CLUSTAL format seed alignment for MF_01014

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

HIS4_NOSS1       -----MDVIPAIDLLAGRCVRLYQGDYDRSQVFSENPVDVAKQWVD-EGATRLHIVDLDG
HIS4_SYNY3       -----MKILPAIDLLGGKCVRLYQGDYDQSQVYHEDPVEVARQWQA-QGASRLHLVDLDG
HIS4_THEEB       -----MDVIPAIDLLDGKCVRLVQGNYDKVNVFHDDPLKVALYWQR-LGAPRLHLVDLDA
HIS4_GLOVI       -----MDIIPAIDILDGRCVRLYQGNYQLAETYGEDPVAVACNWAK-LGAPRLHVVDLDG
HIS4_PROMA       ----MIEIIPAIDLLKGSCVRLVQGDYNEVTEFNDNPSQQALLWQT-LGAKRLHLVDLDG
HIS4_SYNPX       -----MEILPAIDLLDGACVRLHKGDYEQVTRFSDDPVAQALSWQQ-QGATRLHLVDLDG
HIS4_PROMP       -----MKLIPAIDLMNGKCVRLFKGDFNKKKDFSREPYEQAKYWEN-EGAKCIHIVDLDA
HIS4_CAUVC       -----MILYPAIDLKDGQCVRLLHGDMDKATVFNTSPADQAQRFVQ-DGFSWLHVVDLNG
HIS4_RHOPA       -----MILFPAIDLKNGQCVRLEQGDMARATVFNLDPAAQAQSFAA-QGFQYLHVVDLDG
HIS4_PSESM       -----MLIIPAIDLKDGACVRLRQGRMEDSTVFSDDPVAMAAKWVD-GGCRRLHLVDLNG
HIS4_RALSO       -----MLLIPAIDLKDGQCVRLKQGDMDQATVFSEDPAAMARHWVD-QGARRLHLVDLNG
HIS4_GEOSL       -----MIVIPAIDLKEGKCVRLEQGLMEKDTVFCDNPADQAREWER-QGAELLHIVDLDG
HIS4_HELHP       ---MALDIYPAIDLKEGKAVRLFKGDMQSATIYG-EALEFAKMFED-MGAKWLHIVDLDG
HIS4_WOLSU       -----MEIIPAIDLKEGQAVRLTKGLMESAKIYSDEPWRLAKSFEE-LGAKWLHIVDLNG
HIS4_BACHD       --MAKFIIYPAIDMRDGKCVRLVQGDYNQETVYGDSPFTMAKSFAE-QGAEWIHMVDLDG
HIS4_BACSU       --MSAFTLYPAIDMRNGKCVRLVQGDYNKETIYGDSPYDMAELFEK-EGAEWIHLVDLDG
HIS4_BIFLO       ---MSLTLLPAVDVRDGKAVRLRQGESGSETDYG-SPFEAARTWVE-AGAEWIHLVDLDA
HIS4_MYCPA       ----MLILLPAVDVVDGRAVRLVQGKAGSETEYG-SALDAALGWQR-DGAEWIHLVDLDA
HIS4_CHLTE       -----MLIIPAIDIKEGKCVRLTRGDFAQKKIYLDNPCDMAVIWRK-QNAKMIHVVDLDA
HIS4_BACCR       -----MEIFPAIDLKEGRCVRLYQGEFSKETVMNEDPVAQAIIFEK-LGAEILHIVDLDG
HIS4_LISMO       -----MQIFPAIDLKNGQCVRLFQGDFSKKTVVNEDPIAQAKAFAT-DGATYLHIVDLDG
HIS4_OCEIH       -----MIIFPAIDIRNGKCVRLRQGDYNQETIYSNSPVEMAKEWEA-SGAEYLHTVDLDG
HIS4_CLOAB       -----MIILPAIDIKQGKCVRLYQGRFEKSSVVAESPALTAKSFEN-DGAKYIHVVDLDG
HIS4_CALS4       -----MLVIPAIDILDGKCVRLTKGNFDSKEVYYDNPADMAKMWQE-CGAKRIHVVDLDG
HIS4_STAES       ----MIDLWPAIDLINSTSVRLTEGKYDTKEKMEKSVEDSIRFYSQFKCVKRIHIVDLIG
HIS4_BUCAI       ------MIIPAFDLINGRTVRLYQGDYSNQKNYNVNLFNSLEVYKS-KGIEIVHLVDLDG
HIS4_BUCAP       ------MIIPAFDLINGEIVRLYKGNFFNRTKYDINLYKRLKDYEI-KGVKKIHLVDLDG
HIS4_BLOFL       ------MIIPALDIINGDAVRLYQGKYQSQSHYG-NPYSILSTYVQ-QGATMIHLVDLDG
HIS4_BUCBP       ------MIIPSIDLIEGNIVRLYQGNYDTKTFYQNNIYDIALKYYN-QGAKIVHLVDLDG
