSEFAPKAILY
RLMC_SHEB9      MMGLENVQFMALDSTDFAKGKS---AADKPDLIIVNPPRRGIGEALCQSLSEFAPKAILY
RLMC_SHEB2      MMGLENVQFMALDSTDFAKGKS---AADKPDLIIVNPPRRGIGEALCQSLSEFAPKAILY
RLMC_SHEPC      LMGLEKVQFMALDSTDFAQGKN---AADKPDLIIVNPPRRGIGEALCQSLSEFAPKAILY
RLMC_SHESW      LMGLEKVQFMALDSTDFAQGKN---AADKPDLIIVNPPRRGIGEALCQSLSEFAPRAILY
RLMC_SHESM      LMGLDKVQFMALDSTDFAKGDA---AQTKPELIIVNPPRRGIGESLCHSLSEFAPKAILY
RLMC_SHESR      LMGLDKVQFMALDSTDFAKGDA---AQTKPELIIVNPPRRGIGESLCHSLSEFAPKAILY
RLMC_SHESA      LMGLDKVEFMALDSTDFAKGEA---AQTKPELIIVNPPRRGIGESLCHSLSEFAPKAILY
RLMC_SHEON      MMGLDNVQFMALDSTDFAKGDA---AATKPDLIIVNPPRRGIGESLCDALSEFAPRAILY
RLMC_SHEHH      AMGLTQVNFTALDSTGFAQGCD---AKDKPDVVIVNPPRRGIGESLCQSLSAFAPKAILY
RLMC_SHEPA      TMGLTQVDFTALDSTGFAQGCD---ATDKPDVVIVNPPRRGIGESLCQSLSDFAPKAILY
RLMC_SHELP      TLGLDKVRFTALDSTSFASDSR---GEEKPELIIVNPPRRGIGEALCHSLSEFAPKAILY
RLMC_SHEFN      KLGFTQVDFSALDSTHFAKGQS---AQDKPDLIIVNPPRRGLGKSLCDSLSEFAPKAIVY
RLMC_SHEAM      AMGLDNLSFAALDSTDFAMGQQ---AQEVPEVIIVNPPRRGIGEELCERLSAFGPRAIIY
RLMC_VIBC3      MMGIDNLSFAALDSAKFSQSQ-----MSAPELVLVNPPRRGLGSELTAQLEALAPQHILY
RLMC_VIBCM      MMGIDNLSFAALDSAKFSQSQ-----MSAPELVLVNPPRRGLGSELTAQLEALAPQHILY
RLMC_VIBCH      MMGIDNLSFAALDSAKFSQSQ-----MSAPELVLVNPPRRGLGSELTAQLEALAPKYILY
RLMC_VIBVU      QLGIDNLRFSALDSAAYSQAQ-----TQAADLILVNPPRRGLGQALSEQLEQLASQYLIY
RLMC_VIBVY      QLGIGNLRFSALDSAAYSQAQ-----TQAADLILVNPPRRGLGQALSEQLEQLAPQYLIY
RLMC_HAEIN      ILGLEHVNFQSLDAASVIEN----KNENKPDLVIVNPPRRGIGKELSEFLNQIQPHFILY
RLMC_HAEIG      ILGLEHVNFQSLDAASVIEN----KNENKPDLVIVNPPRRGIGKELSEFLNQIQPHFILY
RLMC_HAEI8      ILGLEHVNFQSLDAASVIEN----KNENKPDLVIVNPPRRGIGKELSEFLNQIQPHFILY
RLMC_HAEIE      ILGLEHVNFQSLNAASVMEN----KNENKPDLVIVNPPRRGIGKQLSEFLNQIQPHFILY
RLMC_MANSM      KCGLKKVNFQSLDAANFALN----QDENKPDLVIVNPPRRGIGKPLAQFLNQMQPQFILY
RLMC_ACTSZ      KCGLKNVSFQSLDAANFALN----QDD-KPDLVIVNPPRRGIGKPLAEFLNNLRPQFLLY
RLMC_PASMU      KLGLKQVKFQSLDAKHFALAQSPAAQDDTPELVIVNPPRRGIGIELAQFLNQLAPHFILY
