CLUSTAL format seed alignment for MF_01016

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

YIDE_ECO24       MSDIALTVSILALVAVVGLFIGNVKFRGIGLGIGGVLFGGIIVGHFVSQ---------AG
YIDE_ECO57       MSDIALTVSILALVAVVGLFIGNVKFRGIGLGIGGVLFGGIIVGHFVSQ---------AG
YIDE_ECOLI       MSDIALTVSILALVAVVGLFIGNVKFRGIGLGIGGVLFGGIIVGHFVSQ---------AG
YIDE_SHIFL       MSDIALTVSILALVAVVGLFIGNVKFRGIGLGIGGVLFGGIIVGHFVSQ---------AG
YIDE_SHISS       MSDIALTVSILALVAVVGLFIGNVKFRGIGLGIGGVLFGGIIVGHFVSQ---------AG
YIDE_SHIBS       MSDIALTVSILALVAVVGLFIGNVKFRGIGLGIGGVLFGGIIVGHFVSQ---------AG
YIDE_SHIF8       MSDIALTVSILALVAVVGLFIGNVKFRGIGLGIGGVLFGGIIVGHFVSQ---------AG
YIDE_SHIDS       MSDIALTVSILALVAVVGLFIGNVKFRGIGLGIGGVLFGGIIVGHFVSQ---------AG
YIDE_ECOHS       MSDIALTVSILALVAVVGLFIGNVKFRGIGLGIGGVLFGGIIVGHFVSQ---------AG
YIDE_ECOL6       MSDIALTVSILALVAVVGLFIGNVKFRGVGLGIGGVLFGGIIVGHFVSQ---------AG
YIDE_ECOUT       MSDIALTVSILALVAVVGLFIGNVKFRGVGLGIGGVLFGGIIVGHFVSQ---------AG
YIDE_ECOK1       MSDIALTVSILALVAVVGLFIGNVKFRGVGLGIGGVLFGGIIVGHFVSQ---------AG
YIDE_ECOL5       MSDIALTVSILALVAVVGLFIGNVKFRGVGLGIGGVLFGGIIVGHFVSQ---------AG
YIDE_SALCH       MSDIALTVSVLALVAVVDLWIGNIKVRGVGFGIGGVLFGGIIVGHFVDQ---------AG
YIDE_SALTY       MSDIALTVSVLALVAVVGLWIGNIKVRGVGFGIGGVLFGGIIVGHFVDQ---------AG
YIDE_SALPA       MSDIALTVSVLALVAVVGLWIGNIKVRGVGFGIGGVLFGGIIVGHFVDQ---------AG
YIDE_SALTI       MSDIALTVSVLALVAVVGLWIGNIKVRGVGFGIGGVLFGGIIVGHFVDQ---------AG
Y031_CITK8       MSDIALTVSVLALVAVVGLWIGNIKVRGVGFGIGGVLFGGIIVGHFVDQ---------AG
Y015_ENT38       MSDIALTVSVLALVAVVGLWIGNIKIRGVGLGIGGVLFGGIFIGHFAEQ---------LG
Y4047_KLEP7      MSEIALTVSVLALVAVVGLWIGNVKIRGVGFGIGGVLFGGIIVGHFVDQ---------AG
Y4083_YERPE      MSAIALTVSMLALVAVLGLWIGNWKIYGVGLGIGGVLFGGIIVGHFAQT---------YQ
Y3002_YERPA      MSAIALTVSMLALVAVLGLWIGNWKIYGVGLGIGGVLFGGIIVGHFAQT---------YQ
Y3727_YERPN      MSAIALTVSMLALVAVLGLWIGNWKIYGVGLGIGGVLFGGIIVGHFAQT---------YQ
Y014_YERPP       MSAIALTVSMLALVAVLGLWIGNWKIYGVGLGIGGVLFGGIIVGHFAQT---------YQ
Y3906_YERPS      MSAIALTVSMLALVAVLGLWIGNWKIYGVGLGIGGVLFGGIIVGHFAQT---------YQ
Y4141_YERP3      MSAIALTVSMLALVAVLGLWIGNWKIYGVGLGIGGVLFGGIIVGHFAQT---------YQ
Y4162_YERE8      MSAIALTVSMLALVAVLGLWIGNWKVYGVGLGIGGVLFGGIIVGHFAQT---------YE
Y050_SERP5       MSEIALTVSMLALVAVLGLWMGNWKIYGVGLGIGGVLFGGIIVGHFAQS---------WQ
Y4401_PECAS      MSDIALTVSMLALVAVLGLWIGNWRIYGVGLGIGGVLFGGIIVGHVAHQ---------YQ
Y3492_AERHH      MSDIALSISMLSLVAVLGLWLGNWRVYGVGLGIGGVLFGGIIVGHFAGL---------SG
Y825_AERS4       MSDIALSISMLSLVAVLGLWLGNWRVYGVGLGIGGVLFGGIIVGHFAGV---------SD
Y2144_PHOPR      MSDIALSISILALVAVLGLWIGNWRICGVGLGIGGVLFGGIFVGHFTDS---------WG
Y035_HAEIN       MSDIAITISLLALVAVIGLWIGHWKIRGVGLGIGGVLFGGIIVAHFTNQ---------YG
Y2670_HAEIG      MSDIAITISLLALVAVIGLWIGHWKIRGVGLGIGGVLFGGIIVAHFTNQ---------YG
Y3135_HAEIE      MSDIAITISLLALVAVIGLWIGHWKIRGVGLGIGGVLFGGIIVAHFTDQ---------YG
Y043_HAEI8       MSDIAITISLLALVAVIGLWIGHWKIRGVGLGIGGVLFGGIIVAHFTNQ---------YG
Y1470_HAES1      MSDIAITICILALVAVIGLWIGHWKIRGVGLGIGGVLFGGIIVAHFMNQ---------NG
Y1071_PASMU      MSDIAITISLLALVAVIGLWIGHWKIRGVGLGIGGVLFGGIIVAHFTNQ---------YG
Y023_ACTSZ       MSDIAVTISVLSLVAVLGLWIGHWKIRGVGLGIGGVLFGGIIISHFANQ---------YG
Y966_ACTP2       MSDIAIIVSLLSLVAVLGLWIGHIKIKGVGLGIGGVLFGGIIISHCTHL---------YG
Y009_DICNV       MSSVAITICILSLVASLGLWLGNIKIRGVGLSIGGVLFGGIIISHIMNLPTVASFMQQKN
                 ** :*: :.:*:*** :.*::*: :. *:*:.*********::.*               

YIDE_ECO24       MTLSSDMLHVIQEFGLILFVYTIGIQVGPGFFASLRVSGLRLNLFAVLIVIIGGLVTAIL
YIDE_ECO57       MTLSSDMLHVIQEFGLILFVYTIGIQVGPGFFASLRVSGLRLNLFAVLIVIIGGLVTAIL
YIDE_ECOLI       MTLSSDMLHVIQEFGLILFVYTIGIQVGPGFFASLRVSGLRLNLFAVLIVIIGGLVTAIL
YIDE_SHIFL       MTLSSDMLHVIQEFGLILFVYTIGIQVGPGFFASLRVSGLRLNLFAVLIVIIGGLVTAIL
YIDE_SHISS       MTLSSDMLHVIQEFGLILFVYTIGIQVGPGFFASLRVSGLRLNLFAVLIVIIGGLVTAIL
YIDE_SHIBS       MTLSSDMLHVIQEFGLILFVYTIGIQVGPGFFASLRVSGLRLNLFAVLIVIIGGLVTAIL
YIDE_SHIF8       MTLSSDMLHVIQEFGLILFVYTIGIQVGPGFFASLRVSGLRLNLFAVLIVIIGGLVTAIL