HIS4_ECOLI       ------MIIPALDLIDGTVVRLHQGDYGKQRDYGNDPLPRLQDYAA-QGAEVLHLVDLTG
HIS41_PHOLL      ------MIIPALDLIDGKVVRLHQGDYAQQRDYQHDPLSHFQQYEQ-QGAKLLHLVDLTG
HIS4_VIBVY       ------MIIPALDLIEGQVVRLYQGDYGQVTEYKVDPAEQFNLYHQ-AGANWLHLVDLTG
HIS4_SHEON       ------MIIPAIDLIDGKVVRLYQGDYGQQTTFDLSPLAQLQSYQA-QDASWLHIVDLTG
HIS4_CAMJE       ----MTQIIPALDLIDGEVVRLVKGDYEQKKVYKYNPLKKFKEYEK-AGAKELHLVDLTG
HIS4_XYLFT       ---MNFIVYPALDIRNGAVVRLQQGDYARQTRYDDQVLPRAQAFAD-SGATWMHLVDLDA
HIS4_BACTN       ----MIEIIPAIDIIDGKCVRLSQGDYDSKKVYNENPVEVAKEFEA-NGVRRLHVVDLDG
HIS4_LACPL       ------MIFPAIDLRAGQSVRLYQGDFKQATLINPDPVVQAQQINA-AGLQQLHMVDLDG
HIS4_STRMU       -----MQILPAIDIKNGHAVRLVKGDFEQETVVNDNVLDQASIFME-AGIQYIHVVDLDG
HIS4_LACLA       -----MKIIPAIDLQNGEAVRLYKGDYDKKTVYSKNPLEIAQKFER-MGATDLHLVDLDG
HIS4_LEPIN       -----MIVIPAIDLFDNCAVRLFKGNYEEKKIYSSEPWKLAESFAK-NGATLLHLVDLNG
HIS4_AQUAE       -MNLKEFIIPAIDLMEGKAVRLYKGDFNKVKVYSERPWELAKNFSD-LGFKRLHVVDLEG
HIS4_PYRFU       ---MKFRIYPAIDIMDGKVVRLYKGKKDEVKVYG-DPLKFAEKFSE--YVDKIHIVDLDG
HIS4_SACS2       ----MNEIIPSIDISFGKAVKRIRGVRGT-GLVLGNPIELANKLYN-EGYSRIHVVDLDA
HIS4_SULTO       ----MLKVVPSIDISEGKAVKRIRGVKGS-GLILGNPVKIAYEIYE-EGYDYLHVVDLDS
HIS4_METJA       -----MIIIPAVDLKDKKCVQLIQGDPNKKHLELNNPVEVAKKFVD-EGAEYLHIIDLDA
HIS4_ARCFU       ----MFRVIPAIDLKDGKVVRLRQGKEDEVTFEATNPIEVAKQWVE-IGAKVLHVIDLSG
HIS4_METAC       ---MAFEVIPAVDMRGGKCVQLVQGVPGSEIVSLNDPLAVALDWIG-KGAKTLHLVDLDG
HIS4_METTH       -----MLIIPAVDIKDGKCVQLVQGKPGTEQVVLDDPAGVAGRWES-LGAETIHVVDLDG
HIS4_HALSA       MTFESFTVLPAVDMQDGQVVQLVQGERGTER-TYGDPVDAATDWVA-AGAEALHLVDLDG
HIS4_THEMA       -----MLVVPAIDLFRGKVARMIKGRKENTIFYEKDPVELVEKLIE-EGFTLIHVVDLSN
                        : *:.*:     .:  .*                           :* :**  

HIS4_NOSS1       AKAGKVVNLGAIEAI--AQAI---SIPIEIGGGLRDRSS-VEQVFNLGVQWAILGTVAVE
HIS4_SYNY3       AKEGQPVNLTAIANI--VEAL---TIPVQVGGGLRDRNR-VKQLLDLGVGRVILGTIAVE
HIS4_THEEB       AKTGEPRNYDLIGKI--VASL---EIPVQVGGGLRSRQA-VADLFLQGVNRAILGTVALE
HIS4_GLOVI       ARQGMPVHLDALEAI--VTQV---PCPVQFGGGLRSIEA-VSAVLDRGVDRVILGTAAVE
HIS4_PROMA       AKTGEPLNDSAIRKI--KEKL---SIPIQIGGGIRTIQR-AEDLIELGVDRVILGTIAIE
HIS4_SYNPX       AKRGEPVNDSAVQAI--TSAL---DIPVQLGGGVRSLER-AEQLLACGLDRVILGTVAIE
HIS4_PROMP       AKTGIPTNDQSIQKI--VKSV---NIPIQIGGGIRSLER-IKQLFSYGVDKVIMGTSAIE
HIS4_CAUVC       AIEGKSVNTAAVEQI--LESI---SIPVQLGGGIRTLEG-VEAWIEAGVSRVILGTVAVH
HIS4_RHOPA       AFAGKPMNAQAVEAM--LKVV---SMPVQLGGGIRDLKT-IEAWLSKGIARVIIGTAAVR