RLMC_ACTP2      QLQLKNITFASLDSAQFALN----EKSATPDLVIVNPPRRGIGKPLAEFLNQLGTPYLIY
RLMC_ACTP7      QLQLKNITFASLDSAQFALN----EKSATPDLVIVNPPRRGIGKPLAEFLNQLGTPYLIY
RLMC_ACTPJ      QLQLKNVTFASLDSAQFALN----DKGKSPDLVIVNPPRRGIGKPLAEFLNELGTPYLIY
RLMC_HAEPS      QLGLQNVKFASLDSAQFALN----EQGTTPDLVIVNPPRRGIGKPLAEFINQLGSPYLIY
RLMC_PECAS      QLGLKHVEFQALDSTQFATA-----KAEIPDLVLVNPPRRGIGSELCSYLSRMAPDYILY
RLMC_PECCP      QLGLKQVEFQALDSTQFATG-----KAEIPELVLVNPPRRGIGSELCTYLSRMAPDYILY
RLMC_SERP5      TLGLQHVDFQALDSTRFATA-----EGSVPQLVLVNPPRRGIGKALCDYLNQMAPGYILY
RLMC_YERPE      QLGLKNVSFAALDSTRFATA-----EAQIPELVLVNPPRRGIGRELCDYLSQMAPKFILY
RLMC_YERPD      QLGLKNVSFAALDSTRFATA-----EAQIPELVLVNPPRRGIGRELCDYLSQMAPKFILY
RLMC_YERPP      QLGLKNVSFAALDSTRFATA-----EAQIPELVLVNPPRRGIGRELCDYLSQMAPKFILY
RLMC_YERPG      QLGLKNVSFAALDSTRFATA-----EAQIPELVLVNPPRRGIGRELCDYLSQMAPKFILY
RLMC_YERPA      QLGLKNVSFAALDSTRFATA-----EAQIPELVLVNPPRRGIGRELCDYLSQMAPKFILY
RLMC_YERPN      QLGLKNVSFAALDSTRFATA-----EAQIPELVLVNPPRRGIGRELCDYLSQMAPKFILY
RLMC_YERPS      QLGLKNVSFAALDSTRFATA-----EAQIPELVLVNPPRRGIGRELCDYLSQMAPKFILY
RLMC_YERPB      QLGLKNVSFAALDSTRFATA-----EAQIPELVLVNPPRRGIGRELCDYLSQMAPKFILY
RLMC_YERP3      QLGLKNVSFAALDSTRFATA-----EAQIPELVLVNPPRRGIGRELCDYLSQMAPKFILY
RLMC_YERPY      QLGLKNVSFAALDSTRFATA-----EAQIPELVLVNPPRRGIGRELCDYLSQMAPKFILY
RLMC_YERE8      QLGLKNVTFAALDSTQFATA-----ETQVPQLVLVNPPRRGIGAQLCEYLSQMAPQFILY
RLMC_EDWI9      QLGLTKVSFAALDSGAFADA-----HSAVPQLVLVNPPRRGIGAALCDYMNRMAPPYILY
RLMC_ECO27      ELGLTRLQFQALDSTQFASA-----QGEVPELVLVNPPRRGIGKPLCDYLSTMAPRFIIY
RLMC_ECO7I      ELGLTRLQFQALDSTQFASA-----QGEVPELVLVNPPRRGIGKPLCDYLSTMAPRFIIY
RLMC_ECOUT      ELGLTRLQFQALDSTQFATA-----QGEVPELVLVNPPRRGIGKPLCDYLSTMAPRFIIY
RLMC_ECOL5      ELGLTRLQFQALDSTQFATA-----QGEVPELVLVNPPRRGIGKPLCDYLSTMAPRFIIY
RLMC_ECOK1      ELGLTRLQFQALDSTQFATA-----QGEVPELVLVNPPRRGIGKPLCDYLSTMAPRFIIY
RLMC_ECO45      ELGLTRLQFQALDSTQFATA-----QGEVPELVLVNPPRRGIGKPLCDYLSTMAPRFIIY
RLMC_ECO81      ELGLTRLQFQALDSTQFATA-----QGEVPELVLVNPPRRGIGKPLCDYLSTMAPRFIIY
