CLUSTAL format seed alignment for MF_01015

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y1145_VIBCH      MNIDVVLLLEQNPILLIFVVLAIGLSFGKIRFGSFQLGNSIGVLITSLIMGHLGFSFTPE
Y1915_VIBC3      MNIDVVLLLEQNPILLIFVVLAIGLSFGKIRFGSFQLGNSIGVLITSLIMGHLGFSFTPE
Y1232_VIBPA      MNIDVVQLLDQNPILLIFVVLAIGLAIGKIRFGNLQLGNSIGVLITSLIMGHLGFSFNAE
Y2636_VIBCB      MNIDVVHLLEQNPILLIFVVLAIGLAFGKIRFGKLQLGNSIGVLITSLVMGHLGFSFNAE
Y2828_VIBVU      MNIDVVLLLQQNPILLIFVVLAIGLAFGKVRIANMQLGNSIGVLITSLIMGHLGFSFNAE
Y1438_VIBVY      MNIDVVLLLQQNPILLIFVVLAIGLAFGKVRIANMQLGNSIGVLITSLIMGHLGFSFNAE
Y889_ALIF1       MNIDVATLLSQNDILLLFVVLALGLFIAKLRIGSFQLGSSIGVLITALFMGSLGYTFTAD
Y2420_PHOPR      MNIDVASLLHQNDILLLFVVLAVGLSFGKIRFAKMQVGNSIGVLLTAILFGNAGFTFNTE
Y1357_YERPS      MNINVANLLNGNYILLLFVVLALGLCLGKLRLGSIQLGNAIGVLVVSLLLGQQHFAINTE
Y1478_YERE8      MNINVANLLNGNYILLLFVVLALGLCLGKLRLGPIQLGNAIGVLVVSLLLGQQHFTINTE
Y1326_YERPE      MNINVANLLNGNYILLLFVVLALGLCLGKLRLGSIQLGNAIGVLVVSLLLGQQHFAINTE
Y2370_YERPP      MNINVANLLNGNYILLLFVVLALGLCLGKLRLGSIQLGNAIGVLVVSLLLGQQHFAINTE
Y2649_YERP3      MNINVANLLNGNYILLLFVVLALGLCLGKLRLGSIQLGNAIGVLVVSLLLGQQHFAINTE
Y2653_YERPN      MNINVANLLNGNYILLLFVVLALGLCLGKLRLGSIQLGNAIGVLVVSLLLGQQHFAINTE
Y617_YERPA       MNINVANLLNGNYILLLFVVLALGLCLGKLRLGSIQLGNAIGVLVVSLLLGQQHFAINTE
Y2683_PECAS      MNINVADLLNGNYILLLFVVLSLGLCLGKLRLGPVQLGNSIGVLVVSLLLGQQHFSINTE
YBJL_ECOLI       MNINVAELLNGNYILLLFVVLALGLCLGKLRLGSIQLGNSIGVLVVSLLLGQQHFSINTD
YBJL_ECO24       MNINVAELLNGNYILLLFVVLALGLCLGKLRLGSIQLGNSIGVLVVSLLLGQQHFSINTD
YBJL_ECOUT       MNINVAELLNGNYILLLFVVLALGLCLGKLRLGSIQLGNSIGVLVVSLLLGQQHFSINTD
YBJL_SHIF8       MNINVAELLNGNYILLLFVVLALGLCLGKLRLGSIQLGNSIGVLVVSLLLGQQHFSINTD
YBJL_SHIBS       MNINVAELLNGNYILLLFVVLALGLCLGKLRLGSIQLGNSIGVLVVSLLLGQQHFSINTD
YBJL_ECOL5       MNINVAELLNGNYILLLFVVLALGLCLGKLRLGSIQLGNSIGVLVVSLLLGQQHFSINTD
YBJL_SHIFL       MNINVAELLNGNYILLLFVVLALGLCLGKLRLGSIQLGNSIGVLVVSLLLGQQHFSINTD
YBJL_ECOHS       MNINVAELLNGNYILLLFVVLALGLCLGKLRLGSIQLGNSIGVLVVSLLLGQQHFSINTD
YBJL_ECOK1       MNINVAELLNGNYILLLFVVLALGLCLGKLRLGSIQLGNSIGVLVVSLLLGQQHFSINTD
YBJL_ECOL6       MNINVAELLNGNYILLLFVVLALGLCLGKLRLGSIQLGNSIGVLVVSLLLGQQHFSINTD
YBJL_SHISS       MNINVAELLNGNYILLLFVVLTLGLCLGKLRLGSIQLGNSIGVLVVSLLLGQQHFSINTD
YBJL_ECO57       MNINVAELLNGNYILLLFVVLALGLCLGKLRLGSIQLGNSIGVLVVSLLLGQQHFSINTD
YBJL_SHIDS       MNINVAELLNGNYILLLFVVLALGLCLGKLRLGSIQLGNSIGVLVVSLLLGQQHFSINTD
YBJL_SALPA       MNINVADLLNGNYILLLFVVLALGLCLGKLRLGSVQLGNSIGVLVVSLLLGQQHFSINTD
YBJL_SALTY       MNINVADLLNGNYILLLFVVLALGLCLGKLRLGSVQLGNSIGVLVVSLLLGQQHFSINTD
YBJL_SALTI       MNINVADLLNGNYILLLFVVLALGLCLGKLRLGSVQLGNSIGVLVVSLLLGQQHFSINTD
YBJL_SALCH       MNINISDLLNGNYILLLFVVLALGLCLGKLRLGSVQLGNSIGVLVVSLLLGQQHFSINTD
Y2260_CITK8      MNINVADLLNGNYILLLFVVLALGLCLGKLRLGSVQLGNSIGVLVVSLLLGQQHFSINTD
Y2488_CROS8      MNINVADLLNGNYILLLFVVLALGLCLGKLRLGSVQLGNSIGVLVVSLLLGQQHFSINTD
Y853_KLEP7       MNINVADLLNGNYILLLFVVLALGLCLGKLRLGSVQLGNSIGVLVVSLLLGQQHFAINTD
Y1362_ENT38      MNINVADLLNGNYILLLFVVLALGLCLGKLRLGSVQLGNSIGVLVVSLLLGQQHFSINTD
Y1639_SERP5      MNINVASLLNGNYILLLFVVLALGLCLGKVRLGSVQLGNSIGVLVVSLLLGQQHFAINTE
Y2450_AERHH      MTIDFVTLLHQSDSLLLFVVLAFGLLLGKVRFGNFQIGNTIGVLFTALLFGQMGFEFTAT
Y2308_AERS4      MTIDFVTLLHQSDSLLLFVVLAFGLLLGKVRLGNFQIGNTIGVLFTALLFGQMGFEFTAT
                 *.*:.  **  .  **:****:.** :.*:*:. .*:*.:****..::.:*   : :.. 