HIS4_PSESM       AFEGQPVNGDVVTAI-AKRYP---NLPIQIGGGIRSLET-IEHYIKAGVSYVIIGTKAVK
HIS4_RALSO       AFVGKPRNEAAIKAIIAEVGS---EIPVQLGGGIRDLNT-IERWLDDGLSYVIIGTAAVK
HIS4_GEOSL       AFAGEPKNRASIEAI--VKAI---AIPTQLGGGIRDIPT-IEAYLSLGIGRVILGTAAQR
HIS4_HELHP       AFAGIPQNLKYIEEI--LRTT---HLQIQIGGGIRNEER-IRLYMDLGVSRVILGSIAIK
HIS4_WOLSU       AFAGEPKNLESIRKI--RESC---NLKIELGGGIRDEAT-IKRYVELGVDRIILGSVAMK
HIS4_BACHD       AKAKERMNHEHVVKVATELD-----VNVQVGGGIRTAED-IAYYLDRGISRVILGSVAVN
HIS4_BACSU       AKEGKRVNDRHVIEIAQKLN-----LKVEIGGGIRSEND-VYEYLSAGVERVILGSSAVS
HIS4_BIFLO       AFG-TGNNRDQLREIVHELGD---RVNIELSGGVRDDAS-LDAALEAGAARVNIGTAALE
HIS4_MYCPA       AFG-RGSNRELLAEVVGKLD-----VRVELSGGIRDDDS-LAAALATGCARVNLGTAALE
HIS4_CHLTE       ALTGETVNFERIREIVNVLD-----IPIQVGGGIRSVEA-VEKYLDIGVSRVVIGSAAVT
HIS4_BACCR       AIAGESLNLPVIEKI--CKAV---RIPVQVGGGIRSLVT-VEKLLSAGVEKVILGTAALY
HIS4_LISMO       ALEGRPINLEVIQKM--KITA---KIPVQVGGGIRSMAQ-VDYYLESGIDRVIIGSAALT
HIS4_OCEIH       AKSGESNNINIIQDV--AQAL---SIPIQVGGGIRSLEV-IDKYIQAGVSRVILGTAAIT
HIS4_CLOAB       ALEGEIINLDAVKSI--VQVT---SVPIELGGGIRNIKV-VEKLINIGVKRIILGTAALK
HIS4_CALS4       ARQGHLVNRKVIEKI--VNSC---SVDIEVGGGIRNKEA-LDYLFSIGVSYIILGSAAIY
HIS4_STAES       AKAKEVKEFDYIRSL--RKVT---TKPIEVGGGIRSKQT-IENYIHSGIDYCIVGTKGIQ
HIS4_BUCAI       AKNSANRQIELFKKI--VSH---TTVPVQVGGGIRTTKD-ISTLLDLGVKRVVIGSSIVS
HIS4_BUCAP       AKNIKDRQIKVFRDI--ISY---TNIPIQIGGGIRNEED-INMFLNLGVKKVVIGSSAIK
HIS4_BLOFL       ARNPKNRQLSLIKEL--THTAITSHLKIQIGGGIRHATD-IKTLLKFGVNRVILGSIAIT
HIS4_BUCBP       ALCPNNKQTSLIKNL--LNY---FNFHIQVGGGIRSYKD-VETLLLNGAKRVVIGSSAIN
HIS4_ECOLI       AKDPAKRQIPLIKTL--VAG---VNVPVQVGGGVRSEED-VAALLEAGVARVVVGSTAVK
HIS41_PHOLL      AKDPSARQIPLLRKL--LAA---VSIPVQVGGGIRTEED-VKTLLDAGANRIVIGSIAIK
HIS4_VIBVY       AKDTTARQLDLIAKL--LAS---TPANIQIGGGVRTEQD-VIDLLEAGAQRVVVGSTAVK
HIS4_SHEON       AKDPAKRQTALIAAL--TAG---LSANIQVGGGIRTEEQ-VAELLSLGVKRVVIGSLAVK
HIS4_CAMJE       AKDPSKRQFALIEKL--AKE---VSVNLQVGGGIRSKEE-VKALLDCGVKRVVIGSMAIK
HIS4_XYLFT       AKAGGYTLAPLLRQI--TRA---TGLQVQTGGGVRSRDD-VARILDAGAARVVIGSLAVR
HIS4_BACTN       AASHHVVNHRVLEQI--ATR---TSLIVDFGGGVKSDED-LKIAFESGAQMVTGGSVAVK
HIS4_LACPL       AKSGRPENFATITAI--RQA---FTGTIELGGGIRTYEL-ATRYLELGIDRLILGSVALT
HIS4_STRMU       ALEGRAANRDLIAKI--KEM---TGLAIEVGGGIRTIEQ-IEDYLSVGINRVIIGSMAVK
HIS4_LACLA       AKIGQTRNLELVRKIKDETRL-----KIEIGGGIRDFDTVRMYLEQIGVERVILGTAAVE
HIS4_LEPIN       ARNQLGVNEDSILKIRETTSL-----KVQLGGGIRDKEK-LAYYDKIGINRFILGTAAVT