RLMC_ECOL6      ELGLTRLQFQALDSTQFATA-----QGEVPELVLVNPPRRGIGKPLCDYLSTMAPRFIIY
RLMC_SHIFL      ELGLTRLQFQALDSTQFATA-----QGEVPELVLVNPPRRGIGKPLCDYLSTMAPRFIIY
RLMC_SHIF8      ELGLTRLQFQALDSTQFATA-----QGEVPELVLVNPPRRGIGKPLCDYLSTMAPRFIIY
RLMC_SHIDS      ELGLTCLQFQALDSTQFATA-----QGEVPELVLVNPPRRGIGKPLCDYLSTMAPCFIIY
RLMC_ECOSM      ELGLTRLQFQALDSTQFATA-----QGEVPELVLVNPPRRGIGIPLCDYLSTMAPRFIIY
RLMC_ECO55      ELGLTRLQFQALDSTQFATA-----QGEVPELVLVNPPRRGIGKPLCDYLSTMAPRFIIY
RLMC_ECO8A      ELGLTRLQFQALDSTQFATA-----QGEVPELVLVNPPRRGIGKPLCDYLSTMAPRFIIY
RLMC_ECO24      ELGLTRLQFQALDSTQFATA-----QGEVPELVLVNPPRRGIGKPLCDYLSTMAPRFIIY
RLMC_ECOBW      ELGLTRLQFQALDSTQFATA-----QGDVPELVLVNPPRRGIGKPLCDYLSTMAPRFIIY
RLMC_ECODH      ELGLTRLQFQALDSTQFATA-----QGDVPELVLVNPPRRGIGKPLCDYLSTMAPRFIIY
RLMC_ECOLI      ELGLTRLQFQALDSTQFATA-----QGDVPELVLVNPPRRGIGKPLCDYLSTMAPRFIIY
RLMC_SHISS      ELGLTRLQFQALDSTQFATA-----QGDVPELVLVNPPRRGIGKPLCDYLSTMAPRFIIY
RLMC_ECOLC      ELGLTRLQFQALDSTQFATA-----QGEVPELVLVNPPRRGIGKPLCDYLSTMAPRFIIY
RLMC_ECOHS      ELGLTRLQFQALDSTQFATA-----QGEVPELVLVNPPRRGIGKPLCDYLSTMAPRFIIY
RLMC_ECOSE      ELGLTRLQFQALDSTQFATA-----QGEVPELVLVNPPRRGIGKPLCDYLSTMAPRFIIY
RLMC_SHIB3      ELGLTRLQFQALDSTQFATA-----QGEVQELVLVNPPRRGIGKPLCDYLSTMAPRFIIY
RLMC_SHIBS      ELGLTRLQFQALDSTQFATA-----QGEVPELVLVNPPRRGIGKPLCDYLSTMAPRFIIY
RLMC_ECO57      ELGLTRLQFQALDSTQFATA-----QGEVPELVLVNPPRRGIGKPLCDYLSTMAPRFIIY
RLMC_ECO5E      ELGLTRLQFQALDSTQFATA-----QGEVPELVLVNPPRRGIGKPLCDYLSTMAPRFIIY
RLMC_ECOLU      ELGLTRLQFQALDSTQFATA-----QGEVPELVLVNPPRRGIGKPLCDYLSTMAPRFIIY
RLMC_ESCF3      ELGLTRLQFQALDSTQFATT-----QGEVPELVLVNPPRRGIGKPLCDYLSTMAPRFIIY
RLMC_CITK8      ELGLTNLHFQALDSTQFATG-----QGEVPELVLVNPPRRGIGKALCDYLSQMAPEYIIY
RLMC_SALAR      ELGLTRLHFQALDSTQFATA-----QGETPDLVLVNPPRRGIGKPLCDYLAQIAPRFIIY
RLMC_SALDC      ELGLTRLHFQALDSTQFATA-----QGETPDLVLVNPPRRGIGKPLCDYLAQMAPRFIIY
RLMC_SALSV      ELGLTRLHFQALDSTQFATA-----QGETPDLVLVNPPRRGIGKPLCDYLAQMAPRFIIY