Y1145_VIBCH      ALTIGFMLFIYCVGIEAGPNFFGIFFRDGKHYLILSLVVLITATWIAYFGGYYLNLDYGL
Y1915_VIBC3      ALTIGFMLFIYCVGIEAGPNFFGIFFRDGKHYLILSLVVLITATWIAYFGGYYLNLDYGL
Y1232_VIBPA      ALTIGFMLFIYCVGIEAGPNFFGIFFRDGKHYFILSMTVLVAAVSLTYGLSHYFGLDFGL
Y2636_VIBCB      ALTIGFMLFIYCVGIEAGPNFFGIFFRDGKHYFILSMTVLVSAVGLTYFCSHYMGLDFGL
Y2828_VIBVU      ALTIGFMLFIYCVGIEAGPNFFGIFFRDGKHYFTLSMVVLVTAVSISYFASHYMGLDFGL
Y1438_VIBVY      ALTIGFMLFIYCVGIEAGPNFFGIFFRDGKHYFTLSMVVLVTAVSISYFASHYMGLDFGL
Y889_ALIF1       SLNIGFMLFIFCVGIEAGPNFFGIFLRDGKHYLLLVLVVLVSAVSLSFLTGHYFGLDYGL
Y2420_PHOPR      ALNIGFMLFIFCVGIEAGPNFFGIFFRDGKHYLLLALVVLLSAIAITLAMTHYLGLDIGL
Y1357_YERPS      ALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSAMILALGLGKLFGWDIGL
Y1478_YERE8      ALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSAMVLALGLGKLFGWDIGL
Y1326_YERPE      ALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSAMILALGLGKLFGWDIGL
Y2370_YERPP      ALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSAMILALGLGKLFGWDIGL
Y2649_YERP3      ALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSAMILALGLGKLFGWDIGL
Y2653_YERPN      ALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSAMILALGLGKLFGWDIGL
Y617_YERPA       ALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSAMILALGLGKLFGWDIGL
Y2683_PECAS      ALSLGFMLFIFCVGVEAGPNFFSIFFRDGKNYFMLALVMVGSAMLLALGLGKLFGWGIGL
YBJL_ECOLI       ALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSALVIALGLGKLFGWDIGL
YBJL_ECO24       ALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSALVIALGLGKLFGWDIGL
YBJL_ECOUT       ALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSALVIALGLGKLFGWDIGL
YBJL_SHIF8       ALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSALVIALGLGKLFGWDIGL
YBJL_SHIBS       ALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSALVIALGLGKLFGWDIGL
YBJL_ECOL5       ALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSALVIALGLGKLFGWDIGL
YBJL_SHIFL       ALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSALVIALGLGKLFGWDIGL
YBJL_ECOHS       ALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSALVIALGLGKLFGWDIGL
YBJL_ECOK1       ALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSALVIALGLGKLFGWDIGL
YBJL_ECOL6       ALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSALVIALGLGKLFGWDIGL
YBJL_SHISS       ALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSALVIALGLGKLFGWDIGL
YBJL_ECO57       ALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSALVIALGLGKLFGWDIGL
YBJL_SHIDS       ALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSALVIALGLGKLFGWDIGL
YBJL_SALPA       ALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSALLIALGLGKLFGWDIGL
YBJL_SALTY       ALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSALLIALGLGKLFGWDIGL
YBJL_SALTI       ALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSALLIALGLGKLFGWDIGL
YBJL_SALCH       ALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSALLIALGLGKLFGWDIGL
Y2260_CITK8      ALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSALLIALGLGKLFGWDIGL
Y2488_CROS8      ALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSALLIALGLGRAFGWDIGL
Y853_KLEP7       ALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSAMLIAMVLGKVFGWDIGL
Y1362_ENT38      ALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSALIIALGLGKLFGWDIGL
Y1639_SERP5      ALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSAMVIAIGLGKLFHWDIGL
Y2450_AERHH      TENVGFMLFIFCVGIEAGPHFFSVFLRDGIHYITLTLVILLTALFLTVGLAKFFNLGPGM
Y2308_AERS4      TENVGFMLFIFCVGIEAGPHFFSVFLRDGIHYITLTLVILLTALLLTVGLAKFFNLGPGM
                 : .:******:***:****:**.:*:*** :*: * :.:: :*  ::      :  . *:

Y1145_VIBCH      AAGMMAGALTSTPVLVGAQDALNSGLAAVPRHMDLSLILDNVSVGYAMAYLIGLISMIMF
Y1915_VIBC3      AAGMMAGALTSTPVLVGAQDALNSGLAAVPRHMDLSLILDNVSVGYAMAYLIGLISMIMF
Y1232_VIBPA      SAGMMAGALTATPVLVGAQDALNSGLATIPRNMDFSLVLENLSVGYAMAYLIGLISMIMF
Y2636_VIBCB      SAGMMAGALTATPVLVGAQDALNSGLATIPRNMDFSLVLENLSVGYAMAYLVGLISMIMF
Y2828_VIBVU      SAGMMAGALTATPVLVGAQDALNSGLATIPRNMEFSLVLENLSVGYAMAYLVGLISMIMF
Y1438_VIBVY      SAGMMAGALTATPVLVGAQDALNSGLATIPRNMEFSLVLENLSVGYAMAYLVGLISMIMF
Y889_ALIF1       STGMMAGALTATPVLVGAKDALNSGLAALPEGVDFSKVIDNLSVGYAFSYLIGLTSLILL
Y2420_PHOPR      ATGLMAGSLTATPVLVGAKDALNSGLSGISDPDIIKQTIDSLSVGYAMSYLMGLISLIFL
Y1357_YERPS      TAGMLAGSMTSTPVLVGAGDTLRHTMANGSS---LQQAQDNLSLGYALTYLIGLVSLILG
Y1478_YERE8      TAGMLAGSMTSTPVLVGAGDTLRHTIANNPA---LQHAQDNLSLGYALTYLIGLVSLILG
Y1326_YERPE      TAGMLAGSMTSTPVLVGAGDTLRHTMANGSS---LQQAQDNLSLGYALTYLIGLVSLILG
Y2370_YERPP      TAGMLAGSMTSTPVLVGAGDTLRHTMANGSS---LQQAQDNLSLGYALTYLIGLVSLILG
Y2649_YERP3      TAGMLAGSMTSTPVLVGAGDTLRHTMANGSS---LQQAQDNLSLGYALTYLIGLVSLILG
Y2653_YERPN      TAGMLAGSMTSTPVLVGAGDTLRHTMANGSS---LQQAQDNLSLGYALTYLIGLVSLILG
Y617_YERPA       TAGMLAGSMTSTPVLVGAGDTLRHTMANGSS---LQQAQDNLSLGYALTYLIGLVSLILG
Y2683_PECAS      TAGMLAGSMTSTPVLVGAGDTLRNTASLGGQ---LGVEQDHLSLGYALTYLVGLVSLIFG
YBJL_ECOLI       TAGMLAGSMTSTPVLVGAGDTLRHSGMESRQ---LSLALDNLSLGYALTYLIGLVSLIVG
YBJL_ECO24       TAGMLAGSMTSTPVLVGAGDTLRHFGMESRQ---LSLALDNLSLGYALTYLIGLVSLIVG
YBJL_ECOUT       TAGMLAGSMTSTPVLVGAGDTLRHSGMESRQ---LSLALDNLSLGYALTYLIGLVSLIVG
YBJL_SHIF8       TAGMLAGSMTSTPVLVGAGDTLHHSGMESRQ---LSLALDNLSLGYALTYLIGLVSLIVG
YBJL_SHIBS       TAGMLAGSMTSTPVLVGAGDTLRHSGMESRQ---LSLALDNLSLGYALTYLIGLVSLIVG
YBJL_ECOL5       TAGMLAGSMTSTPVLVGAGDTLRHSGMESRQ---LSLALDNLSLGYALTYLIGLVSLIVG
YBJL_SHIFL       TAGMLAGSMTSTPVLVGAGDTLHHSGMESRQ---LSLALDNLSLGYALTYLIGLVSLIVG
YBJL_ECOHS       TAGMLAGSMTSTPVLVGAGDTLRHSGMESRQ---LSLALDNLSLGYALTYLIGLVSLIVG
YBJL_ECOK1       TAGMLAGSMTSTPVLVGAGDTLRHSGMESRQ---LSLALDNLSLGYALTYLIGLVSLIVG
YBJL_ECOL6       TAGMLAGSMTSTPVLVGAGDTLRHSGMESRQ---LSLALDNLSLGYALTYLIGLVSLIVG
YBJL_SHISS       TAGMLAGSMTSTPVLVGAGDTLRHSGMESRQ---LSLALDNLSLGYALTYLIGLVSLIVG
YBJL_ECO57       TAGMLAGSMTSTPVLVGAGDTLRHSGMESRQ---LSLALDNLSLGYALTYLIGLVSLIVG
YBJL_SHIDS       TAGMLAGSMTSTPVLVGAGDTLRHSGMESRQ---LSLALDNLSLGYALTYLIGLVSLIVG
YBJL_SALPA       TAGMLAGSMTSTPVLVGAGDTLRHSGIASTQ---LSSALDNLSLGYALTYLIGLVSLIVG
YBJL_SALTY       TAGMLAGSMTSTPVLVGAGDTLRHSGIASTQ---LSSALDNLSLGYALTYLIGLVSLIVG
YBJL_SALTI       TAGMLAGSMTSTPVLVGAGDTLRHSGIASTQ---LSSALDNLSLGYALTYLIGLVSLIVG
YBJL_SALCH       TAGMLAGSMTSTPVLVGAGDTLRHSGIASPQ---LSSALDNLSLGYALTYLIGLVSLIVG
Y2260_CITK8      TAGMLAGSMTSTPVLVGAGDTLRHSGMESSQ---LSVALDNLSLGYALTYLIGLVSLIVG
Y2488_CROS8      TAGMLAGSMTSTPVLVGAGDTLRHAGMEGAQ---LAQALDHLSLGYALTYLIGLVSLIFG
Y853_KLEP7       TAGMLAGAMTSTPVLVGAGDTLRHFGLPSDQ---LAQSLDHLSLGYALTYLVGLVSLIVG
Y1362_ENT38      TAGMLAGSMTSTPVLVGAGDTLRHSGMEGSQ---LSVALDHLSLGYALTYLIGLVSLIVA
Y1639_SERP5      TAGMLAGSMTSTPVLVGAGDTLRNTITNGPA---LLAAQDHLSLGYALTYLIGLVSLIFG
Y2450_AERHH      AAGILAGSLTSTPALVGAQDALRSGLLNLPHQTDMQSVLDNMGIGYALTYLVGLVGLMLV
Y2308_AERS4      AAGILAGSLTSTPALVGAQDALRSGLLNLPHKTDMQSVLDNMGIGYALTYLVGLVGLMLV
                 ::*::**::*:**.**** *:*.           :    : :.:***::**:** .::. 