HIS4_AQUAE       AEGGKPKNLEVIRKIRENFEG-----EVEVGGGIRSYEV-AKALFDEGIDFVVIGTLAYK
HIS4_PYRFU       AFSGKPQNLDIVEKIIRDVGV-----RVQIGGGFRDYES-IKKAYDIGVENVIIGTKAL-
HIS4_SACS2       AE-GVGNNEMYIKEICKIGFD-----WIQVGGGIRDVEK-AKRLISLDVNALIFSTIVFT
HIS4_SULTO       AE-ENGNNEEYVKDICKIGFK-----WVQVGGGIRNVEK-AERLLDYDCSAIVISTLPIK
HIS4_METJA       AF-GTGNNRDVIKNIIKEVNV-----PVEVGGGIRNLEI-AKELISLGVDRVIVGTKAIL
HIS4_ARCFU       AFQGRLRHEEIIAEIAKMAE-------VQVGGGIRDFRV-AERLFELGVDRVIFGTIAVE
HIS4_METAC       AIEGERKNAPIIEKIVQACREK--GVSIQVGGGIRSFED-AASLLELGVSRIILGTAALQ
HIS4_METTH       AL-GLEKNTGILKEITERV-----SVPLQIGGGIRSREY-AGKLLDMGFERVILGTMAIE
HIS4_HALSA       AFEGARANATAVEDILDAT-----DVSVQVGGGIRSAED-ATALLDRGVDRVILGTAAIE
HIS4_THEMA       AIENSGENLPVLEKLSEFAEH------IQIGGGIRSLDY-AEKLRKLGYRRQIVSSKVLE
                 *          .  :             : .**.:            .      .:    

HIS4_NOSS1       QPQLVQELCQQYPGQ-IIIGIDAR-----NGLVATRGWLETSEVLATQLAIQMQEMGAAA
HIS4_SYNY3       NPDLVGELCAEFPGQ-IVVGIDAR-----NGKVATRGWLETSTVEAGELAQRMEKLGAAA
HIS4_THEEB       NPKLVASLAAEYPGR-IWVGLDAR-----DGYVATRGWLETSKILATDLAQNMAAMGVAG
HIS4_GLOVI       NPALIRECCERFGGR-IAVGLDAR-----GGQVAVRGWRETSEVEVTELAGEMEKLGVSA
HIS4_PROMA       NPNIIEKLSEKHPNK-IVVGIDAK-----EGKVATRGWTNNCEMDATELVKRFSQTNIAA
HIS4_SYNPX       QPDLVRSLAERYPGR-IVVGIDAK-----DGRVATRGWIEQSDVLATDLARTFSSSGIAA
HIS4_PROMP       NKELVKSLSTKFPSR-IIIGIDAK-----EGKVSTRGWLKQSDVLATELVQEFSSFKIAS
HIS4_CAUVC       DPELVKKAARLWPEQ-IAVAVDVR-----DGKVAVDGWTGLSDLSAIDLSRRFEDAGVAA
HIS4_RHOPA       DPALVKEAAKAFPGR-VAVGLDAR-----DGNVAVEGWAESSQVTALDIAQRFEDAGVAA
HIS4_PSESM       DPEFVAQACRAFPGK-VIVGLDAK-----DGFVATDGWAEVSTVQVIDLAKRFEADGVSA
HIS4_RALSO       NPGFLQDACTAFGGH-IIVGLDAR-----DGKVATDGWSKLTGHEVVDLARKYEDYGVES
HIS4_GEOSL       NPELVEEACRLFPGR-IVVGIDAK-----NGMVAVQGWAEVTGVTAVDLAKRFEGYGVAA
HIS4_HELHP       NWEFVKTMAHSYP---IAVGIDAR-----EGKVAVQGWAKESDICSSVLAEKFAGSEVQA
HIS4_WOLSU       NPEFVKEMASRYK---IAVGIDAK-----EGYVAAEGWAETGKVKATELAALFREVPLDA
HIS4_BACHD       NPAFTKEMLQKYGGEKIAIGLDAR-----DGYVATEGWLETSSVKAETLGQELARHGAEV
HIS4_BACSU       NPPFVKKMLKQYG-EKIAIGLDAR-----NGFVSTEGWLETSTLKATELGKELANEGAEV
HIS4_BIFLO       NPDWTASVIKKYG-DRVAVGLDVR-----GHTLAARGWTREGG-DLFETMKFLDSVGCSR
HIS4_MYCPA       NPQWCARAIGEHG-DKVAVGLDVQII-DGQHRLRGRGWETDGG-DLWEVLERLERQGCSR
HIS4_CHLTE       NPGLIADLLKKYRPSQIVVGIDAE-----HGVPKIKGWTESSNMQDYELAGEMKKLGVER