YIDE_SHIDS       MTLSSDMLHVIQEFGLILFVYTIGIQVGPGFFASLRVSGLRLNLFAVLIVIIGGLVTAIL
YIDE_ECOHS       MTLSSDMLHVIQEFGLILFVYTIGIQVGPGFFASLRVSGLRLNLFAVLIVIIGGLVTAIL
YIDE_ECOL6       MTLSSDMLHVIQEFGLILFVYTIGIQVGPGFFASLRVSGLRLNLFAVLIVIIGGLVTAIL
YIDE_ECOUT       MTLSSDMLHVIQEFGLILFVYTIGIQVGPGFFASLRVSGLRLNLFAVLIVIIGGLVTAIL
YIDE_ECOK1       MTLSSDMLHVIQEFGLILFVYTIGIQVGPGFFASLRVSGLRLNLFAVLIVIIGGLVTAIL
YIDE_ECOL5       MTLSSDMLHVIQEFGLILFVYTIGIQVGPGFFASLRVSGLRLNLFAVLIVIIGGLVTAIL
YIDE_SALCH       VTLSGDMLHFIQEFGLILFVYTIGIQVGPGFFASLRVSGLRLNLFAVLIVIMGGLVTAIL
YIDE_SALTY       VTLSGDMLHFIQEFGLILFVYTIGIQVGPGFFASLRVSGLRLNLFAVLIVIMGGLVTAIL
YIDE_SALPA       VTLSGDMLHFIQEFGLILFVYTIGIQVGPGFFASLRVSGLRLNLFAVLIVIMGGLVTAIL
YIDE_SALTI       VTLSGDMLHFIQEFGLILFVYTIGIQVGPGFFASLRVSGLRLNLFAVLIVIMGGLVTAIL
Y031_CITK8       MTLSSDMLHFIQEFGLILFVYTIGIQVGPGFFASLRVSGLRLNLFAILIVIIGGLVTAIL
Y015_ENT38       ITLSAEMLHFIQEFGLILFVYTIGIQVGPGFFASLRVSGLRLNLFALGIVVMGGVVTAIL
Y4047_KLEP7      VALSSPMLHFIQEFGLILFVYTIGIQVGPGFFASLRVSGLRLNLFAILIVILGGLVTAVL
Y4083_YERPE      IVLNGDMLHFIQEFGLILFVYTIGIQVGPGFFSSLRVSGLRLNCFAILMVVVGGLVTAII
Y3002_YERPA      IVLNGDMLHFIQEFGLILFVYTIGIQVGPGFFSSLRVSGLRLNCFAILMVVVGGLVTAII
Y3727_YERPN      IVLNGDMLHFIQEFGLILFVYTIGIQVGPGFFSSLRVSGLRLNCFAILMVVVGGLVTAII
Y014_YERPP       IVLNGDMLHFIQEFGLILFVYTIGIQVGPGFFSSLRVSGLRLNCFAILMVVVGGLVTAII
Y3906_YERPS      IVLNGDMLHFIQEFGLILFVYTIGIQVGPGFFSSLRVSGLRLNCFAILMVVVGGLVTAII
Y4141_YERP3      IVLNGDMLHFIQEFGLILFVYTIGIQVGPGFFSSLRVSGLRLNCFAILMVVVGGLVTAII
Y4162_YERE8      LVLNGDMLHFIQEFGLILFVYTIGIQVGPGFFSSLRVSGLRLNCFAILMVIVGGLVTAII
Y050_SERP5       LNLNGDMLHFIQEFGLILFVYTIGIQVGPGFFSSLRVSGLRLNGFAILLVLVGGLVAAVV
Y4401_PECAS      IQLNDDMLHVIQEFGLILFVYTIGIQVGPGFFSSLRVSGLRLNAFALLTVFLGSVVTVML
Y3492_AERHH      LALDEQTLHFIQEFGLILFVYTIGIQVGPGFFSSLRSSGLKLNGFAALLVLLGCAVAAAL
Y825_AERS4       LALDEQTLHFIQEFGLILFVYTIGIQVGPGFFSSLRSSGLKLNGFAALLVILGCVVAAGL
Y2144_PHOPR      VALDSHTLHFIQEFGLILFVYTIGIQVGPGFFASLRSSGLKLNAFAALVVLLGCIVAIGL
Y035_HAEIN       LKLDAHTLHFVQEFGLILFVYTIGIQVGPGFFSSLRKSGLKLNAFAILIILLGSIAVVLV
Y2670_HAEIG      LKLDAHTLHFVQEFGLILFVYTIGIQVGPGFFSSLRKSGLKLNAFAILIIVLGSIAVVLV
Y3135_HAEIE      LKLDAHTLHFVQEFGLILFVYTIGIQVGPGFFSSLRKSGLKLNAFAILIIVLGSIAVVLV
Y043_HAEI8       LKLDAHTLHFVQEFGLILFVYTIGIQVGPGFFSSLRKSGLKLNAFAILIIVLGSIAVVLV
Y1470_HAES1      LKLDAHTLHFIQEFGLILFVYTIGIQVGPGFFASLLSAGLKLNGLATLIVVLGAVSVFVL
Y1071_PASMU      LKLDAHTMHFIQEFGLILFVYTIGIQVGPGFFASLRQSGLKLNGFAALIVLLGSLAVIVI
Y023_ACTSZ       LKLDEHTLHFVQEFGLILFVYTIGIQVGPGFFSSLRESGLKLNVLGGLIVVLGALLVVII
Y966_ACTP2       IELDAHTLHFIQEFGLILFVYSIGIQVGPGFFASLRQSGLKLNGFAVMIVGLSGILVALI
Y009_DICNV       IVLDSQTLYFVQEFGLILFVYTIGIQVGPGFFASLRSSGLKLNAFAALIVLLGGLCSVIL
                 : *.   ::.:**********:**********:**  :**:** :.   : :.      :

YIDE_ECO24       HKLFDIPLPVVLGIFSGAVTNTPALGAGQQILRDLGTPMEMVDQMGMSYAMAYPFGICGI
YIDE_ECO57       HKLFDIPLPVVLGIFSGAVTNTPALGAGQQILRDLGTPMEMVDQMGMSYAMAYPFGICGI
YIDE_ECOLI       HKLFDIPLPVVLGIFSGAVTNTPALGAGQQILRDLGTPMEMVDQMGMSYAMAYPFGICGI
YIDE_SHIFL       HKLFDIPLPVVLGIFSGAVTNTPALGAGQQILRDLGTPMEMVDQMGMSYAMAYPFGICGI
YIDE_SHISS       HKLFDIPLPVVLGIFSGAVTNTPALGAGQQILRDLGTPMEMVDQMGMSYAMAYPFGICGI
YIDE_SHIBS       HKLFDIPLPVVLGIFSGAVTNTPALGAGQQILRDLGTPMEMVDQMGMSYAMAYPFGICGI
YIDE_SHIF8       HKLFDIPLPVVLGIFSGAVTNTPALGAGQQILRDLGTPMEMVDQMGMSYAMAYPFGICGI
YIDE_SHIDS       HKLFDIPLPVVLGIFSGAVTNTPALGAGQQILRDLGTPMEMVDQMGMSYAMAYPFGICGI
YIDE_ECOHS       HKLFDIPLPVVLGIFSGAVTNTPALGAGQQILRDLGTPMEMVDQMGMSYAMAYPFGICGI
YIDE_ECOL6       HKLFDIPLPVVLGIFSGAVTNTPALGAGQQILRDLGTPMAMVDQMGMSYAMAYPFGICGI
YIDE_ECOUT       HKLFDIPLPVVLGIFSGAVTNTPALGAGQQILRDLGTPMAMVDQMGMSYAMAYPFGICGI
YIDE_ECOK1       HKLFDIPLPVVLGIFSGAVTNTPALGAGQQILRDLGTPMAMVDQMGMSYAMAYPFGICGI
YIDE_ECOL5       HKLFDIPLPVVLGIFSGAVTNTPALGAGQQILRDLGTPMEMVDQMGMSYAMAYPFGICGI
YIDE_SALCH       HKIFAIPLPVVLGIFSGAVTNTPALGAGQQILRDLGTPVDLVDQMGMSYAMAYPFGICGI
YIDE_SALTY       HKIFAIPLPVVLGIFSGAVTNTPALGAGQQILRDLGTPVDLVDQMGMSYAMAYPFGICGI