Y1145_VIBCH      AKLLPKLQKQNLSDSAQQIAQERGLG--SQRKVYLPIIRAYRVGPELINWIDGRNLRELG
Y1915_VIBC3      AKLLPKLQKQNLSDSAQQIAQERGLG--SQRKVYLPIIRAYRVGPELINWIDGRNLRELG
Y1232_VIBPA      AKLLPKLQKQNLSDSAQQIAQERGLGNSSQRKVYLPIIRAYRVGPELIDWTDGKNLRELG
Y2636_VIBCB      AKLLPKLQKQNLSDSAQQIAQERGLGNSSQRKVYLPIIRAYRVGPELIDWTDGKNLRELG
Y2828_VIBVU      AKLLPRLQKQNLSDSAQQIAQERGLGGSGQRKVYLPIIRAYRVGPELINWTDGKNLRELG
Y1438_VIBVY      AKLLPRLQKQNLSDSAQQIAQERGLGGSGQRKVYLPIIRAYRVGPELINWTDGKNLRELG
Y889_ALIF1       ARLLPKLQKQNLQDSAMQIAQERGIGSAGQRKVYLPIIRAYRVGQELIDWTDGKNLRELG
Y2420_PHOPR      AKLMPKLQKQDLAESSQQIARERGIGEVGQRKVYLPIIRAYRVGPELINWIDSRNLRELG
Y1357_YERPS      ARYLPKLQHQDLPTSAQQIARERGLDTDSQRKVYLPVIRAYRVGPELVAWADGKNLRELG
Y1478_YERE8      ARYLPKLQHQDLPTSAQQIARERGLDTDSQRKVYLPVIRAYRVGPELVAWADGKNLRELG
Y1326_YERPE      ARYLPKLQHQDLPTSAQQIARERGLDTDSQRKVYLPVIRAYRVGPELVAWADGKNLRELG
Y2370_YERPP      ARYLPKLQHQDLPTSAQQIARERGLDTDSQRKVYLPVIRAYRVGPELVAWADGKNLRELG
Y2649_YERP3      ARYLPKLQHQDLPTSAQQIARERGLDTDSQRKVYLPVIRAYRVGPELVAWADGKNLRELG
Y2653_YERPN      ARYLPKLQHQDLPTSAQQIARERGLDTDSQRKVYLPVIRAYRVGPELVAWADGKNLRELG
Y617_YERPA       ARYLPKLQHQDLPTSAQQIARERGLDTDSQRKVYLPVIRAYRVGPELVAWADGKNLRELG
Y2683_PECAS      ARYLPKLQHQDLPTSAQQIARERGLDVDSQRKVYLPVIRAYRVGPELVDWAAGKNLRELG
YBJL_ECOLI       ARYLPKLQHQDLQTSAQQIARERGLDTDANRKVYLPVIRAYRVGPELVAWTDGKNLRELG
YBJL_ECO24       ARYLPKLQHQDLQTSAQQIARERGLDTDANRKVYLPVIRAYRVGPELVAWTDGKNLRELG
YBJL_ECOUT       ARYLPKLQHQDLQTSAQQIARERGLDTDANRKVYLPVIRAYRVGPELVAWTDGKNLRELG
YBJL_SHIF8       ARYLPKLQHQDLQTSAQQIARERGLDTDANRKVYLPVIRAYRVGPELVAWTDGKNLRELG
YBJL_SHIBS       ARYLPKLQHQDLQTSAQQIARERGLDTDANRKVYLPVIRAYRVGPELVAWTDGKNLRELG
YBJL_ECOL5       ARYLPKLQHQDLQTSAQQIARERGLDTDANRKVYLPVIRAYRVGPELVAWTDGKNLRELG
YBJL_SHIFL       ARYLPKLQHQDLQTSAQQIARERGLDTDANRKVYLPVIRAYRVGPELVAWTDGKNLRELG
YBJL_ECOHS       ARYLPKLQHQDLQTSAQQIARERGLDTDANRKVYLPVIRAYRVGPELVAWTDGKNLRELG
YBJL_ECOK1       ARYLPKLQHQDLQTSAQQIARERGLDTDANRKVYLPVIRAYRVGPELVAWTDGKNLRELG
YBJL_ECOL6       ARYLPKLQHQDLQTSAQQIARERGLDTDANRKVYLPVIRAYRVGPELVAWTDGKNLRELG
YBJL_SHISS       ARYLPKLQHQDLQTSAQQIARERGLDTDANRKVYLPVIRAYRVGPELVAWTDGKNLRELG
YBJL_ECO57       ARYLPKLQHQDLQTSAQQIARERGLDTDANRKVYLPVIRAYRVGPELVAWTDGKNLRELG
YBJL_SHIDS       ARYLPKLQHQDLQTSAQQIARERGLDTDANRKVYLPVIRAYRVGPELVAWTDGKNLRELG
YBJL_SALPA       ARYLPKLQHQDLQTSAQQIARERGLDTDANRKVYLPVIRAYRVGPELVAWTDGKNLRELG
YBJL_SALTY       ARYLPKLQHQDLQTSAQQIARERGLDTDANRKVYLPVIRAYRVGPELVAWTDGKNLRELG
YBJL_SALTI       ARYLPKLQHQDLQTSAQQIARERGLDTDANRKVYLPVIRAYRVGPELVAWTDGKNLRELG
YBJL_SALCH       ARYLPKLQHQDLQTSAQQIARERGLDTDANRKVYLPVIRAYRVGPELVAWTDGKNLRELG
Y2260_CITK8      ARYLPKLQHQDLQTSAQQIARERGLDTDANRKVYLPVIRAYRVGPELVAWADGKNLRELG
Y2488_CROS8      ARYLPKLQHQDLQTSAQQIARERGLDTDANRKVYLPVIRAYRVGPELVAWADGKNLRELG
Y853_KLEP7       ARYMPKLQHQDLQTSAQQIARERGLDTDSKRKVYLPVIRAYRVGPELVAWADGKNLRELG
Y1362_ENT38      ARYLPKLQHQDLQTSAQQIARERGLDTDTKRKVYLPVIRAYRVGPELVAWADGKNLRELG
Y1639_SERP5      ARYLPKLQHQDLSTSAQQIARERGLDTDSQRKVYLPVIRAYRVGPELVAWADGKNLRELG
Y2450_AERHH      VRYLPSLARLDLNTEAQKIARERGLSDNESRKTYLPIIRAYRVGPELAAWIGGRTLRETG
Y2308_AERS4      VRYLPSLARLDLSTEAQKIARERGLSDNESRKTYLPIIRAYRVGPELAAWIGGRTLRETG
                 .: :* * : :*  .: :**:***:.   .**.***:******* **  *  .:.*** *

Y1145_VIBCH      IYRQTGCYIERIRRHGILAHPDGDAILQEGDEIALVGFPDSHARLDPSFRNGKEVFDRNL
Y1915_VIBC3      IYRQTGCYIERIRRHGILAHPDGDAILQEGDEIALVGFPDSHARLDPSFRNGKEVFDRNL
Y1232_VIBPA      IYRQTGCYIERIRRNGILAHPDGDAILQEGDEIALVGFPDSHARLDPSFRNGKEVFDRNL
Y2636_VIBCB      IYRQTGCYIERIRRNGILAHPDGDAILQEGDEIALVGFPDSHARLDPSFRNGKEVFDRNL