HIS4_BACCR       DKSFLEEAVRLYKEK-IIVGIDAK-----NGFVATRGWLDLSEISYVSLAKQMESLGVQT
HIS4_LISMO       DPDFLRAAVQKYGAK-IAAGIDAK-----NGFVATRGWLDVSQVSYLDLAKRMEKVGVET
HIS4_OCEIH       DSVFLQTAVESYAEK-IAVSIDAR-----NGFIATDGWTKNSTVEAIPFIKQLESIGVKT
HIS4_CLOAB       DKEFTREAIKEYGKS-IAVGIDAK-----DGYVAVNGWLNVSKINYIEFAKIMEDMGTED
HIS4_CALS4       DKDLLLYSVSHYGEK-TIVGIDSK-----KREVAVSGWLERTKIKDTELAEKIKEIGIKT
HIS4_STAES       DIEWLTHMTHQFPNK-LYLSVDAF-----GEKIKINGWKEDAKLNLFDYVAKIEHLPLGG
HIS4_BUCAI       NKKQVKQWLNFYGPDAIVLALDVHVDGSNKKEISIDGWQKKTNFILEEIIEYFLSSGLKH
HIS4_BUCAP       NKTKVKKWLKIYGPNVIILALDIIIK-NNNKEIAIHGWQETTNITLEEIIEYFSPIGLKH
HIS4_BLOFL       HPKKVKQWFTYFNPSSLVLALDIYIDSKNNRKVVIHGWQKETNIQLEEVIENYNSVGLKH
HIS4_BUCBP       NITEVEKWLLEFGYKSIVLALDVYVRNNGYKEVVINGWKNRSNVSLESVLERFSTLGIKY
HIS4_ECOLI       SQDMVKGWFERFGADALVLALDVRIDEQGNKQVAVSGWQENSGVSLEQLVETYLPVGLKH
HIS41_PHOLL      QPALVTQWFKRYGAENIVLALDVRINDTGMKQVAINGWQENSSVTLEQVIEQYLPCGLKY
HIS4_VIBVY       QPELVKGWMEKYGAEKIVLALDINIDQDGTRKVAISGWQEDSGVTIEALINDYLTVGLQH
HIS4_SHEON       EPELVKGWFNKFGNEAICLALDINITPSGEKIVAVSGWQNGGGKNLESIVEDFSQVGLKH
HIS4_CAMJE       DATLCLEILKEFGSEAIVLALDTILK--EDYVVAVNAWQEASDKKLMEVLDFYSNKGLKH
HIS4_XYLFT       QMTCVIEWLQAFGPERITVALDTRQDAGGVWRLPVHGWTEVAEATLEALAQQYAAAGLRH
HIS4_BACTN       DPELFCHWLEVYGSEKIILGADVKEH-----KIAVNGWKDESACELFPFLEDYINKGIQK
HIS4_LACPL       DPRLVKRLLSEFGGERIVIGLDGTNG-----YVAIKGWLEQSQTKMSTLMKTMTTSGAKH
HIS4_STRMU       HPQFVKEALDKFGSDKIVVGIDAKNG-----MVATEGWLETSTVDYISLALEMEKMGVRL
HIS4_LACLA       KPDFLKELLIKYGPSRIVVGVDIR-----EGFVSTSGWLEKTSLPYLSFLKKLERIGVKT
HIS4_LEPIN       NPDLLKYALDNYGKERVVVAVDAR-----DGIVKIAGWEKDSGIHYRDLLERLVKAGIEH
HIS4_AQUAE       NKEEFLKILENFPNR-VILAIDSK-----QGKVAIGGWKEETAVSPEEFAKEYENYPIWG
HIS4_PYRFU       DISFLERITSEFEG--ITVSLDSK-----GGKIFTKGWIEEESLLVEDAYKMLRKF-VNR
HIS4_SACS2       NFNLFYNIVREIGNNRVIVSIDYDDT----KRVLISGWKERSMEIIDGIKKVNELE-LLG
HIS4_SULTO       DPKSFMDIQKIIGKDKILLSVDYDSS----GYVLIRGWKEKSIKVLDFLLSYDSL----G
HIS4_METJA       EPKFIDDLNKEIGKDKIVLAVECKE-----GKVVIKGWKEKVDKTPIEVIKEFEDK-VGY
HIS4_ARCFU       RVEELREFAKKW-KGRVMVAIDSKK-----GRVAVKGWKEVVELTPVQLAELYDDL-DVS
HIS4_METAC       NPELVKQLSDAFGSSCVNVALDAKN-----GKISIKGWTEECAQTPVEMGREFEELGAGS
HIS4_METTH       NPAIVEELAGEYGSERIMVSLDSRD-----SRVVIRGWTEKVPFTAEEMARKFQERGAGS
HIS4_HALSA       TPDIVGEIAAAY-SDGVLVSLDAKD-----GEVVVEGWTEGTGMDPVAAAQRYADLGAAG
HIS4_THEMA       DPSFLKSLREIDVEP--VFSLDTR-----GGRVAFKGWLAEEEIDPVSLLKRLKEYGLEE