YIDE_SALPA       HKIFAIPLPVVLGIFSGAVTNTPALGAGQQILRDLGTPVDLVDQMGMSYAMAYPFGICGI
YIDE_SALTI       HKIFAIPLPVVLGIFSGAVTNTPALGAGQQILRDLGTPVDLVDQMGMSYAMAYPFGICGI
Y031_CITK8       HKIFAIPLPVVLGIFSGAVTNTPALGAGQQILRDLGTPMEAVDQMGMSYAMAYPFGICGI
Y015_ENT38       HKLFEIPLPVVLGIFSGAVTNTPALGAGQQILRDLGIAPDVVDQMGMSYAMAYPFGICGI
Y4047_KLEP7      HKLFNIPLPVVLGIFSGAVTNTPALGAGQQILRDLGVPFEVVDQMGMSYAMAYPFGICGI
Y4083_YERPE      HKLFAVPLPIILGVFSGAVTNTPALGAAQQILTDLGSPPQLVSQMGMGYAMAYPFGICGI
Y3002_YERPA      HKLFAVPLPIILGVFSGAVTNTPALGAAQQILTDLGSPPQLVSQMGMGYAMAYPFGICGI
Y3727_YERPN      HKLFAVPLPIILGVFSGAVTNTPALGAAQQILTDLGSPPQLVSQMGMGYAMAYPFGICGI
Y014_YERPP       HKLFAVPLPIILGVFSGAVTNTPALGAAQQILTDLGSPPQLVSQMGMGYAMAYPFGICGI
Y3906_YERPS      HKLFAVPLPIILGVFSGAVTNTPALGAAQQILTDLGSPPQLVSQMGMGYAMAYPFGICGI
Y4141_YERP3      HKLFAVPLPIILGVFSGAVTNTPALGAAQQILTDLGSPPQLVSQMGMGYAMAYPFGICGI
Y4162_YERE8      HKLFAVPLPIILGVFSGAVTNTPALGAAQQILTDLGSPPQLVSQMGMGYAMAYPFGICGI
Y050_SERP5       HKLFAVPLPIILGVFSGAVTNTPALGAGQQILTDLGSDPALVDRMGMGYAMAYPFGICGI
Y4401_PECAS      HKLLNIPLPIILGIFSGAVTNTPSLGAGQQILTDLGSSTALVNQMGTGYAMAYPLGICGI
Y3492_AERHH      HQLFDVPLPVILGVFSGAVTNTPSLGAGQQILAELGAAPGSTGLMGMGYAVAYPFGICGI
Y825_AERS4       HQLFDVPLPVILGVFSGAVTNTPSLGAGQQILAELGADPGSTGLMGMGYAVAYPFGICGI
Y2144_PHOPR      YKIFDVPLPVILGIFSGAVTNTPSLGAGQQILTELGAQEGMLDLTGMGYAVAYPFGICGI
Y035_HAEIN       HKIADVPLDIALGIYSGAVTNTPALGAGQQILAELGVP-QTTVTMGVSYAMAYPFGICGI
Y2670_HAEIG      HKIADVPLDIALGIYSGAVTNTPALGAGQQILAELGVP-QTTVTMGVSYAMAYPFGICGI
Y3135_HAEIE      HKIADVPLDIALGIYSGAVTNTPALGAGQQILAELGVP-QTTVTMGVSYAMAYPFGICGI
Y043_HAEI8       HKIADVPLDIALGIYSGAVTNTPALGAGQQILAELGVP-QTTVTMGVSYAMAYPFGICGI
Y1470_HAES1      YKVVNVDLDIILGIYSGAVTNTPSLGAGQQILTELGIE-NANSTMGMAYAMAYPFGICGI
Y1071_PASMU      HKLADVPLDIILGIYSGAVTNTPSLGAGQQILSELGLT-QTTSTMGMAYAMAYPFGICGI
Y023_ACTSZ       HQVTEIPLDAILGIYSGAVTNTPSLGAGQQILNELGMQ-DITETMGMSYAMAYPFGICGI
Y966_ACTP2       HKLFDVPLPVILGIFSGAVTNTPSLGAGQQVLTELGGD-NITAVMGMSYAIAYPFGIIGI
Y009_DICNV       YYLFSIPLPAILGILSGAVTNTPSLGAGKQIIAELGGE-QMTELMGMGYAIAYPFGIIGV
                 : :  : *   **: ********:***.:*:: :**         * .**:***:** *:

YIDE_ECO24       LFTMWMLRVIFRVNVETEAQQHESSRTNGGALIKTINIRVENPNLHDLAIKDVPILNGD-
YIDE_ECO57       LFTMWMLRVIFRVNVETEAQQHESSRTNGGALIKTINIRVENPNLHDLAIKDVPILNGD-
YIDE_ECOLI       LFTMWMLRVIFRVNVETEAQQHESSRTNGGALIKTINIRVENPNLHDLAIKDVPILNGD-
YIDE_SHIFL       LFTMWMLRVIFRVNVETEAQQHESSRTNGGALIKTINIRVENPNLHDLAIKDVPILNGD-
YIDE_SHISS       LFTMWMLRVIFRVNVETEAQQHESSRTNGGALIKTINIRVENPNLHDLAIKDVPILNGD-
YIDE_SHIBS       LFTMWMLRVIFRVNVETEAQQHESSRTNGGALIKTINIRVENPNLHDLAIKDVPILNGD-
YIDE_SHIF8       LFTMWMLRVIFRVNVETEAQQHESSRTNAGALIKTINIRVENPNRHDLAIKDVPILNGD-
YIDE_SHIDS       LFTMWMLRVIFRVNVETEAQQHESSRTNGGALIKTINIRVENLNLHDLAIKDVPILNGD-
YIDE_ECOHS       LFTMWMLRVIFRVNVETEAQQHESSRTNGGALIRTINIRVENPNLHDLAIKDVPILNGD-
YIDE_ECOL6       LFTMWMLRVIFRVNVETEAQQHESTRTNGGALIRTINIRVENPNLHNLAIKDVPILNGD-
YIDE_ECOUT       LFTMWMLRVIFRVNVETEAQQHESTRTNGGALIRTINIRVENPNLHNLAIKDVPILNGD-
YIDE_ECOK1       LFTMWMLRVIFRVNVETEAQQHESTRTNGGALIRTINIRVENPNLHNLAIKDVPILNGD-
YIDE_ECOL5       LFTMWMLRVIFRVNVETEAQQHESTRTNGGALIRTINIRVENPNLHNLAIKDVPILNGD-
YIDE_SALCH       LLTMWLMRLIFRVNVEAEAQKHESSLANGHSLIQTMNIRVENPNLNNMAIQDVPILNSD-
YIDE_SALTY       LLTMWLMRLIFRVNVEAEAQKHESSLANGHSLIQTMNIRVENPNLNNMAIQDVPILNSD-
YIDE_SALPA       LLTMWLMRLIFRVNVEAEAQKHESSLANGHSLIQTMNIRVENPNLNNMAIQDVPILNSD-
YIDE_SALTI       LLTMWLMRLIFRVNVEAEAQKHESSLANGHSLIQTMNIRVENPNLNNMAIQDVPILNSD-
Y031_CITK8       LLTMWLMRMIFRVNVEAEAKQHEDTLSNGHSLIQTMNIRVENPNLNNMAIQDVPILNSD-
Y015_ENT38       LLTMWLVRVLFRINVDDEAKKHESAITNGHALIKTINIRVENPNLSNMAIQDVPILNSI-
Y4047_KLEP7      LLTMWLVRLFFRINVEKEAQRFEESSGNGHAHLHTINVRVENPNLNQMAIQDVPMLNND-
Y4083_YERPE      LLVMWLIRLFFKINIDREAKAFDSSYGQNRELLQTMNVAVRNPNLHGLSVQDVPLLNSD-
Y3002_YERPA      LLVMWLIRLFFKINIDREAKAFDSSYGQNRELLQTMNVAVRNPNLHGLSVQDVPLLNSD-
Y3727_YERPN      LLVMWLIRLFFKINIDREAKAFDSSYGQNRELLQTMNVAVRNPNLHGLSVQDVPLLNSD-