Y2828_VIBVU      IYRQTGCYIERIRRHGILAHPDGDAILQEGDEIALVGFPDSHARLDPSFRNGKEVFDRNL
Y1438_VIBVY      IYRQTGCYIERIRRHGILAHPDGDAILQEGDEIALVGFPDSHARLDPSFRNGKEVFDRNL
Y889_ALIF1       IHRQTGCHIERIRRNGILANPDGDYILQQGDEIALVGYPDSHARLDSSFRNGKEVFDRNL
Y2420_PHOPR      IYRQTGCYIERIRRNGILANPDGDAILQEGDEIALVGYPDSHARLDPSFRNGKEVFDRDL
Y1357_YERPS      IYRQTGCYIERIRRNGILANPDGDAVLQVGDEISLVGYPDAHSRLDPSFRNGKEVFDRDL
Y1478_YERE8      IYRQTGCYIERIRRNGILANPDGDAVLQVGDEISLVGYPDAHSRLDPSFRNGKEVFDRDL
Y1326_YERPE      IYRQTGCYIERIRRNGILANPDGDAVLQVGDEISLVGYPDAHSRLDPSFRNGKEVFDRDL
Y2370_YERPP      IYRQTGCYIERIRRNGILANPDGDAVLQVGDEISLVGYPDAHSRLDPSFRNGKEVFDRDL
Y2649_YERP3      IYRQTGCYIERIRRNGILANPDGDAVLQVGDEISLVGYPDAHSRLDPSFRNGKEVFDRDL
Y2653_YERPN      IYRQTGCYIERIRRNGILANPDGDAVLQVGDEISLVGYPDAHSRLDPSFRNGKEVFDRDL
Y617_YERPA       IYRQTGCYIERIRRNGILANPDGDAVLQVGDEISLVGYPDAHSRLDPSFRNGKEVFDRDL
Y2683_PECAS      IYRQTGCYIERIRRNGILANPDGDAVLQIGDEIALVGYPDAHSRLNSNFRDGKEVFDRNL
YBJL_ECOLI       IYRQTGCYIERIRRNGILANPDGDAVLQMGDEIALVGYPDAHARLDPSFRNGKEVFDRDL
YBJL_ECO24       IYRQTGCYIERIRRNGILANPDGDAVLQMGDEIALVGYPDAHARLDPSFRNGKEVFDRDL
YBJL_ECOUT       IYRQTGCYIERIRRNGILANPDGDAVLQMGDEIALVGYPDAHARLDPSFRNGKEVFDRDL
YBJL_SHIF8       IYRQTGCYIERIRRNGILANPDGDAVLQMGDEIALVGYPDAHARLDPSFRNGKEVFDRDL
YBJL_SHIBS       IYRQTGCYIERIRRNGILANPDGDAVLQMGDEIALVGYPDAHARLDPSFRNGKEVFDRDL
YBJL_ECOL5       IYRQTGCYIERIRRNGILANPDGDAVLQMGDEIALVGYPDAHARLDPSFRNGKEVFDRDL
YBJL_SHIFL       IYRQTGCYIERIRRNGILANPDGDAVLQMGDEIALVGYPDAHARLDPSFRNGKEVFDRDL
YBJL_ECOHS       IYRQTGCYIERIRRNGILANPDGDAVLQMGDEIALVGYPDAHARLDPSFRNGKEVFDRDL
YBJL_ECOK1       IYRQTGCYIERIRRNGILANPDGDAVLQMGDEIALVGYPDAHARLDPSFRNGKEVFDRDL
YBJL_ECOL6       IYRQTGCYIERIRRNGILANPDGDAVLQMGDEIALVGYPDAHARLDPSFRNGKEVFDRDL
YBJL_SHISS       IYRQTGCYIERIRRNGILANPDGDAVLQMGDEIALVGYPDAHARLDPSFRNGKEVFDRDL
YBJL_ECO57       IYRQTGCYIERIRRNGILANPDGDAVLQMGDEIALVGYPDAHARLDPSFRNGKEVFDRDL
YBJL_SHIDS       IYRQTGCYIERIRRNGILANPDGDAVLQMGDEIALVGYPDAHARLDPSFRNGKEVFDRDL
YBJL_SALPA       IYRQTGCYIERIRRNGILANPDGDAVLQMGDEIALVGYPDAHARLDPSFRNGKEVFDRDL
YBJL_SALTY       IYRQTGCYIERIRRNGILANPDGDAVLQMGDEIALVGYPDAHARLDPSFRNGKEVFDRDL
YBJL_SALTI       IYRQTGCYIERIRRNGILANPDGDAVLQMGDEIALVGYPDAHARLDPSFRNGKEVFDRDL
YBJL_SALCH       IYRQTGCYIERIRRNGILANPDGDAVLQMGDEIALVGYPDAHARLDPSFRNGKEVFDRDL
Y2260_CITK8      IYRQTGCYIERIRRNGILANPDGDAVLQMGDEIALVGYPDAHARLDPSFRNGKEVFDRDL
Y2488_CROS8      IYRQTGCYIERIRRNGILASPDGDAVLQMGDEIALVGYPDAHARLDPSFRNGKEVFDRDL
Y853_KLEP7       IYRQTGCYIERIRRNGILANPDGDAVLQMGDDIALVGYPDAHARLDPSFRNGKEVFDRDL
Y1362_ENT38      IYRQTGCYIERIRRNGILANPDGDAVLQMGDDIALVGYPDAHARLDPSFRNGKEVFDRDL
Y1639_SERP5      IYRQTGCYIERIRRNGILANPDGDAVLQVGDEISLVGYPDAHARLDPSFRNGKEVFDRDL
Y2450_AERHH      IYPHTGCYVERIRRNGILASPDGDAVIQEGDEIALVGYPESHEKLDVNYRNGKEVFDRNL
Y2308_AERS4      IYPHTGCYVERIRRNGILASPDGDAVIQEGDEIALVGYPESHEKLDVNYRNGKEVFDRNL
                 *: :***::*****:**** **** ::* **:*:***:*::* :*: .:*:*******:*

Y1145_VIBCH      LDLRISEEEIVVKSDSIAGKRLSDLNLSEYGCFLNRVVRAQIEMPMDLDIVLAKGDVLQV
Y1915_VIBC3      LDLRISEEEIVVKSDSIAGKRLSDLNLSEYGCFLNRVVRAQIEMPMDLDIVLAKGDVLQV
Y1232_VIBPA      LDLRIVEEEIVVKSDAIAGKRLSDLNLSEFGCFLNRVVRAQIEMPMDLDIVLAKGDVLQV
Y2636_VIBCB      LDLRIVEEEIVVKSDAIAGKRLSDLNLSEFGCFLNRVVRAQIEMPMDLDIVLAKGDVLQV
Y2828_VIBVU      LDLRIVEEEIVVKSDAIAGKRLSDLNLSEYGCFLNRVIRAQIEMPMDLDIVLAKGDILQV
Y1438_VIBVY      LDLRIVEEEIVVKSDAIAGKRLSDLNLSEYGCFLNRVIRAQIEMPMDLDIVLAKGDILQV
Y889_ALIF1       LDLRIAEEEIVVKSDNIAGKRLSELNLSEYGCFLNRVVRAQIEMPIEHDIVLAKGDILQV