                                    . :              .*                      

HIS4_NOSS1       IIYTDIHRDGTLAGPNLDALRELAAAISIPVIASGGVSSVTDLLSLLA---LEPQGVTGV
HIS4_SYNY3       IIYTDIHRDGTMQGPNLDALRQLASQLTIPVIASGGVSQVEDLLNLLS---LESLGVNGV
HIS4_THEEB       FVYTDIQRDGTLQGPNIPALRQLLAVTNRPVIASGGVSSLNDILSLFA---LTPHGLVGA
HIS4_GLOVI       IVYTDILKDGTLTGPNLVELQRLTDAVKVPIIASGGVGTLADVLYLLA---LEPRGLQGV
HIS4_PROMA       IICTDISTDGTLMGPNLDFLRELALISTVPLIASGGIGSISDILSILP---LEQNGINGL
HIS4_SYNPX       IITTDIATDGTLAGPNLEALRTMAASSSVPVIASGGIGCMADLLSLLP---LEPLGVSGV
HIS4_PROMP       FIVTDINTDGTLEGTNEVFIKKILEITDIPVIASGGVGSISDLLSLTK---FEDSGLYGV
HIS4_CAUVC       LIITDISRDGALTGVNVEGVGELADAVSIPVIASGGVAAVADIERLKA---RQGVEIAGA
HIS4_RHOPA       IIFTDIARDGLLKGINWDATIALAEAISIPVIASGGLASIEDVRTLLS---PRAKKLEGA
HIS4_PSESM       IVYTDIAKDGMMQGCNIPFTAALAAATRIPVIASGGIHNLGDIQALLN---AKAPGIIGA
HIS4_RALSO       IIYTDIGRDGMLQGINIDATVKLAQSVSIPVIASGGLSSLKDIDHLCA---VESEGVEGV
HIS4_GEOSL       IIYTDIARDGMMQGPNIEATRALAEAISIPVIASGGVSSLKDIENLMA---IETSGIAGA
HIS4_HELHP       IICTDINRDGALSGINVSFTQDIACRSGIYTIASGGFASSNELEILD-----ENPYISGV
HIS4_WOLSU       IICTDISKDGTLEGINREFTQAIAEASGHYTIASGGLASEEEIPLLA-----QAKGVDGV
HIS4_BACHD       FIFTDISRDGMLSGPNTEAIVQLAKATGKQVIASGGVSSLQDLDALRN---EKQNGIAGA
HIS4_BACSU       FIFTDIATDGMLSGPNVKSTVELAKETGKSVIASGGVSSVADLEALAR---NEADGVSGA
HIS4_BIFLO       YVVTDVAKDGMMSGPNIQLLSEVAERTDAKVTASGGISKLDDLRAIKE---LAEIGVDSA
HIS4_MYCPA       YVVTDVTKDGTLGGPNLDLLGAVADRTDAPVIASGGVSSLDDLRAIAT---LTGRGVEGA
HIS4_CHLTE       IIYTDITRDGMLQGVGYETTKRFAEKAGMKVTASGGATTSDDLHKLRS---LEKYGVDSV
HIS4_BACCR       IVFTDISKDGTLAGPNFEQLAILQKSVGIRLIASGGVASIQDVKKLN------DMNIYGV
HIS4_LISMO       IIYTDISRDGTLTGPNLEQMANLKEHVKVNLIASGGVSSRADLEALA------QLGLYGA
HIS4_OCEIH       IIYTDILKDGMMSGPNFQELDAVQQATTMNIIASGGVTTEKDVQQLK------TMNLYGA
HIS4_CLOAB       IILTDISKDGTLKGPNFDMLKKLQENVNCNITASGGIKDLDDLIKLK------EMNIYGA
HIS4_CALS4       IIFTDISKDGTLHGPNFEALKDMLK-VGVEIIASGGISSIEDLKRLK------DMGVTGA
HIS4_STAES       VIYTDISKDGKLSGPNFDLTGRLALYTSLPVIASGGIRHQEDLFRLE------SLNVHAA
HIS4_BUCAI       VLCTDISRDGTLLGPNFKLYKEICSNFKNINFQASG--GVASLQDIIF---LKKTGVKSI
HIS4_BUCAP       VLCTDISKDGTLSGPNNILYKDIVKKFKHISFQASG--GVSRLKDLLS---LKKTGVKSV
HIS4_BLOFL       VLCTDISKDGTLLGSNINLYQSICYKWPKISFQASG--GVAKLTEILQ---LRSSGVNSI
HIS4_BUCBP       VLCTDVKKDGTCLGPNFTLYKNISKLFKNVCFQLSG--GIGTISDVIS---AKKSGIKDI
HIS4_ECOLI       VLCTDISRDGTLAGSNVSLYEEVCARYPQVAFQSSG--GIGDIDDVAA---LRGTGVRGV