Y014_YERPP       LLVMWLIRLFFKINIDREAKAFDSSYGQNRELLQTMNVAVRNPNLHGLSVQDVPLLNSD-
Y3906_YERPS      LLVMWLIRLFFKINIDREAKAFDSSYGQNRELLQTMNVAVRNPNLHGLSVQDVPLLNSD-
Y4141_YERP3      LLVMWLIRLFFKINIDREAKAFDSSYGQNRELLQTMNVAVRNPNLHGLSVQDVPLLNSD-
Y4162_YERE8      LLVMWLIRLFFKINVDREAKEFDSSHGQNRELLQTMNVAVRNPNLHGLSMQDVPLLNSD-
Y050_SERP5       LLVMWLIRLFFRINIEQEAQAFASSLGNQRELLHTMNVAVRNPNLQGMAIKNVPLLNGE-
Y4401_PECAS      LLVMWLMRVLFRVAVDNEAKQFETSNGQHHEQLLTINVSVTNTNLQGLAIQDVPILNRD-
Y3492_AERHH      LLTMWLIRMFFRIKIDEEAAQFEQQAGKTKESLQTINIAVRNPNIHGLMLSEIPSLDEA-
Y825_AERS4       LLTMWLVRLFFRIKIDEEADLFEQHAGKTKESLQTINIAVRNPNMHGLMLCEIPSLDES-
Y2144_PHOPR      LLTMWILRLAFRVNVDKEAEEFEVQNGHKKQNLHTLNVAIRNPNLNGLQLKDVPALAEG-
Y035_HAEIN       LLAMWLIRLFFNVKVDDEAARFNAESSQDKESLHNISLKVTNQNLDGLTLIQIPGFSDE-
Y2670_HAEIG      LLAMWLIRLFFNVKVDDEAARFNAESSQDKESLHNISLKVTNQNLDGLTLIQIPGFSDE-
Y3135_HAEIE      LLAMWLIRLFFNVKVDDEAARFNAESSQDKESLHNISLKVTNQNLDGLTLIQIPGFSDE-
Y043_HAEI8       LLAMWLIRLFFKVKVDDEAARFNAESSQDKESLHNISLKVTNQNLDGLTLIQIPGFSDE-
Y1470_HAES1      LLSMWLIRLFFKIKVEEEEKQFQKASGQDKESLTTVNVKVTNPNLSGLRLIDIPGFDNK-
Y1071_PASMU      LLSMWLIRLFFRIKIDDEAKNFLKESGQDKETLGSINVRVTNPNLDGLRLVDIPGFDEKR
Y023_ACTSZ       LLTMWLIRLFFKINIDKEAENFDRETGKDKETIRKANIRITNANFAGLNLRDIPGFEKN-
Y966_ACTP2       LLSMWLIRIIFKVNIDKEAQEFDNNQNQQKEGLDTLNVRLTNPNLGGLKLKEIPDFESH-
Y009_DICNV       LLAMWLIRLIFKIRPERELQFFDKEQQRQK-GLAGINIRITNPNINNILLREIPDYDLN-
                 *: **::*: *.:  : *   .     .    :   .: : * *   : : ::*      

YIDE_ECO24       KIICSRLKREETLKVPSPDTIIQLGDLLHLVGQPADLHNAQLVIGQEVDTSLSTKG-TDL
YIDE_ECO57       KIICSRLKREETLKVPSPDTIIQLGDLLHLVGQPADLHNAQLVIGQEVDTSLSTKG-TDL
YIDE_ECOLI       KIICSRLKREETLKVPSPDTIIQLGDLLHLVGQPADLHNAQLVIGQEVDTSLSTKG-TDL
YIDE_SHIFL       KIICSRLKREETLKVPSPDTIIQLGDLLHLVGQPADLHNAQLVIGQEVDTSLSTKG-TDL
YIDE_SHISS       KIICSRLKREETLKVPSPDTIIQLGDLLHLVGQPADLHNAQLVIGQEVDTSLSTKD-TDL
YIDE_SHIBS       KIICSRLKREETLKVPSPDTIIQLGDLLHLVGQPADLHNAQLVIGQEVDTSLSTKG-TDL
YIDE_SHIF8       KIICSRLKREETLKVPSPDTIIQLGDLLHLVGQPADLHNAQLVIGQEVDTSLSTKG-TDL
YIDE_SHIDS       KIICSRLKREETLKVPSPDTIIQLGDLLHLVGQPADLHNAQLVIGQEVDTSLSTKG-TDL
YIDE_ECOHS       KIICSRLKREETLKVPSPDTIIQLGDLLHLVGQPADLHNAQLVIGQEVDTSLSTKG-TDL
YIDE_ECOL6       KVICSRLKREETLKVPSPETVIQLGDLLHLVGQPADLHNAQLVIGQEVDTSLSTKG-TDL
YIDE_ECOUT       KVICSRLKREETLKVPSPETVIQLGDLLHLVGQPADLHNAQLVIGQEVDTSLSTKG-TDL
YIDE_ECOK1       KVICSRLKREETLKVPSPETVIQLGDLLHLVGQPADLHNAQLVIGQEVDTSLSTKG-TDL
YIDE_ECOL5       KVICSRLKREETLKVPSPETVIQLGDLLHLVGQPADLHNAQLVIGQEVDTSLSTKG-TDL
YIDE_SALCH       KIICSRLKRDDTLMVPSPGTIIQAGDLLHLVGQSTDLHNAQLVIGKEVDTSLSTRG-TDL
YIDE_SALTY       KIICSRLKRDDTLMVPSPGTIIQAGDLLHLVGQSTDLHNAQLVIGKEVDTSLSTRG-TDL
YIDE_SALPA       KIICSRLKRDDTLMVPSPGTIIQAGDLLHLVGQSTDLHNAQLVIGKEVDTSLSTRG-TDL
YIDE_SALTI       KIICSRLKRDDTLMVPSPGTIIQAGDLLHLVGQPTDLHNAQLVIGKEVDTSLSTRG-TDL
Y031_CITK8       KIICSRLKRDETLMVPSPGTIIQSGDLLHLVGQPVDLHNAQLVIGQEVDTSLSTRG-TDL
Y015_ENT38       SIICSRLKRGDMLMVPSPGTVIQIGDLLHLVGQPGDLHSAQLVIGQEVETSLSTRG-TDM
Y4047_KLEP7      NIVCSRLKRGELLMVPAPGTLIQAGDLLHLVGRPEDLHNAQLVIGQEVATSLSTRG-TDL
Y4083_YERPE      EVVCSRLKRGDLLMVPMPATVIEIGDYLHLVGQRDALEKVRLVVGEEVDVTLSTAG-TAL
Y3002_YERPA      EVVCSRLKRGDLLMVPMPATVIEIGDYLHLVGQRDALEKVRLVVGEEVDVTLSTAG-TAL
Y3727_YERPN      EVVCSRLKRGDLLMVPMPATVIEIGDYLHLVGQRDALEKVRLVVGEEVDVTLSTAG-TAL
Y014_YERPP       EVVCSRLKRGDLLMVPMPATVIEIGDYLHLVGQRDALEKVRLVVGEEVDVTLSTAG-TAL
Y3906_YERPS      EVVCSRLKRGDLLMVPMPATVIEIGDYLHLVGQRDALEKVRLVVGEEVDVTLSTAG-TAL
Y4141_YERP3      EVVCSRLKRGDLLMVPMPATVIEIGDYLHLVGQRDALEKVRLVVGEEVDVTLSTAG-TAL
Y4162_YERE8      EVVCSRLKRGDLLMVPLSGTVIELGDYLHLVGQREALEKVRLVVGEEVDVTLSTAS-TVL
Y050_SERP5       DIICSRLKRGDLLMVPAPLEKLELGDYLHLVGKRESLENARLVIGEEVDVSLSTRG-TEL
Y4401_PECAS      TIVCSRLKRGDELMVPSPHTLIQLGDYLHLVGAKNDLEQARLVIGNEVETSLSTRG-TDL
Y3492_AERHH      DVICSRLKRGDELMVPRPDSRIELGDLLHLVGERHALRKVLLVLGEEVETSLSTRG-TDL
Y825_AERS4       DVICSRLKRGEELMVPRSDSRIELGDLLHLVGERHALHKVLLVLGEEVETSLSTRG-TDL
Y2144_PHOPR      DIVCSRLKRGEKLHVPRPDTRIETNDLLHLVGAKHALEKARLVIGEVVDASLSTRG-TDL