RLMC_SALCH      ELGLTRLHFQALDSTQFAIA-----QGETPDLVLVNPPRRGIGKPLCDYLAQMAPRFIIY
RLMC_SALPB      ELGLTRLHFQALDSTQFAIA-----QGETPDLVLVNPPRRGIGKPLCDYLAQMAPRFIIY
RLMC_SALPC      ELGLTRLHFQALDSTQFAIA-----QGETPDLVLVNPPRRGIGKPLCDYLAQMAPRFIIY
RLMC_SALTY      ELGLTRLHFQALDSTQFATA-----QGETPDLVLVNPPRRGIGKPLCDYLAQMAPRFIIY
RLMC_SALEP      ELGLTRLHFQALDSTQFATA-----QGETPDLVLVNPPRRGIGKPLCDYLAQMAPRFIIY
RLMC_SALPA      ELGLTRLHFQALDSTQFATA-----QGETPDLVLVNPPRRGIGKPLCDYLAQMAPRFIIY
RLMC_SALPK      ELGLTRLHFQALDSTQFATA-----QGETPDLVLVNPPRRGIGKPLCDYLAQMAPRFIIY
RLMC_SALA4      ELGLTRLHFQALDSTQFATA-----QGETPDLVLVNPPRRGIGKPLCDYLAQMAPRFIIY
RLMC_SALNS      ELGLTRLHFQALDSTQFAIA-----QGETPDLVLVNPPRRGIGKPLCDYLAQMAPRFIIY
RLMC_SALTI      ELGLTRLHFQALDSTQFATA-----QGETPDLVLVNPPRRGIGKPLCDYLAQMAPRFIIY
RLMC_ENT38      QLGLTDLHFQALDSAEFATG-----QGRVPELVLVNPPRRGIGKTLCDYLSQMAPDFIIY
RLMC_CROS8      ALGLRNVHFQALDSTDFATG-----QQAVPDLVLVNPPRRGIGKALCEYLSHMAPRYIVY
RLMC_XENBS      SLGLEQVEFQALDSTHFALD-----KAQLPELVLVNPPRRGIGKALCEYLSRMAPKFILY
RLMC_XENNA      SLGLKSVEFQALDSTHFALE-----KAKIPELVLVNPPRRGIGKELCEYLSRMAPKFVLY
RLMC_PHOLL      TLGLENIEFQALDSTHFAVA-----KDQIPQLVLVNPPRRGIGKVLCDYLSKMVPDYILY
RLMC_PROMH      ELGLEHVEFQALDSTGFALA-----KESVPELVLVNPPRRGIGETLCDYLNSMKPRFILY
RLMC_HALNC      ELGLKNVSFHALGANEFIDQAV--SLPQMPALVVVNPPRRGLGVGLCAFLDESVVQTVIY
                   :  : * :*.:                 :::*******:*  *   :       ::*

RLMC_SHEB5      SSCNPKTLAKDLEHIQGYHLTKVQLFDLFPHSDHFEVLAMLVKD-------
RLMC_SHEB8      SSCNPKTLAKDLEHIQGYHLTKVQLFDLFPHTDHFEVLAMLVKD-------
RLMC_SHEB9      SSCNPKTLAKDLEHIQGYHLTKVQLFDLFPHTDHFEVLAMLVKD-------
RLMC_SHEB2      SSCNPKTLAKDLEHIQGYHLTKVQLFDLFPHTDHFEVLAMLVKD-------
RLMC_SHEPC      SSCNPKTLAKDLEHIQGYHLTKVQLFDLFPHTDHFEVLAMLVKD-------
RLMC_SHESW      SSCNPKTLAKDLEHIQGYHLTKVQLFDLFPHTDHFEVLAMLVKD-------
RLMC_SHESM      SSCNPKTLAKDLGHIRGYRLTKVQLFDLFPHSDHFEVLALLVKD-------
RLMC_SHESR      SSCNPKTLAKDLGHIRGYRLTKVQLFDLFPHSDHFEVLALLVKD-------
RLMC_SHESA      SSCNPKTLAKDLGHIRGYRLTKVQLFDLFPHSDHFEVLALLVKD-------