HIS41_PHOLL      VLCTDISRDGTLTGSNVELYRAICQYYPQIVFQASG--GIGTLNDIAS---LPTSGVAGV
HIS4_VIBVY       VLCTDISRDGTLEGSNVELYVDLCKQYPQVQFQSSG--GIGSLADIEA---LKGSGVAGV
HIS4_SHEON       ALVTDISRDGTLTGANTELYCELSSRYPNIAWQASG--GIASLEDVAA---VRDSGAAGI
HIS4_CAMJE       ILCTDISKDGTMQGVNVRLYKLIHEIFPNICIQASG--GVASLKDLEN---LKGI-CSGV
HIS4_XYLFT       LLCTDIARDGMLSGPNMDVYAYLRALVPAVQIQVSG--GARDVADVVA---AKMAGCAGI
HIS4_BACTN       VICTDISCDGMLKGPSIDLYKEMLEKFPNLYLMASG--GVSNVDDIIA---LNEAGVPGV
HIS4_LACPL       FIVTDVARDGTMQGPNLALYQELQAQVPTANLIASG--GVRNLTDVQV---LQASGFKDV
HIS4_STRMU       LIYTDVDRDGTLTGPNFEHYEKLIAHLTSAKVIASG--GIHALSDLQQ---LEKIGVAGT
HIS4_LACLA       TIITDISKDGTLTGPNFKLYDEISKENSLNVIISGGVKDNSDIQR------ATRSDFYGI
HIS4_LEPIN       IVFTDIAQDGTLAGPNLEAYREILNSYPFQVIASGGIASLKDLMDLSSL--KTKISLYGV
HIS4_AQUAE       YLYTVIERDGSLEGVDVEPYKEIKKHVKKPVIASGGVSSLEDIKKLYG-------IVEGV
HIS4_PYRFU       FVYTVIDRDGTLLGIE----KIKRFWGDEEFIYAGGVATPTDIIQLAE------IGFSGV
HIS4_SACS2       IILTYVTNEGTVKGIDYSV-KDYAKLIRGVKEYAGGVSSDSDITFLKN------VGFDYI
HIS4_SULTO       YIFTYVENEGTKRGIDNNV-KNYVIRIKGLKEYAGGIGSIEDLYKLNE------YGINYA
HIS4_METJA       ILFTNVDVEGLLKGINVDIIKELIEKTDIPIIYSGGITTLEDIKALKE------LGIYGV
HIS4_ARCFU       FLYTNIDVEGLVSGIERERIEEVVKSLRNPVYVAGGISSIEDIRFAKR------VGAAGV
HIS4_METAC       LLFTNIDTEGLMQGVNPGPTRELVESVSIPVIASGGVSSLEDLKVLKQ------TGASGV
HIS4_METTH       ILFTNVDFEGLLSGFDLKPVSELVEAVEIPVIYSGGVSSLNDLRMLQG------TGVMGV
HIS4_HALSA       ILFTDVDVEGKQEGVRTDPVRDLVDSVDIPVIASGGVATVDDVRALEA------AGAAGA
HIS4_THEMA       IVHTEIEKDGTLQEHDFSLTKKIAIEAEVKVLAAGGISSENSLKTAQKVHTETNGLLKGV
                  : * :  :*                        .*      :                 

HIS4_NOSS1       IVGRALYTGDISLKEALQAIGPGRIQDIPPNLDFSSFA------
HIS4_SYNY3       IIGKALYTGDIQLAEAIRAVGNGRWQDVPP-LDFPRLG------
HIS4_THEEB       IVGKALYTKAMDLREAVRAVGQGRWQDIPPDLGSTTWA------
HIS4_GLOVI       IIGRALYTGDVDLAEALRAAGPSRWQDLPP--DDVAFA------
HIS4_PROMA       IIGRALYDGAFDLAEALKVVKNQDLQDIVNANKDQA--------
HIS4_SYNPX       IVGRALYDGRVDLAEAVRALAEPRLQDITAVAADLA--------
HIS4_PROMP       IVGKALYENKFTISEASNILSTERINDIPINKDYYA--------
HIS4_CAUVC       ILGRSLYAGTIKPSE--ALIAAAA--------------------
HIS4_RHOPA       IAGRALYDGRLDPTEALALIGAAKAA------------------
HIS4_PSESM       ITGRAIYEGTLDVAEAQALCDREQR-------------------
HIS4_RALSO       ICGRAIYSGDLNFREAQDHADKLGAA------------------
HIS4_GEOSL       ITGKAVYTGAINLAEAVALTKRGGA-------------------