Y035_HAEIN       EVVCSRLKRDDMEIVPKASTEIRTNDILQLVGDDNSLAKMRLIIGHEVDAPTVAYS-GEI
Y2670_HAEIG      EVVCSRLKRDDMEIVPKASTEIRTNDILQLVGDDNSLAKMRLIIGHEVDAPTVAYS-GEI
Y3135_HAEIE      EVVCSRLKRDDMEIVPKASTEIRTNDILQLVGDDNSLAKMRLIIGYEVDAPTVAYS-GEI
Y043_HAEI8       EVVCSRLKRDDMEIVPKASTEIRINDILQLVGDDNSLAKMRLIIGYEVDAPTVAYS-GEI
Y1470_HAES1      DVVCSRLKRQENISVPSADTIIAIDDVLHLVGEINALKKMKLVIGEEIDMPMTHLA-GDL
Y1071_PASMU      DVVCTRLKRDEHISVPQANTIIQKGDLLHLVGEIPLLRKIKLVLGEEVDVPLSSFT-GDL
Y023_ACTSZ       GIVCTRLKREQDIFIPQADTQLQVGDILHFLGDPKILHEMELILGESIQVEASAMK-GNL
Y966_ACTP2       TVIYSRLKRNDQLIVPNVDTVLNVGDVLHLVGEKATLRKMQLILGEEADVSVSTRG-TIF
Y009_DICNV       TVIYSRLKRNDELIIPHPNTTLYLNDILHLVGNKKSLNKMQIILGEEAGHEPLNSGDSPI
                  :: :**** :   :*     :  .* *:::*    * .  :::*              :

YIDE_ECO24       RVERVVVTNENVLGKRIRDLHFKERYDVVISRLNRAGVELVASGDISLQFGDILNLVGRP
YIDE_ECO57       RVERVVVTNENVLGKRIRDLHFKERYDVVISRLNRAGVELVASGDISLQFGDILNLVGRP
YIDE_ECOLI       RVERVVVTNENVLGKRIRDLHFKERYDVVISRLNRAGVELVASGDISLQFGDILNLVGRP
YIDE_SHIFL       RVERVVVTNENVLGKRIRDLHFKERYDVVISRLNRAGVELVASGDISLQFGDILNLVGRP
YIDE_SHISS       RVERVVVTNENVLGKRIRDLHFKERYDVVISRLNRAGVELVASGDISLQFGDILNLVGRP
YIDE_SHIBS       RVERVVVTNENVLGKRIRDLHFKERYDVVISRLNRAGVELVASGDISLQFGDILNLVGRP
YIDE_SHIF8       RVERVVVTNENVLGKRIRDLHFKERYDVVISRLNRAGVELVASGDISLQFGDILNLVGRP
YIDE_SHIDS       RVERVVVTNENVLGKRIRDLHFKERYDVVISRLNRAGVELVASGDISLQFGDILNLVGRP
YIDE_ECOHS       RVERVVVTNENVLGKRIRDLHFKERYDVVISRLNRAGVELVASGDISLQFGDILNLVGRP
YIDE_ECOL6       RVARVVVTNENVLGKRIRDLHFKERYDVVISRLNRAGVELVASSDISLQFGDILNLVGRP
YIDE_ECOUT       RVARVVVTNENVLGKRIRDLHFKERYDVVISRLNRAGVELVASSDISLQFGDILNLVGRP
YIDE_ECOK1       RVARVVVTNENVLGKRIRDLHFKERYDVVISRLNRAGVELVASSDISLQFGDILNLVGRP
YIDE_ECOL5       RVARVVVTNENVLGKRIRDLHFKERYDVVISRLNRAGVELVASSDISLQFGDILNLVGRP
YIDE_SALCH       RVERVVVTNEKVLGKRIRDLHFKERYDVVISRLNRAGVELVASSDASLQFGDILNLVGRP
YIDE_SALTY       RVERVVVTNEKVLGKRIRDLHFKERYDVVISRLNRAGVELVASSDASLQFGDILNLVGRP
YIDE_SALPA       RVERVVVTNEKVLGKRIRDLHFKERYDVVISRLNRAGVELVASSDASLQFGDILNLVGRP
YIDE_SALTI       RVERVVITNEKVLGKRIRDLHFKERYDVVISRLNRAGVELVASSDASLQFGDILNLVGRP
Y031_CITK8       RVERVVVTNEKVLGKRIRDLHFKERYDVVISRLNRAGVELVASSDASLQFGDILNLVGRP
Y015_ENT38       RVERVVVTNEQVLGKKIRDLQVKERYDVVISRLNRAGVELVASPDASLQFGDILNLVGRP
Y4047_KLEP7      KVERVVVTNEKVLGKKIRDLHVKQRYDVVISRLNRAGVELVASSSASLQFGDILNLVGRP
Y4083_YERPE      QTARVVVTNEAVLGKKIRDLNLKQKYDVVITRLNRAGIELVASNSASLQFGDILNLVGRP
Y3002_YERPA      QTARVVVTNEAVLGKKIRDLNLKQKYDVVITRLNRAGIELVASNSASLQFGDILNLVGRP
Y3727_YERPN      QTARVVVTNEAVLGKKIRDLNLKQKYDVVITRLNRAGIELVASNSASLQFGDILNLVGRP
Y014_YERPP       QTARVVVTNEAVLGKKIRDLNLKQKYDVVITRLNRAGIELVASNSASLQFGDILNLVGRP
Y3906_YERPS      QTARVVVTNEAVLGKKIRDLNLKQKYDVVITRLNRAGIELVASNSANLQFGDILNLVGRP
Y4141_YERP3      QTARVVVTNEAVLGKKIRDLNLKQKYDVVITRLNRAGIELVASNSANLQFGDILNLVGRP
Y4162_YERE8      QTARVVVTNEAVLGKKIRDLNLKQKYDVAITRLNRAGIELVASNNASLQFGDILNLVGRP
Y050_SERP5       QVVRAVVTNEKVLGSKIRDLNLKQKYDVVISRLNRSGVELVAGSNVTLQFGDILNLVGRP
Y4401_PECAS      HVERVVVTNEKVLGRKIRELNLKQNYDVVISRLNRAGVELVASNQASLQFGDILNLVGRK
Y3492_AERHH      RVERVVVTNEQVLGKKIRDLDIKQKYDVVISRLNRAGIELVPTSQTSLQFGDILNLVGRL
Y825_AERS4       RVERVVVTNEQVLGKKIRDLDIKQKYDVVISRLNRAGIELVPTSQTSLQFGDILNLVGRL
Y2144_PHOPR      RVQRLVVTNEIVLGKKISHLDLKEKYDVVVSRLNRAGVELVPTSQTTLQFGDILNLVGRQ
Y035_HAEIN       RSERVVVTNEKVLGKKIRALGIHQKYGVVISRLNRAGIELVPTGNTTLQFGDVLHMVGRS
Y2670_HAEIG      RSERVVVTNEKVLGKKIRALGIHQKYGVVISRLNRAGIELVPTGNTTLQFGDVLHMVGRS
Y3135_HAEIE      RSERVVVTNEKVLGKKIRALGIHQKYGVVISRLNRAGIELVPTGNTTLQFGDVLHMVGRS
Y043_HAEI8       RSERVVVTNEKVLGKKIRALGIHQKYGVVISRLNRAGIELVPTGNTTLQFGDVLHMVGRS
Y1470_HAES1      RSERIVVTNEKVLGKRIKHLGIHKKYGVVISRLNRAGVELVPTANTALQFGDVLHIVGRS
Y1071_PASMU      RSDRIVVTNEKVLGKKIRALGIHQKYGVVISRLNRAGVELVPTANTALQFGDVLHVVGRS
Y023_ACTSZ       RTERVVVTNEKILSKKIRTLAFHQQYGVMISRLNRSGVELIPTANTTLQFGDVLHIIGSA
Y966_ACTP2       RSERAVVTNENVFGKKIRHLMLKGKYEVVISRLNRAGVELIPNGEMALQFGDVLNLVGRQ