RLMC_SHEON      SSCNPKTLAKDLVHIRGYQLTRVQLFDLFPHSDHFEVLAMLVKDSR-----
RLMC_SHEHH      SSCNPHTLAKDLACIQGYRVQKVQLFDMFPHTDHFEVLVMLLKDA------
RLMC_SHEPA      SSCNPHTLAKDLANIQGYHIQKVQLFDMFPHTDHFEVLVMLVKPS------
RLMC_SHELP      SSCNPKTLAKDLHCISGYRVTKVQLFDMFPHTDHFEVLVMLQRIGE-----
RLMC_SHEFN      SSCNPHTLMSDLEYITGYQITKVQMFDMFPHTDHFEVLVMLEQL-------
RLMC_SHEAM      SSCNPETLAKDLALISGYRIARVQLFDMFPHSDHFEVLCLLLKEAACASAD
RLMC_VIBC3      SSCNPQTMVKDIAELASYQMSRVQWFDMFPHTDHAEVLTLLVRK-------
RLMC_VIBCM      SSCNPQTMVKDIAELASYQMSRVQWFDMFPHTDHAEVLTLLVRK-------
RLMC_VIBCH      SSCNPQTMVKDIAELSSYQMIRVQWFDMFPHTDHAEVLTLLVRK-------
RLMC_VIBVU      SSCNPVTMQQDLAHLPSYRVERAQWFDMFPHTDHAEVMMLLVRQ-------
RLMC_VIBVY      SSCNPVTMQQDLAHLPSYQVERAQWFDMFPHTDHAEVMMLLVRQ-------
RLMC_HAEIN      SSCNAMTMGKDLQHLTCYKPLKIQLFDMFPQTSHYEVLVLLERKKIN----
RLMC_HAEIG      SSCNAMTMGKDLQHLTCYKPLKIQLFDMFPQTSHYEVLVLLERKKIN----
RLMC_HAEI8      SSCNAMTMGKDLQHLTCYKPLKIQLFDMFPQTSHYEVLVLLERKKIN----
RLMC_HAEIE      SSCNAMTMGKDLQHLTCYKPLKIQLFDMFPQTSHYEVLVLLERKKIN----
RLMC_MANSM      SSCNAISMTKDLLELTHYQLQKIQLFDMFPHTSHYEVLTLLIKR-------
RLMC_ACTSZ      SSCNAVTMGSDLQSLTHYQMRKIRLFDMFPHTAHYEVLTLLTLK-------
RLMC_PASMU      SSCNAETMGKDVLHLSDYQLKKVQLFDMFPHTSHYEVLCLLERK-------
RLMC_ACTP2      SSCNARTMAQDFEALSNYSLQKVQLFDMFPHTSHYEVLTFLVKKS------
RLMC_ACTP7      SSCNARTMAQDFEALSNYSLQKVQLFDMFPHTSHYEVLTFLVKKS------
RLMC_ACTPJ      SSCNAQTMAKDFEALSNYSLQKVQLFDMFPHTSHYEVLTFLVKKS------
RLMC_HAEPS      SSCNAETMAKDFASLSHYELKKVQLFDMFPHTAHYEVLTFLVNKII-----
RLMC_PECAS      SSCNAESMAKDMTELANYRALRVQLFDMFPHTAHYEVLTLLKRA-------
RLMC_PECCP      SSCNAESMAKDMTELTNYRALRVQLFDMFPHTAHYEVLTLLKREI------
RLMC_SERP5      SSCNAESMAKDIEMLPDYRIERVQLFDMFPHTAHYEVLTLLVRN-------
RLMC_YERPE      SSCNAETMAKDISLLAGYHIERVQLFDMFPHTSHYEVLTLLTLRR------
RLMC_YERPD      SSCNAETMAKDISLLAGYHIERVQLFDMFPHTSHYEVLTLLTLRR------
RLMC_YERPP      SSCNAETMAKDISLLAGYHIERVQLFDMFPHTSHYEVLTLLTLRR------
RLMC_YERPG      SSCNAETMAKDISLLAGYHIERVQLFDMFPHTSHYEVLTLLTLRR------