Y2420_PHOPR      LDLRIVEEEIVVKNDNISGKRLSELNLSEYGCFLNRVVRAQIEMPMDHNILLNKGDILQV
Y1357_YERPS      LDMRIVTEEIVVKNSNAVGKRLSHLKLTDHGCFLNRVIRSQIEMPIDDNVVLNKGDVLQV
Y1478_YERE8      LDMRIVTEEIVVKNSNAVGKRLSHLKLTDHGCFLNRVIRSQIEMPIDDNVVLNKGDVLQV
Y1326_YERPE      LDMRIVTEEIVVKNSNAVGKRLSHLKLTDHGCFLNRVIRSQIEMPIDDNVVLNKGDVLQV
Y2370_YERPP      LDMRIVTEEIVVKNSNAVGKRLSHLKLTDHGCFLNRVIRSQIEMPIDDNVVLNKGDVLQV
Y2649_YERP3      LDMRIVTEEIVVKNSNAVGKRLSHLKLTDHGCFLNRVIRSQIEMPIDDNVVLNKGDVLQV
Y2653_YERPN      LDMRIVTEEIVVKNSNAVGKRLSHLKLTDHGCFLNRVIRSQIEMPIDDNVVLNKGDVLQV
Y617_YERPA       LDMRIVTEEIVVKNSNAVGKRLSHLKLTDHGCFLNRVIRSQIEMPIDDNVVLNKGDVLQV
Y2683_PECAS      LDMRIVTEEIVVKNHNAVGKRLSQLKLTDHGCFLNRIVRSQIEMPLDDNVVLNKGDVLQV
YBJL_ECOLI       LDMRIVTEEVVVKNHNAVGKRLAQLKLTDHGCFLNRVIRSQIEMPIDDNVVLNKGDVLQV
YBJL_ECO24       LDMRIVTEEVVVKNHNAVGKRLAQLKLTDHGCFLNRVIRSQIEMPIDDNVVLNKGDVLQV
YBJL_ECOUT       LDMRIVTEEVVVKNHNAVGKRLAQLKLTDHGCFLNRVIRSQIEMPIDDNVVLNKGDVLQV
YBJL_SHIF8       LDMRIVTEEVVVKNHNAVGKRLAQLKLTDHGCFLNRVIRSQIEMPIDDNVVLNKGDVLQV
YBJL_SHIBS       LDMRIVTEEVVVKNHNAVGKRLAQLKLTDHGCFLNRVIRSQIEMPIDDNVVLNKGDVLQV
YBJL_ECOL5       LDMRIVTEEVVVKNHNAVGKRLAQLKLTDHGCFLNRVIRSQIEMPIDDNVVLNKGDVLQV
YBJL_SHIFL       LDMRIVTEEVVVKNHNAVGKRLAQLKLTDHGCFLNRVIRSQIEMPIDDNVVLNKGDVLQV
YBJL_ECOHS       LDMRIVTEEVVVKNHNAVGKRLAQLKLTDHGCFLNRVIRSQIEMPIDDNVVLNKGDVLQV
YBJL_ECOK1       LDMRIVTEEVVVKNHNAVGKRLAQLKLTDHGCFLNRVIRSQIEMPIDDNVVLNKGDVLQV
YBJL_ECOL6       LDMRIVTEEVVVKNHNAVGKRLAQLKLTDHGCFLNRVIRSQIEMPIDDNVVLNKGDVLQV
YBJL_SHISS       LDMRIVTEEVVVKNHNAVGKRLAQLKLTDHGCFLNRVIRSQIEMPIDDNVVLNKGDVLQV
YBJL_ECO57       LDMRIVTEEVVVKNHNAVGKRLAQLKLTDHGCFLNRVIRSQIEMPIDDNVVLNKGDVLQV
YBJL_SHIDS       LDMRIVTEEVVVKNHNAVGKCLAQLKLTDHGCFLNRVIRSQIEMPIDDNVVLNKGDVLQV
YBJL_SALPA       LDMRIVTEEIVVKNHNAVGRRLAQLKLTDHGCFLNRVIRSQIEMPIDDNVVLNKGDVLQV
YBJL_SALTY       LDMRIVTEEIVVKNHNAVGRRLAQLKLTDHGCFLNRVIRSQIEMPIDDNVVLNKGDVLQV
YBJL_SALTI       LDMRIVTEEIVVKNHNAVGRRLAQLKLTDHGCFLNRVIRSQIEMPIDDNVVLNKGDVLQV
YBJL_SALCH       LDMRIVTEEIVVKNHNAVGRRLAQLKLTDHGCFLNRVIRSQIEMPIDDNVVLNKGDVLQV
Y2260_CITK8      LDMRIVTEEIVVKNHNAVGRRLAQLKLTDHGCFLNRVIRSQIEMPIDDNVVLNKGDVLQV
Y2488_CROS8      LDMRIVTEEIVVKNHNVVGRRLGQLKLTDHGCFLNRVIRSQIEMPIDDNIVLNKGDVLQV
Y853_KLEP7       LDMRIVTEEIVVKNHNAVGRRLAQLKLTDHGCFLNRVIRSQIEMPIDDNVVLNKGDVLQV
Y1362_ENT38      LDMRIVTEEIVVKNHNAVGRRLAQLKLTDHGCFLNRVIRSQIEMPIDDNVVLNKGDVLQV
Y1639_SERP5      LDMRIVTEEIVVKNSNAVNKRLSQLKLTDHGCFLNRVIRSQIEMPIDDSIVLNKGDVLQV
Y2450_AERHH      LDLQIVTEEIVVKNDAVVGRHLVELNLTEKGCFLNRVVRSQIEMPFDRNIMLQKGDVLQI
Y2308_AERS4      LDLQIVTEEIVVKNDGVVGRHLVELNLTEKGCFLNRVVRSQIEMPFDRNIMLQKGDVLQI
                 **::*  **:***.    .: * .*:*:: ******::*:*****:: .::* ***:**:

Y1145_VIBCH      SGEKSKVKGLADKIGFISVHSQMADLLAFCSFFILGILFGLVTMTFGQVSFSLGNAVGLL
Y1915_VIBC3      SGEKSKVKGLADKIGFISVHSQMADLLAFCSFFILGILFGLVTMTFGQVSFSLGNAVGLL
Y1232_VIBPA      SGEKSRVHGLAEKIGFISIHSQMADLLAFCSFFILGIMFGLVTMTFGQVSFSLGNAVGLL
Y2636_VIBCB      SGEKSRVHGLAEKIGFISIHSQMADLLAFCSFFILGIMFGLVTMTFGQVSFSLGNAVGLL
Y2828_VIBVU      SGEKSRVHGLAERIGFISIHSQIADLLAFCSFFILGIMFGLVTMTFGQVSFSLGNAVGLL
Y1438_VIBVY      SGEKSRVHGLAERIGFISIHSQIADLLAFCSFFILGIMFGLVTMTFGQVSFSLGNAVGLL
Y889_ALIF1       SGEKSKVHYLADKIGFISIHSQVSDLLAFCSFFILGIMFGMITMSFGQVTFGLGNAVGLL
Y2420_PHOPR      SGEKSRVLGLAERIGFISIHSQIADLLAFCCFFIIGLLIGSITLAFGHVAFGLGSAAGLL
Y1357_YERPS      SGDARRVKSVAEKIGFISIHSQVTDLLAFCSFFILGLMIGLITFQFSNFSFGIGNAAGLL
Y1478_YERE8      SGDARRVKSVAEKIGFISIHSQVTDLLAFCAFFILGLMIGLITFQFSNFSFGIGNAAGLL
Y1326_YERPE      SGDARRVKSVAEKIGFISIHSQVTDLLAFCSFFILGLMIGLITFQFSNFSFGIGNAAGLL