Y009_DICNV       KNERAVVTNEQVCGKKLAQLQIQSQYDVVISRINRAGVELIPSDEMALQFGDVLHLVGRQ
                 :  * *:*** : . ::  * .: .* * ::*:**:*:**:.  .  *****:*:::*  

YIDE_ECO24       SAIDAVANVLGNAQQKLQQVQMLPVFIGIGLGVLLGSIPVFVPGFPAALKLGLAGGPLIM
YIDE_ECO57       SAIDAVANVLGNAQQKLQQVQMLPVFIGIGLGVLLGSIPVFVPGFPAALKLGLAGGPLIM
YIDE_ECOLI       SAIDAVANVLGNAQQKLQQVQMLPVFIGIGLGVLLGSIPVFVPGFPAALKLGLAGGPLIM
YIDE_SHIFL       SAIDAVANVLGNAQQKLQQVQMLPVFIGIGLGVLLGSIPVFVPGFPAALKLGLAGGPLIM
YIDE_SHISS       SAIDAVANVLGNAQQKLQQVQMLPVFIGIGLGVLLGSIPVFVPGFPAALKLGLAGGLLIM
YIDE_SHIBS       SAIDAVANVLGNAQQKLQQVQMLPVFIGIGLGVLLGSIPVFVPGFPAALKLGLAGGPLIM
YIDE_SHIF8       SAIDAVANVLGNAQQKLQQVQMLPVFIGIGLGVLLGSIPVFVPGFPAALKLGLAGGPLIM
YIDE_SHIDS       SAIDAVANVLGNAQQKLQQVQMLPVFIGIGLGVLLGSIPVFVPRFPAALKLGLAGGPLIM
YIDE_ECOHS       SAIDAVANVLGNAQQKLQQVQMLPVFIGIGLGVLLGSIPVFVPGFPAALKLGLAGGPLIM
YIDE_ECOL6       SAIDAVANVLGNAQQKLQQVQMLPVFIGIGLGVLLGSIPVFVPGFPAALKLGLAGGPLIM
YIDE_ECOUT       SAIDAVANVLGNAQQKLQQVQMLPVFIGIGLGVLLGSIPVFVPGFPAALKLGLAGGPLIM
YIDE_ECOK1       SAIDAVANVLGNAQQKLQQVQMLPVFIGIGLGVLLGSIPVFVPGFPAALKLGLAGGPLIM
YIDE_ECOL5       SAIDAVANVLGNAQQKLQQVQMLPVFIGIGLGVLLGSIPVFVPGFPAALKLGLAGGPLIM
YIDE_SALCH       ASIDAVANVVGNAQQKLQQVQMLPVFIGIGLGVLLGSIPLFVPGFPVALKLGLAGGPLIM
YIDE_SALTY       ASIDAVANVVGNAQQKLQQVQMLPVFIGIGLGVLLGSIPLFVPGFPVALKLGLAGGPLIM
YIDE_SALPA       ASIDAVANVVGNAQQKLQQVQMLPVFIGIGLGVLLGSIPLFVPGFPVALKLGLAGGPLIM
YIDE_SALTI       ASIDAVANVVGNAQQKLQQVQMLPVFIGIGLGVLLGSIPLFVPGFPVALKLGLAGGPLIM
Y031_CITK8       SSIDAVANVVGNAQQKLQQVQMLPVFIGIGLGVLLGSIPLFVPGFPVALKLGLAGGPLIM
Y015_ENT38       SSIDAVADMVGNAQQKLQQVQMLPVFIGIGLGVLLGSIPLYVPGFPVALKLGLAGGPLIM
Y4047_KLEP7      EAIDAVAAELGNAQQKLQQVQMLPVFIGIGLGVLLGSIPLFIPGFPAALKLGLAGGPLIM
Y4083_YERPE      EAIEAVSAIVGNAQQKLQQVQMLPVFIGVGLGVLLGSIPLFVPGFPAALRLGLAGGPLVV
Y3002_YERPA      EAIEAVSAIVGNAQQKLQQVQMLPVFIGVGLGVLLGSIPLFVPGFPAALRLGLAGGPLVV
Y3727_YERPN      EAIEAVSAIVGNAQQKLQQVQMLPVFIGVGLGVLLGSIPLFVPGFPAALRLGLAGGPLVV
Y014_YERPP       EAIEAVSAIVGNAQQKLQQVQMLPVFIGVGLGVLLGSIPLFVPGFPAALRLGLAGGPLVV
Y3906_YERPS      EAIEAVSAIVGNAQQKLQQVQMLPVFIGVGLGVLLGSIPLFVPGFPAALRLGLAGGPLVV
Y4141_YERP3      EAIEAVSAIVGNAQQKLQQVQMLPVFIGVGLGVLLGSIPLFVPGFPAALRLGLAGGPLVV
Y4162_YERE8      ESIEAVSAVVGNAQQKLQQVQMLPVFIGVGLGVLLGSIPLFIPGFPAALRLGLAGGPLVV
Y050_SERP5       ESIEAVAAIVGNAQQKLQQVQMLPVFIGIGLGVLLGSIPLFIPGFPAALRLGLAGGPLVA
Y4401_PECAS      TAIDAVADIVGNAQQKLQQVQMLPVFIGIGLGVLLGSVPLMVPGFPVALRLGLAGGPLVV
Y3492_AERHH      DAIEAVTNVVGNVQQKLQQVQMLPVFIGIGLGVLLGSIPFYLPGFPAALKLGLAGGPLVV
Y825_AERS4       DAIEAVTNVVGNVQQKLQQMQMLPVFIGIGLGVLLGSIPFYLPGFPAALKLGLAGGPLVV
Y2144_PHOPR      EAIESVSGIVGNAHQKLQQVQMLPVFVGIGLGVLLGSIPFYLPGFPAAIKLGLAGGPLLV
Y035_HAEIN       DVLNQAISVIGNAQQKLLQVQMLPVFIGIGLGVLVGSIPFYIPGFPVALKLGLAGGPLVV
Y2670_HAEIG      DVLNQAISVIGNAQQKLLQVQMLPVFIGIGLGVLVGSIPFYIPGFPVALKLGLAGGPLVV
Y3135_HAEIE      DVLNQAISVIGNAQQKLLQVQMLPVFIGIGLGVLVGSIPFYIPGFPVALKLGLAGGPLVV
Y043_HAEI8       DVLNQAISVIGNAQQKLLQVQMLPVFIGIGLGVLVGSIPFYIPGFPVALKLGLAGGPLVV
Y1470_HAES1      DTIGNATSIIGNAQQKLQQVQMLPVFIGIGLGVLLGSIPFYIPGFPVALKLGLAGGPLVV
Y1071_PASMU      EVLNQAVSILGNAQQKLQQVQMLPVFIGIGLGVLLGSIPFHIPGFPVPLKLGLAGGPLVV
Y023_ACTSZ       DVMDKVIEMFGNAQSKLNQVQMLPVFIGIGLGVLLGSIPFSIPGIPVPLKLGLAGGPLVV
Y966_ACTP2       EDIETVRAIIGDAHQKLQQVQMLPIFVGIGLGVLLGSLPLYIPGFPVALKLGLAGGPLVV
Y009_DICNV       KNIATVLSLIGNAQQKLQQVQMLPVFIGIGLGVLLGSIPIYLPGFPVALKLGLAGGPLVV
                   :  .   .*:.:.** *:****:*:*:*****:**:*. :* :*..::****** *: 

YIDE_ECO24       ALILGRIGSIGKLYWFMPPSANLALRELGIVLFLSVVGLKSGGDFVNTLVNGEGLSWIGY
YIDE_ECO57       ALILGRIGSIGKLYWFMPPSANLALRELGIVLFLSVVGLKSGGDFVNTLVNGEGLSWIGY
YIDE_ECOLI       ALILGRIGSIGKLYWFMPPSANLALRELGIVLFLSVVGLKSGGDFVNTLVNGEGLSWIGY
YIDE_SHIFL       ALILGRIGSIGKLYWFMPPSANLALRELGIVLFLSVVGLKSGGDFVNTLVNGEGLSWIGY
YIDE_SHISS       ALILGRIGSIGKLYWFMPPSANLALRELGIVLFLSVVGLKSGGDFVNTLVNGEGLSWIGY
YIDE_SHIBS       ALILGRIGSIGKLYWFMPPSANLALRELGIVLFLSVVGLKSGGDFVNTLVNGEGLSWIGY