RLMC_YERPA      SSCNAETMAKDISLLAGYHIERVQLFDMFPHTSHYEVLTLLTLRR------
RLMC_YERPN      SSCNAETMAKDISLLAGYHIERVQLFDMFPHTSHYEVLTLLTLRR------
RLMC_YERPS      SSCNAETMAKDISLLAGYHIERVQLFDMFPHTSHYEVLTLLALRR------
RLMC_YERPB      SSCNAETMAKDISLLAGYHIERVQLFDMFPHTSHYEVLTLLALRR------
RLMC_YERP3      SSCNAETMAKDISLLAGYHIERVQLFDMFPHTSHYEVLTLLALRR------
RLMC_YERPY      SSCNAETMAKDISLLAGYHIERVQLFDMFPHTSHYEVLTLLALRR------
RLMC_YERE8      SSCNAETMAKDISLLADYRIERVQLFDMFPHTAHYEVLSLLIKC-------
RLMC_EDWI9      SSCNAQSMVQDIERLADYRIEKVRLFDMFPHTAHYEVLTLLVRASA-----
RLMC_ECO27      SSCNAQTMAKDIRELPGYRIERVQLFDMFPHTAHYEVLTLLVKQ-------
RLMC_ECO7I      SSCNAQTMAKDIRELPGYRIERVQLFDMFPHTAHYEVLTLLVKQ-------
RLMC_ECOUT      SSCNAQTMAKDIRELPGYRIERVQLFDMFPHTAHYEVLTLLVKQ-------
RLMC_ECOL5      SSCNAQTMAKDIRELPGYRIERVQLFDMFPHTAHYEVLTLLVKQ-------
RLMC_ECOK1      SSCNAQTMAKDIRELPGYRIERVQLFDMFPHTAHYEVLTLLVKQ-------
RLMC_ECO45      SSCNAQTMAKDIRELPGYRIERVQLFDMFPHTAHYEVLTLLVKQ-------
RLMC_ECO81      SSCNAQTMAKDIRELPGYRIERVQLFDMFPHTAHYEVLTLLVKQ-------
RLMC_ECOL6      SSCNAQTMAKDIRELPGYRIERVQLFDMFPHTAHYEVLTLLVQQ-------
RLMC_SHIFL      SSCNAQTMAKDIRELPGYRIERVQLFDMFPHTAHYEVLTLLVKQ-------
RLMC_SHIF8      SSCNAQTMAKDIRELPGYRIERVQLFDMFPHTAHYEVLTLLVKQ-------
RLMC_SHIDS      SSCNAQTMAKDIRELPGYRIERVQLFDMFPHTAHYEVLTLQVKI-------
RLMC_ECOSM      SSCNAQTMAKDIRELPGYRIERVQLFDMFPHTAHYEVLTLLVKQ-------
RLMC_ECO55      SSCNAQTMAKDIRELPGYRIERVQLFDMFPHTAHYEVLTLLVKQ-------
RLMC_ECO8A      SSCNAQTMAKDIRELPGYRIERVQLFDMFPHTAHYEVLTLLVKQ-------
RLMC_ECO24      SSCNAQTMAKDIRELPGYRIERVQLFDMFPHTAHYEVLTLLVKQ-------
RLMC_ECOBW      SSCNAQTMAKDIRELPGFRIERVQLFDMFPHTAHYEVLTLLVKQ-------
RLMC_ECODH      SSCNAQTMAKDIRELPGFRIERVQLFDMFPHTAHYEVLTLLVKQ-------
RLMC_ECOLI      SSCNAQTMAKDIRELPGFRIERVQLFDMFPHTAHYEVLTLLVKQ-------
RLMC_SHISS      SSCNAQTMAKDIRELPGYRIERVQLFDMFPHTAHYEVMTLLVKQ-------
RLMC_ECOLC      SSCNAQTMAKDVRELPGYRIERVQLFDMFPHTAHYEVLTLLVKQ-------
RLMC_ECOHS      SSCNAQTMAKDVRELPGYRIERVQLFDMFPHTAHYEVLTLLVKQ-------