Y2370_YERPP      SGDARRVKSVAEKIGFISIHSQVTDLLAFCSFFILGLMIGLITFQFSNFSFGIGNAAGLL
Y2649_YERP3      SGDARRVKSVAEKIGFISIHSQVTDLLAFCSFFILGLMIGLITFQFSNFSFGIGNAAGLL
Y2653_YERPN      SGDARRVKSVAEKIGFISIHSQVTDLLAFCSFFILGLMIGLITFQFSNFSFGIGNAAGLL
Y617_YERPA       SGDARRVKSVAEKIGFISIHSQVTDLLAFCSFFILGLMIGLITFQFSNFSFGIGNAAGLL
Y2683_PECAS      SGDARRVKSIAERIGFISIHSQVTDLLAFCAFFVIGVMVGLITIQFSNFTFGIGNAAGLL
YBJL_ECOLI       SGDARRVKTIADRIGFISIHSQVTDLLAFCAFFVIGLMIGMITFQFSTFSFGMGNAAGLL
YBJL_ECO24       SGDARRVKTIADRIGFISIHSQVTDLLAFCAFFVIGLMIGMITFQFSTFSFGMGNAAGLL
YBJL_ECOUT       SGDARRVKTIADRIGFISIHSQVTDLLAFCAFFVIGLMIGMITFQFSTFSFGMGNAAGLL
YBJL_SHIF8       SGDARRVKTIADRIGFISIHSQVTDLLAFCAFFVIGLMIGMITFQFSTFSFGMGNAAGLL
YBJL_SHIBS       SGDARRVKTIADRIGFISIHSQVTDLLAFCAFFVIGLMIGMITFQFSTFSFGMGNAAGLL
YBJL_ECOL5       SGDARRVKTIADRIGFISIHSQVTDLLAFCAFFVIGLMIGMITFQFSTFSFGMGNAAGLL
YBJL_SHIFL       SGDARRVKTIADRIGFISIHSQVTDLLAFCAFFVIGLMIGMITFQFSTFSFGMGNAAGLL
YBJL_ECOHS       SGDARRVKTIADRIGFISIHSQVTDLLAFCAFFVIGLMIGMITFQFSTFSFGMGNAAGLL
YBJL_ECOK1       SGDARRVKTIADRIGFISIHSQVTDLLAFCAFFVIGLMIGMITFQFSTFSFGMGNAAGLL
YBJL_ECOL6       SGDARRVKTIADRIGFISIHSQVTDLLAFCAFFVIGLMIGMITFQFSTFSFGMGNAAGLL
YBJL_SHISS       SGDARRVKTIADRIGFISIHSQVTDLLAFCAFFVIGLMIGMITFQFSTFSFGMGNAAGLL
YBJL_ECO57       SGDARRVKTIADRIGFISIHSQVTDLLAFCAFFVIGLMIGMITFQFSTFSFGMGNAAGLL
YBJL_SHIDS       SGDARRVKTIADRIGFISIHSQVTDLLAFCAFFVIGLMIGMITFQFSTFSFGMGNAAGLL
YBJL_SALPA       SGDARRVKTIADRIGFISIHSQVTDLLAFCAFFIIGLMIGMITFQFSNFSFGIGNAAGLL
YBJL_SALTY       SGDARRVKTIADRIGFISIHSQVTDLLAFCAFFIIGLMIGMITFQFSNFSFGIGNAAGLL
YBJL_SALTI       SGDARRVKTIADRIGFISIHSQVTDLLAFCAFFIIGLMIGMITFQFRNFSFGIGNAAGLL
YBJL_SALCH       SGDARRVKTIADRIGFISIHSQVTDLLAFCAFFIIGLMIGMITFQFSNFSFGIGNAAGLL
Y2260_CITK8      SGDARRVKTVADRIGFISIHSQVTDLLAFCAFFIIGLMIGMITFQFSNFSFGIGNAAGLL
Y2488_CROS8      SGDARRVKTIADRIGFISIHSQVTDLLAFCAFFIVGLMIGMITFQFSSFSFGIGNAAGLL
Y853_KLEP7       SGDARRVKTVADRIGFISIHSQVTDLLAFCAFFIVGLMIGMITFQFSSFSFGIGNAAGLL
Y1362_ENT38      SGDARRVKTVADRIGFISIHSQVTDLLAFCAFFIVGLMIGMITFQFSNFSFGVGNAAGLL
Y1639_SERP5      SGDARRVKSVAEKIGFISIHSQVTDLLAFCAFFIIGLLIGQITIQFSNFSFGIGNAAGLL
Y2450_AERHH      SGEKQRVKLLANKIGFISIHSQTTDLVAFTTFFVLGLLIGSVSLVFGQLEFGLGNAVGLL
Y2308_AERS4      SGEKQRVKLLANKIGFISIHSQTTDLVAFTTFFVLGLLIGSVSLVFGQLEFGLGNAVGLL
                 **:  :*  :*::*****:*** :**:**  **::*::.* ::: *  . *.:*.*.***

Y1145_VIBCH      LSGITLGFLRANHPTFGYVPQGALNMVKDLGLAIFMVGIGLNAGSKMFQHLSEVGVQVIG
Y1915_VIBC3      LSGITLGFLRANHPTFGYVPQGALNMVKDLGLAIFMVGIGLNAGSKMFQHLSEVGVQVIG
Y1232_VIBPA      LSGITLGFLRANHPTFGYVPQGALNMVKDLGLMFFMVGIGLSAGGKMFEHLTQVGPQVIG
Y2636_VIBCB      LSGITLGFLRANHPTFGYVPQGALNMVKDLGLMFFMVGIGLSAGGKIFEHLSQVGPQIIG
Y2828_VIBVU      LSGITLGFLRANHPTFGYVPQGALNMVKDLGLMIFMVGIGLSAGGKMFEHLTQVGPQIIG
Y1438_VIBVY      LSGITLGFLRANHPTFGYVPQGALNMVKDLGLMIFMVGIGLSAGGKMFEHLTQVGPQIIG
Y889_ALIF1       ISGITLGFLRANHPTFGYVPQGALNMTKNLGLLVFMVGIGLSAGGNINEYFSEDGLKVLA
Y2420_PHOPR      IAGITLGFLRANHPTFGYVPQGALNMAKDLGLMVFMVGIGLSAGSNLFDSFAHIGPMVLV
Y1357_YERPS      LAGIMLGFLRANHPTFGYIPQGALNMVKEFGLMVFMAGVGLSAGGGINSSLGAVGGQMLI
Y1478_YERE8      MAGIMLGFLRANHPTFGYIPQGALNMVKEFGLMVFMAGVGLSAGGGINSSLGAVGGQMLI
Y1326_YERPE      LAGIMLGFLRANHPTFGYIPQGALNMVKEFGLMVFMAGVGLSAGGGINSSLGAVGGQMLI
Y2370_YERPP      LAGIMLGFLRANHPTFGYIPQGALNMVKEFGLMVFMAGVGLSAGGGINSSLGAVGGQMLI
Y2649_YERP3      LAGIMLGFLRANHPTFGYIPQGALNMVKEFGLMVFMAGVGLSAGGGINSSLGAVGGQMLI
Y2653_YERPN      LAGIMLGFLRANHPTFGYIPQGALNMVKEFGLMVFMAGVGLSAGGGINSSLGAVGGQMLI
Y617_YERPA       LAGIMLGFLRANHPTFGYIPQGALNMVKEFGLMVFMAGVGLSAGGGINSSLGAVGGQMLI