YIDE_SHIF8       ALILGRIGSIGKLYWFMPPSANLALRELGIVLFLSIVGLKSGGDFVNTLVNGEGLSWIGY
YIDE_SHIDS       ALILGRIGSIGKLYWFMPPSANLALRELGIVLFLSVVGLKSGGDFVNTLVNGEGLSWIGY
YIDE_ECOHS       ALILGRIGSIGKLYWFMPPSANLALRELGIVLFLSVVGLKSGGDFVNTLVNGEGLSWIGY
YIDE_ECOL6       ALILGRIGSIGKLYWFMPPSANLALRELGIVLFLSVVGLKSGGDFIHTLVDGEGLSWIGY
YIDE_ECOUT       ALILGRIGSIGKLYWFMPPSANLALRELGIVLFLSVVGLKSGGDFIHTLVDGEGLSWIGY
YIDE_ECOK1       ALILGRIGSIGKLYWFMPPSANLALRELGIVLFLSVVGLKSGGDFIHTLVDGEGLSWIGY
YIDE_ECOL5       ALILGRIGSIGKLYWFMPPSANLALRELGIVLFLSVVGLKSGGDFIHTLVDGEGLSWIGY
YIDE_SALCH       ALILGRIGSIGKLYWFMPPSANLALRELGIVLFLAVVGLKSGGDFVDTLTQGEGLSWIGY
YIDE_SALTY       ALILGRIGSIGKLYWFMPPSANLALRELGIVLFLAVVGLKSGGDFVDTLTQGEGLSWIGY
YIDE_SALPA       ALILGRIGSIGKLYWFMPPSANLALRELGIVLFLAVVGLKSGGDFVDTLTQGEGLSWIGY
YIDE_SALTI       ALILGRIGSIGKLYWFMPPSANLALRELGIVLFLAVVGLKSGGDFVDTLTQGEGLSWIGY
Y031_CITK8       ALILGRIGSIGKLYWFMPPSANLALRELGIVLFLAVVGLKSGGDFIDTLTQGDGLSWIGY
Y015_ENT38       ALILGRIGCIGKLYWFMPPSANLALRELGIVLFLSVVGLKSGGDFIDTLAHGEGISWIGY
Y4047_KLEP7      ALILGRIGSIGKLYWFMPPSANLALRELGIVLFLAVVGLKSGGDFVATLTQGDGLSWIAY
Y4083_YERPE      ALILGRIGSIGKLYWFMPPSANLALRELGIVLFLSVVGLKSGGDFINTLVNGDGLAWIGY
Y3002_YERPA      ALILGRIGSIGKLYWFMPPSANLALRELGIVLFLSVVGLKSGGDFINTLVNGDGLAWIGY
Y3727_YERPN      ALILGRIGSIGKLYWFMPPSANLALRELGIVLFLSVVGLKSGGDFINTLVNGDGLAWIGY
Y014_YERPP       ALILGRIGSIGKLYWFMPPSANLALRELGIVLFLSVVGLKSGGDFINTLVNGDGLAWIGY
Y3906_YERPS      ALILGRIGSIGKLYWFMPPSANLALRELGIVLFLSVVGLKSGGDFINTLVNGDGLAWIGY
Y4141_YERP3      ALILGRIGSIGKLYWFMPPSANLALRELGIVLFLSVVGLKSGGDFINTLVNGDGLAWIGY
Y4162_YERE8      ALILGRIGSIGKLYWFMPPSANLALRELGIVLFLSVVGLKSGGDFINTLVNGDGLAWIGY
Y050_SERP5       ALILGRIGSIGKLYWFMPPSANLALRELGIVLFLAVVGLKSGGNFVDTLINGEGLAWIGY
Y4401_PECAS      ALVLGRIGSIGKLHWFMPPSANLALRELGIVLFLSVVGLKSGGDFVDTLLNGDGVWWIGY
Y3492_AERHH      ALILSRIGSIGKLYWFMPPSANLALREIGIVLFLAVVGFKSGAGFIDTLINGDGPAWMMY
Y825_AERS4       ALILSRIGSIGKLYWFMPPSANLALREIGIVLFLAVVGFKSGAGFVDTLINGDGPAWMMY
Y2144_PHOPR      ALILARIGSIGKLYWFMPPSANLALREIGIVLFLAVVGLKSGGGFVDTLVNGDGLSWMGY
Y035_HAEIN       ALILARIGTIGKLYWFMPPSANLALREIGIVLFLAVVGLKSGGSFFDTLVNGSGLEWMGY
Y2670_HAEIG      ALILARIGTIGKLYWFMPPSANLALREIGIVLFLAVVGLKSGGSFFDTLVNGSGLEWMGY
Y3135_HAEIE      VLILARIGTIGKLYWFMPPSANLALREIGIVLFLAVVGLKSGGSFFDTLVNGSGLEWMGY
Y043_HAEI8       ALILARIGTIGKLYWFMPPSANLALREIGIVLFLAVVGLKSGGSFFDTLVNGSGLEWMGY
Y1470_HAES1      ALILARIGSVGKLYWFMPPSANLALREIGIVLFLAVVGLKSGGGFVDTLVHGQGLEWMGY
Y1071_PASMU      ALILARIGSIGKLYWFMPPSANLALREIGIVLFLAVVGLKSGGNFVDTLVNGSGLEWMVY
Y023_ACTSZ       ALILARVGTIGKLYWFMPPSANLALREIGIVLFLSVVGFKSGGNFVHTLINGNGLEWMFY
Y966_ACTP2       ALILARIGSIGKLYWFMPPSANLALREIGIVLFLSVVGLKAGANFLDTLLSPEGLAWMGY
Y009_DICNV       ALVLARIGSIGKLYWFMPPSANLALREIGIVLFLSVIGIHAGEHFFSTLLSKDGFSWICY
                 .*:*.*:* :***:*************:******:::*:::*  *. **   .*  *: *

YIDE_ECO24       GALITAVPLITVGILARMLAKMNYLTMCGMLAGSMTDPPALAFANNLHPTSGAAALSYAT
YIDE_ECO57       GALITAVPLITVGILARMLAKMNYLTMCGMLAGSMTDPPALAFANNLHPTSGAAALSYAT
YIDE_ECOLI       GALITAVPLITVGILARMLAKMNYLTMCGMLAGSMTDPPALAFANNLHPTSGAAALSYAT
YIDE_SHIFL       GALITAVPLITVGILARMLAKMNYLTMCGMLAGSMTDPPALAFANNLHPTSGAAALSYAT
YIDE_SHISS       GALITAVPLITVGILARMLAKMNYLTMCGMLAGSMTDPPALAFANNLHPTSGAAALSYAT
YIDE_SHIBS       GALITAVPLITVGILARMLAKMNYLTMCGMLAGSMTDPPALAFANNLHPTSGAPALSYAT
YIDE_SHIF8       GALITAVPLITVGILARMLAKMNYLTMCGMLAGSMTDPPALAFANNLHPTSGAAALSYAT
YIDE_SHIDS       GALITAVPLITVGILARILAKMNYLTMCGMLAGSMTDPPALAFANNLHPTSGAAALSYAT
YIDE_ECOHS       GALITAVPLITVGILARMLAKMNYLTMCGMLAGSMTDPPALAFANNLHPTSGAAALSYAT
YIDE_ECOL6       GALITAVPLITVGILARMLAKMNYLTMCGMLAGSMTDPPALAFANNLHPTSGAAALSYAT
YIDE_ECOUT       GALITAVPLITVGILARMLAKMNYLTMCGMLAGSMTDPPALAFANNLHPTSGAAALSYAT
YIDE_ECOK1       GALITAVPLITVGILARMLAKMNYLTMCGMLAGSMTDPPALAFANNLHPTSGAAALSYAT
YIDE_ECOL5       GALITAVPLITVGILARMLAKMNYLTMCGMLAGSMTDPPALAFANNLHPTSGAAALSYAT
YIDE_SALCH       GIFITAIPLITVGLLARIFAKMNYLTLCGMLAGSMTDPPALAFANNLHATSGAAALSYAT