RLMC_ECOSE      SSCNAQTMAKDVRELPGYRIERVQLFDMFPHTAHYEVLTLLVKQ-------
RLMC_SHIB3      SSCNAQTMAKDIRELPGFRIERVQLFDMFPHTAHYEVLTLLVKQ-------
RLMC_SHIBS      SSCNAQTMAKDIRELPGFRIERVQLFDMFPHTAHYEVLTLLVKQ-------
RLMC_ECO57      SSCNAQTMAKDIRELPGYRIERVQLFDMFPHTAHYEVLTLLVKM-------
RLMC_ECO5E      SSCNAQTMAKDIRELPGYRIERVQLFDMFPHTAHYEVLTLLVKM-------
RLMC_ECOLU      SSCNAQTMAKDIRELPGYRIERVQLFDMFPHTAHYEVLTLLVKM-------
RLMC_ESCF3      SSCNAQTMTKDIRELSGYRIERVQLFDMFPHTAHYEVLTLLVKQ-------
RLMC_CITK8      SSCNAQTMAKDIANLPGYRIERVQLFDMFPHTAHYEVLTLLTKTR------
RLMC_SALAR      SSCNAQTMAQDIRHLPNYRIQRVQLFDMFPHTAHYEVLTLLCRL-------
RLMC_SALDC      SSCNAQTMAQDIRHLPNYRIQRVQLFDMFPHTAHYEVLTLLCRL-------
RLMC_SALSV      SSCNAQTMAQDIRHLPNYRIQSVQLFDMFPHTAHYEVLTLLCRL-------
RLMC_SALCH      SSCNAQTMAQDIRHLPNYRIQRVQLFDMFPHTAHYEVLALLRRSI------
RLMC_SALPB      SSCNAQTMAQDIRHLPNYRIQRVQLFDMFPHTAHYEVLALLRRSI------
RLMC_SALPC      SSCNAQTMAQDIRHLPNYRIQRVQLFDMFPHTAHYEVLALLRRSI------
RLMC_SALTY      SSCNAQTMAQDIRHLPNYRIQRVQLFDMFPHTAHYEVLALLRRSI------
RLMC_SALEP      SSCNAQTMAQDIRHLPNYRIQRVQLFDMFPHTAHYEVLALLRRL-------
RLMC_SALPA      SSCNAQTMAQDIRHLPNYRIQRVQLFDMFPHTAHYEVLTLLCRQ-------
RLMC_SALPK      SSCNAQTMAQDIRHLPNYRIQRVQLFDMFPHTAHYEVLTLLCRQ-------
RLMC_SALA4      SSCNAQTMAQDIRHLPNYRIQRVQLFDMFPHTAHYEVLTLLCRL-------
RLMC_SALNS      SSCNAQTMAQDIRHLPNYRIQRVQLFDMFPHTAHYEVLTLLRRSI------
RLMC_SALTI      SSCNAQTMAQDIRHLPNYRIQRVQLFDMFPHTAHYEVLTLLCRL-------
RLMC_ENT38      SSCNAQTMAKDFGHLPGYRVERVQLFDMFPHTAHYEVLTLLVKS-------
RLMC_CROS8      SSCNAQTMAKDIGEWPGYRIARVQLFDMFPHTAHYEVLTLLVRE-------
RLMC_XENBS      SSCNAETMAKDIAALEQYRIEKVQLFDMFPHTEHYETLALLIFDGK-----
RLMC_XENNA      SSCNAETMAKDIAMLKQYRIEKVQLFDMFPHTEHYETLALLILD-------
RLMC_PHOLL      SSCNAQTMAKDIAALANYRVEKTQLFDMFPHTEHYEVLTLLVLNHN-----
RLMC_PROMH      SSCNAQTMAKDIQQLSHYRIDRVQLFDMFPHTAHYEVLTLLVLQQS-----
RLMC_HALNC      SSCNPESLARDLVMMPGFELVKAQVFDLFPHTAHSEVLAMLVRVR------
                ****. ::  *.     :     : **:**:: * *.: :