Y2683_PECAS      FAGIMLGFLRANHPTFGYIPQGALNMVKEFGLMVFMAGVGLSAGSTINSSLGEVGIQMLA
YBJL_ECOLI       FAGIMLGFMRANHPTFGYIPQGALSMVKEFGLMVFMAGVGLSAGSGINNGLGAIGGQMLI
YBJL_ECO24       FAGIMLGFMRANHPTFGYIPQGALSMVKEFGLMVFMAGVGLSAGSGINNGLGAIGGQMLI
YBJL_ECOUT       FAGIMLGFMRANHPTFGYIPQGALSMVKEFGLMVFMAGVGLSAGSGINNGLGAIGGQMLI
YBJL_SHIF8       FAGIMLGFMRANHPTFGYIPQGALSMVKEFGLMVFMAGVGLSAGSGINNGLGAIGGQMLI
YBJL_SHIBS       FAGIMLGFMRANHPTFGYIPQGALSMVKEFGLMVFMAGVGLSAGSGINNGLGAIGGQMLI
YBJL_ECOL5       FAGIMLGFMRANHPTFGYIPQGALSMVKEFGLMVFMAGVGLSAGSGINNGLGAIGGQMLI
YBJL_SHIFL       FAGIMLGFMRANHPTFGYIPQGALSMVKEFGLMVFMAGVGLSAGSGINNGLGAIGGQMLI
YBJL_ECOHS       FAGIMLGFMRANHPTFGYIPQGALSMVKEFGLMVFMAGVGLSAGSGINNGLGAIGGQMLI
YBJL_ECOK1       FAGIMLGFMRANHPTFGYIPQGALSMVKEFGLMVFMAGVGLSAGSGINNGLGAIGGQMLI
YBJL_ECOL6       FAGIMLGFMRANHPTFGYIPQGALSMVKEFGLMVFMAGVGLSAGSGINNGLGAIGGQMLI
YBJL_SHISS       FAGIMLGFMRANHPTFGYIPQGALSMVKEFGLMVFMAGVGLSAGSGINNGLGAIGGQMLI
YBJL_ECO57       FAGIMLGFMRANHPTFGYIPQGALSMVKEFGLMVFMAGVGLSAGSGINNGLGAIGGQMLI
YBJL_SHIDS       FAGIMLGFMRANHPTFGYIPQGALSMVKEFGLMVFMAGVGLSAGSGINNGLGAIGGQMLI
YBJL_SALPA       FAGIMLGFLRANHPTFGYIPQGALNMVKEFGLMVFMAGVGLSAGSGISNGLGAVGGQMLI
YBJL_SALTY       FAGIMLGFLRANHPTFGYIPQGALNMVKEFGLMVFMAGVGLSAGSGISNGLGAVGGQMLI
YBJL_SALTI       FAGIMLGFLRANHPTFGYIPQGALNMVKEFGLMVFMAGVGLSAGSGISNGLGAVGGQMLI
YBJL_SALCH       FAGIMLGFLRANHPTFGYIPQGALNMVKEFGLMVFMAGVGLSAGSGINNGLGAVGGQMLI
Y2260_CITK8      FAGIMLGFLRANHPTFGYIPQGALNMVKEFGLMVFMAGVGLSAGSGIGNGLGAVGGQMLI
Y2488_CROS8      FAGIMLGFLRANHPTFGYIPQGALMMVKEFGLMVFMAGVGLSAGSGIGHGLGAVGGQMLF
Y853_KLEP7       FAGIMLGFLRANHPTFGYIPQGALNMVKEFGLMVFMAGVGLSAGAGINNGLGAVGGQMLA
Y1362_ENT38      FAGIMLGFLRANHPTFGYIPQGALNMVKEFGLMVFMAGVGLSAGSGIGHSLGAVGWQMLV
Y1639_SERP5      MAGIMLGFLRANHPTFGYIPQGALNMVKEFGLMVFMAGVGLSAGAGIGNSLGAVGGQMLI
Y2450_AERHH      LAGILMGYLRANHPTVGYVPPGALRLAKDLGLAVFMVSTGLKAGGGILDHLSQVGAVVLF
Y2308_AERS4      LAGILMGYLRANHPTVGYVPPGALRLAKDLGLAVFMVSTGLKAGGGILDHLSQVGAVVLF
                 ::** :*::******.**:* *** :.*::** .**.. **.**. :   :   *  :: 

Y1145_VIBCH      LAFLVSVVPVVFAYLVGAYILKMNRALLFGAIIGARTCAPAMDVVNEYAKSTIPALGYAG
Y1915_VIBC3      LAFLVSVVPVVFAYLVGAYILKMNRALLFGAIIGARTCAPAMDVVNEYAKSTIPALGYAG
Y1232_VIBPA      LAFIVSVVPVVIAYLVGAYILKMNRALLFGAIIGARTCAPAMDVVNEYAKSTIPALGYAG
Y2636_VIBCB      LAFIVSVVPVVLAYLVGAYVLKMNSALLFGAIIGARTCAPAMDVVNEYAKSTIPALGYAG
Y2828_VIBVU      IAFLVSVVPVFFAYLVGAYVLKMNRALLFGAIIGARTCAPAMDIVNEYAKSTIPALGYAG
Y1438_VIBVY      IAFLVSVVPVFFAYLVGAYVLKMNRALLFGAIIGARTCAPAMDIVNEYAKSTIPALGYAG
Y889_ALIF1       AAFIVSVIPVILAYLVGAYILNMNRALLIGAIIGARTCGPAMDVVNEHARSTIPALGYAG
Y2420_PHOPR      TSLMVSVIPVVLAYLFGAYVLKMNRALLFGAIIGARTCAPAMDMINEHARSTIPALGYAG
Y1357_YERPS      SGLIVSLVPVVICFVFGAYVLRMNRALLFGAIMGARTCAPAMDIISDTARSNIPALGYAG
Y1478_YERE8      SGLIVSLVPVVICFIFGAYVLRMNRALLFGAIMGARTCAPAMDIISDTARSNIPALGYAG
Y1326_YERPE      SGLIVSLVPVVICFVFGAYVLRMNRALLFGAIMGARTCAPAMDIISDTARSNIPALGYAG
Y2370_YERPP      SGLIVSLVPVVICFVFGAYVLRMNRALLFGAIMGARTCAPAMDIISDTARSNIPALGYAG
Y2649_YERP3      SGLIVSLVPVVICFVFGAYVLRMNRALLFGAIMGARTCAPAMDIISDTARSNIPALGYAG
Y2653_YERPN      SGLIVSLVPVVICFVFGAYVLRMNRALLFGAIMGARTCAPAMDIISDTARSNIPALGYAG
Y617_YERPA       SGLIVSLVPVVICFVFGAYVLRMNRALLFGAIMGARTCAPAMDIISDTARSNIPALGYAG
Y2683_PECAS      SGLIVSLVPVVICFLFGAYVLKMNRALLFGAMMGARTCAPAMEIISDTARSNIPALGYAG
YBJL_ECOLI       AGLIVSLVPVVICFLFGAYVLRMNRALLFGAMMGARTCAPAMEIISDTARSNIPALGYAG
YBJL_ECO24       AGLIVSLVPVVICFLFGAYVLRMNRALLFGAMMGARTCAPAMEIISDTARSNIPALGYAG
YBJL_ECOUT       AGLIVSLVPVVICFLFGAYVLRMNRALLFGAMMGARTCAPAMEIISDTARSNIPALGYAG