HIS4_HELHP       IIGKAFYEGKINLKEALALFENKKVKI-----------------
HIS4_WOLSU       IVGKAFYEGRIDLGTLYKRLSGCLN-------------------
HIS4_BACHD       IVGKALYTNQFTLEDALKEES-----------------------
HIS4_BACSU       IIGKALYTNQFTLSEALERVKRK---------------------
HIS4_BIFLO       ILGKSLYARAFTLQEALEVAK-----------------------
HIS4_MYCPA       IVGKALYAGRFTLPQALAAVAE----------------------
HIS4_CHLTE       IIGKALYECNFPCQELWYAYEQGLGIDGEFSTARKKECCS----
HIS4_BACCR       IIGKALYEKTIDLEEVLQVTKLC---------------------
HIS4_LISMO       IAGKALYNHHISMSDIVEVEQIAY--------------------
HIS4_OCEIH       IIGKALYDGSIKLQDILEGEMDAR--------------------
HIS4_CLOAB       IVGKAIYSEKINLKEAIAVIEKR---------------------
HIS4_CALS4       IIGKALYTGMIDLKAALLELEREGI-------------------
HIS4_STAES       IVGKAAHLDEFWEGLS----------------------------
HIS4_BUCAI       IIGRSLLEKKFTIEEAVKCWQRES--------------------
HIS4_BUCAP       IIGRSLLENKFTIEEALKCWQSE---------------------
HIS4_BLOFL       IIGRSFLEKKFTLTEAISCWQNASSRV-----------------
HIS4_BUCBP       IIGRALLENKFSLLEAIRC-------------------------
HIS4_ECOLI       IVGRALLEGKFTVKEAIACWQNA---------------------
HIS41_PHOLL      IIGRALLDEKFTLKEAIQCWQNA---------------------
HIS4_VIBVY       IVGRALLDGKFTAEEAFACWQSE---------------------
HIS4_SHEON       IIGKALLINQFNVAEAIQCWPNE---------------------
HIS4_CAMJE       IVGKALLDGVFSVEEGIRCLAN----------------------
HIS4_XYLFT       VLGKALLEGRLALKEAVQHGSVADPGDPLPCGELTEPVCRYRSV
HIS4_BACTN       IFGKALYEGHITLKDLRIFL------------------------
HIS4_LACPL       IIGKALAEGGVTLAELAGVTEC----------------------
HIS4_STRMU       IVGKAYYNGDISLKELREFEG-----------------------
HIS4_LACLA       IVGKAYYEGKINLEKEFRNAN-----------------------
HIS4_LEPIN       ITGKALYEGKLDLAKAISSI------------------------
HIS4_AQUAE       VVGKAIYEGRITLEDLQNF-------------------------
HIS4_PYRFU       IIGKALYEGTISLEEALEVAKSVGKKNYSSS-------------
HIS4_SACS2       IVGMAFYLNKIRGTNVV---------------------------
HIS4_SULTO       IIGMSFYSGSLRGIKYVY--------------------------
HIS4_METJA       VIGSALYKGLIDLKKALEIVKN----------------------
HIS4_ARCFU       VIGSALYTKKLKFEEAIKVEYEKV--------------------
HIS4_METAC       VVGSALYTGRFTLEAAIETIRND---------------------
HIS4_METTH       VIGSAIYRGLIDLTEALKYQDLK---------------------
HIS4_HALSA       VVGTALYEGNFTLADAQAAVED----------------------
HIS4_THEMA       IVGRAFLEGILTVEVMKRYAR-----------------------
                 : * :     .