YIDE_SALTY       GIFITAIPLITVGLLARIFAKMNYLTLCGMLAGSMTDPPALAFANNLHATSGAAALSYAT
YIDE_SALPA       GIFITAIPLITVGLLARIFAKMNYLTLCGMLAGSMTDPPALAFANNLHATSGAAALSYAT
YIDE_SALTI       GIFITAIPLITVGLLARIFAKMNYLTLCGMLAGSMTDPPALAFANNLHATSGAAVLSYAT
Y031_CITK8       GIFITAIPLITVGLLARIFAKMNYLTLCGMLAGSMTDPPALAFANNLHATSGAAALSYAT
Y015_ENT38       GFFITAVPLLTIGILARIFTNMNYLTLCGMLAGSMTDPPALAFANNLHATSGAAALSYAT
Y4047_KLEP7      GIFITAIPLLTVGVLARMLAKMNYLTLCGMLAGSMTDPPALAFANNLHATSGAAALSYAT
Y4083_YERPE      GAMITGIPLLTVGILARMLVKMNYLTLCGMLAGSMTDPPALAFANGLHPTSGAAALSYAT
Y3002_YERPA      GAMITGIPLLTVGILARMLVKMNYLTLCGMLAGSMTDPPALAFANGLHPTSGAAALSYAT
Y3727_YERPN      GAMITGIPLLTVGILARMLVKMNYLTLCGMLAGSMTDPPALAFANGLHPTSGAAALSYAT
Y014_YERPP       GAMITGIPLLTVGILARMLVKMNYLTLCGMLAGSMTDPPALAFANGLHPTSGAAALSYAT
Y3906_YERPS      GAMITGIPLLTVGILARMLVKMNYLTLCGMLAGSMTDPPALAFANGLHPTSGAAALSYAT
Y4141_YERP3      GAMITGIPLLTVGILARMLVKMNYLTLCGMLAGSMTDPPALAFANGLHPTSGAAALSYAT
Y4162_YERE8      GAMITGIPLLTVGILARMLAKMNYLTLCGMLAGSMTDPPALAFANGLHPTSGAAALSYAT
Y050_SERP5       GALITAIPLFSVGVLARMVGKMNYLTLSGMLAGSMTDPPALAFANGLHPTSGAAALSYAT
Y4401_PECAS      GALITIVPLLAVGILARTLGKMNYLTLCGMLAGSMTDPPALAFANGLHPTSGAAALSYAT
Y3492_AERHH      GVAITLIPLLVVGVLARLYGKMNYLTLCGLLAGSMTDPPALAFANGMHPTSGASALSYAT
Y825_AERS4       GMAITLIPLLVVGVLARLYGKMSYLTLCGLLAGSMTDPPALAFANGMHPTSGASALSYAT
Y2144_PHOPR      GIVITLVPLLTVGFLARIVGQLNYLTICGMLAGSMTDPPALAFANGLHPTSGASALSYAT
Y035_HAEIN       GIFITFVPLIIVGTIARLYGKLNYLTICGLLAGSMTDPPALAFANEIKEDNGAAALSYAT
Y2670_HAEIG      GIFITFVPLIIVGTIARLYGKLNYLTICGLLAGSMTDPPALAFANEIKEDNGAAALSYAT
Y3135_HAEIE      GIFITFVPLIIAGTIARLYGKLNYLTICGLLAGSMTDPPALAFANEIKEDNGAAALSYAT
Y043_HAEI8       GIFITFIPLMITGILARLYGKLNYLTICGLLAGSMTDPPALAFANEIKEDNGAAALSYAT
Y1470_HAES1      GMFITFIPLMITGIIARLYMKLNYLSLCGLLAGSMTDPPALAFANAIKEDSGIAALSYAT
Y1071_PASMU      GIFITFVPLMIVGIVARLYAKMNYLSLCGLLAGSMTDPPALAFANAIKEESGASALSYAT
Y023_ACTSZ       GIFITFVPLLITGIIARIYAKLNYLSICGLVAGSMTDPPALAFANSLKENCGASALAYAT
Y966_ACTP2       GAIITFIPLIVTGFVARIYGKMNYLSLCGLLSGAMTDPPALAFANEIKDGHGAAALSYAT
Y009_DICNV       GAIITLLPLLIAGIIARYYSKMNYLTICGLLAGAMTDTPALAFANAIQENNGASVLAYAT
                 *  ** :**:  * :**   ::.**::.*:::*:***.******* ::   * ..*:***

YIDE_ECO24       VYPLVMFLRIITPQLLAVLFWSIG
YIDE_ECO57       VYPLVMFLRIITPQLLAVLFWSIG
YIDE_ECOLI       VYPLVMFLRIITPQLLAVLFWSIG
YIDE_SHIFL       VYPLVMFLRIITPQLLAVLFWSIG
YIDE_SHISS       VYPLVMFLRIITPQLLAVLFWSIG
YIDE_SHIBS       VYPLVMFLRIITPQLLAVLFWSIG
YIDE_SHIF8       VYPLVMFLRIITPQLLAVLFWSIG
YIDE_SHIDS       VYPLVMFLRIITPQLLAVLFWSIG
YIDE_ECOHS       VYPLVMFLRIITPQLLAVLFWSIG
YIDE_ECOL6       VYPLVMFLRIITPQLLAVLFWSIG
YIDE_ECOUT       VYPLVMFLRIITPQLLAVLFWSIG
YIDE_ECOK1       VYPLVMFLRIITPQLLAVLFWSIG
YIDE_ECOL5       VYPLVMFLRIITPQLLAVLFWSIG
YIDE_SALCH       VYPLVMFLRIITPQLLAVIFWGMG
YIDE_SALTY       VYPLVMFLRIITPQLLAVIFWGMG
YIDE_SALPA       VYPLVMFLRIITPQLLAVIFWGMG
YIDE_SALTI       VYPLVMFLRIITPQLLAVIFWGMG
Y031_CITK8       VYPLVMFLRIITPQLLAVLFWGLG
Y015_ENT38       VYPLVMFLRIITPQLLAVLFWGMG
Y4047_KLEP7      VYPLVMFLRIITPQLLAVLFWGLS
Y4083_YERPE      VYPLAMFLRIMSPQILAVLFWTL-
Y3002_YERPA      VYPLAMFLRIMSPQILAVLFWTL-
Y3727_YERPN      VYPLAMFLRIMSPQILAVLFWTL-
Y014_YERPP       VYPLAMFLRIMSPQILAVLFWTL-
Y3906_YERPS      VYPLAMFLRIMSPQILAVLFWTL-
Y4141_YERP3      VYPLAMFLRIMSPQILAVLFWTL-
Y4162_YERE8      VYPLAMFLRIMSPQILAVLFWTL-
Y050_SERP5       VYPLAMFLRIMSPQLLAVLFWAM-
Y4401_PECAS      VYPLAMFLRIMSPQLLAVLFLTL-
Y3492_AERHH      VYPLVMFLRIISPQLLAILLWAGA
Y825_AERS4       VYPLVMFLRIISPQLLAILLWAGV
Y2144_PHOPR      VYPLVMCLRILSPQILALLLWAV-
Y035_HAEIN       VYPLVMFLRIMSPQLLAVLLWAA-
Y2670_HAEIG      VYPLVMFLRIMSPQLLAVLLWAA-
Y3135_HAEIE      VYPLVMFLRIMSPQLLAVLLWAA-
Y043_HAEI8       VYPLVMFLRIMSPQLLAVLLWAA-
Y1470_HAES1      VYPLSMFLRIMSPQLLAILLWTAM
Y1071_PASMU      VYPLVMFLRIISPQLLAILLWTLL
Y023_ACTSZ       VYPLVMFLRIISPQLLAILLWRAV
Y966_ACTP2       VYPLVMFLRIILPQLLAILLWTAS
Y009_DICNV       VYPLTTFLRIMLPQLIAVLLWAAH
                 ****   ***: **::*:::