YBJL_SHIF8       AGLIVSLVPVVICFLFGAYVLRMNRALLFGAMMGARTCAPAMEIISDTARSNIPALGYAG
YBJL_SHIBS       AGLIVSLVPVVICFLFGAYVLRMNRALLFGAMMGARTCAPAMEIISDTAHSNIPALGYAG
YBJL_ECOL5       AGLIVSLVPVVICFLFGAYVLRMNRALLFGAMMGARTCAPAMEIISDTARSNIPALGYAG
YBJL_SHIFL       AGLIVSLVPVVICFLFGAYVLRMNRALLFGAMMGARTCAPAMEIISDTARSNIPALGYAG
YBJL_ECOHS       AGLIVSLVPVVICFLFGAYVLRMNRALLFGAMMGARTCAPAMEIISDTARSNIPALGYAG
YBJL_ECOK1       AGLIVSLVPVVICFLFGAYVLRMNRALLFGAMMGARTCAPAMEIISDTARSNIPALGYAG
YBJL_ECOL6       AGLIVSLVPVVICFLFGAYVLRMNRALLFGAMMGARTCAPAMEIISDTARSNIPALGYAG
YBJL_SHISS       AGLIVSLVPVVICFLFGAYVLRMNRALLFGAMMGARTCAPAMEIISDTARSNIPALGYAG
YBJL_ECO57       AGLIVSLVPVVICFLFGAYVLRMNRALLFGAMMGARTCAPAMEIISDTARSNIPALGYAG
YBJL_SHIDS       AGLIVSLVPVVICFLFGAYVLRMNRALLFGAMMGARTCAPAMEIISDTARSNIPALGYAG
YBJL_SALPA       AGLVVSLVPVVICFLFGAYVLRMNRALLFGAMMGARTCAPAMEIISDTARSNIPALGYAG
YBJL_SALTY       AGLVVSLVPVVICFLFGAYVLRMNRALLFGAMMGARTCAPAMEIISDTARSNIPALGYAG
YBJL_SALTI       AGLVVSLIPVVICFLFGAYVLRMNRALLFGAMMGARTCAPAMEIISDTARSNIPALGYAG
YBJL_SALCH       AGLVVSLVPVVICFLFGAYVLRMNRALLFGAMMGARTCAPAMEIISDTARSNIPALGYAG
Y2260_CITK8      AGLVVSLVPVIICFLFGAYVLRMNRALLFGAMMGARTCAPAMEIISDTARSNIPALGYAG
Y2488_CROS8      AGLIVSLLPVVICFLFGAYVLRMNRALLFGAMMGARTCAPAMEIISDTARSNIPALGYAG
Y853_KLEP7       AGLIVSLVPVVICFLFGAYVLRMNRAMLFGAMMGARTCAPAMEIISDTARSNIPALGYAG
Y1362_ENT38      AGLIVSLLPVVICFLFGAYVLRMNRAMLFGAMMGARTCAPAMEIISDTARSNIPALGYAG
Y1639_SERP5      AGLIVSLVPVVICFLFGAYVLRMNRALLFGAIMGARTCAPAMEIISDTARSNIPALGYAG
Y2450_AERHH      SGMLVTTLPVLVGYLFGVWVLKMNPALLLGAITGARTCAPAMDVVNEAANSSIPALGYAG
Y2308_AERS4      SGMLVTTLPVLVGYLFGVWVLKMNPALLLGAITGARTCAPAMDVVNEAANSSIPALGYAG
                  .::*: :**.. ::.*.::*.** *:*:**: *****.***:::.: *.*.********

Y1145_VIBCH      TYAIANILMTLTGTIFILLS-----
Y1915_VIBC3      TYAIANILMTLTGTIFILLS-----
Y1232_VIBPA      TYAIANILMTLAGTILIILS-----
Y2636_VIBCB      TYAIANILMTLAGTILIILS-----
Y2828_VIBVU      TYAIANILMTLAGTILIILS-----
Y1438_VIBVY      TYAIANILMTLAGTILIILS-----
Y889_ALIF1       TYAIANILMTVAGTIMILLA-----
Y2420_PHOPR      TYAIANVLLTIAGTLIIIMN-----
Y1357_YERPS      TYAIANVLLTLAGSLIVILWPGILG
Y1478_YERE8      TYAIANVLLTLAGSLIVIVWPGILG
Y1326_YERPE      TYAIANVLLTLAGSLIVILWPGILG
Y2370_YERPP      TYAIANVLLTLAGSLIVILWPGILG
Y2649_YERP3      TYAIANVLLTLAGSLIVILWPGILG
Y2653_YERPN      TYAIANVLLTLAGSLIVILWPGILG
Y617_YERPA       TYAIANVLLTLAGSLIVILWPGILG
Y2683_PECAS      TYAIANVLLTLAGSLIVVIWPELPG
YBJL_ECOLI       TYAIANVLLTLAGTIIVMVWPGLG-
YBJL_ECO24       TYAIANVLLTLAGTIIVMVWPGLG-
YBJL_ECOUT       TYAIANVLLTLAGTIIVMVWPGLG-
YBJL_SHIF8       TYAIANVLLTLAGTIIVMVWPGLG-
YBJL_SHIBS       TYAIANVLLTLAGTIIVMVWPGLG-
YBJL_ECOL5       TYAIANVLLTLAGTIIVMVWPGLG-
YBJL_SHIFL       TYAIANVLLTLAGTIIVMVWPGLG-
YBJL_ECOHS       TYAIANVLLTLAGTIIVMVWPGLG-
YBJL_ECOK1       TYAIANVLLTLAGTIIVMVWPGLG-
YBJL_ECOL6       TYAIANVLLTLAGTIIVMVWPGLG-
YBJL_SHISS       TYAIANVLLTLAGTIIVMVWPGLG-
YBJL_ECO57       TYAIANVLLTLAGTIIVMVWPGLG-
YBJL_SHIDS       TYAIANVLLTLAGTIIVMVCPGLG-
YBJL_SALPA       TYAIANVLLTLAGTLIVIIWPGLG-
YBJL_SALTY       TYAIANVLLTLAGTLIVIIWPGLG-
YBJL_SALTI       TYAIANVLLTLAGTLIVIIWPGLG-
YBJL_SALCH       TYAIANVLLTLAGTLIVIIWPELG-
Y2260_CITK8      TYAIANVLLTLAGTLIVIIWPGLG-
Y2488_CROS8      TYAIANVLLTLAGTLIVIIWPGT--
Y853_KLEP7       TYAIANVLLTLAGTLIVIIWPGLQ-
Y1362_ENT38      TYAIANVLLTLAGTLIIIIWPGLG-
Y1639_SERP5      TYAIANVLLTLAGSLIVVLWPGILG
Y2450_AERHH      TYAVANVMLTLAGSFIIGFWF----
Y2308_AERS4      TYAVANVMLTLAGSFIIGFWF----
                 ***:**:::*::*:::: .