CLUSTAL format seed alignment for MF_01018

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

HIS1_BACSU       ---------MGKLLTMAMP-KGRIFEEAAGLLRQAGYRLPEEFEDSRK-LIIDVPEENLR
HIS1_BACVZ       ---------MGKVLTMAMP-KGRIFEEAAGLLRQAGYRLPEEFEESRK-LIIDVPEENLR
HIS1_BACHD       ----------MSMLTVAMP-KGRIFDEAVGLLRKAGYNLPAEFEASRK-LIVDVPEENMR
HIS1_CALS4       ----------MDIVSIALP-KGRMTEDAVVLFKKAGISNDVLKDISRK-LILEDNKNAIK
HIS12_GEOSL      ---------MTDYITIAIP-KGRILEESVTLFGKIGINCDELLSNTRK-LIFENHEQRMR
HIS1_NEIMA       --------MQDNALTIALS-KGRIFEETLPLLAAAGIVPTEEPEKSRK-LIIGTNHENIR
HIS1_CHRVO       -----------MKLTIALS-KGRIFEETLPLLAAAGIVPAENPESSRK-LIIGTNHPDVQ
HIS1_BORBR       ------MSPAAAPLTLALS-KGRIFEETMPLLAEAGIEVPENPESSRK-LILPTSDPGLR
HIS1_BORPA       ------MSPAAAPLTLALS-KGRIFEETMPLLAEAGIEVPENPESSRK-LILPTSDPGLR
HIS1_BORPE       ------MNPAAAPLTLALS-KGRIFEETMPLLAEAGIEVPENPESSRK-LILPTSDPGLR
HIS1_NITEU       ----------MPDITIALS-KGRIFEDTIPFLKAAGIVPSDDPDTSRK-LIIGTNRPDVR
HIS1_PSEPK       ------------MLTIALS-KGRILDDTLPLLAEAGIVPTENPDKSRK-LIIPTTQDDVR
HIS1_PSESM       ------------MLTIALS-KGRILDDTLPLLAEAGIVPTENPDKSRK-LIIPTTQADVR
HIS1_PSEAE       ------------MLTIALS-KGRILDDTLPLLAAAGIVPSENPDKSRK-LIIPTSLSDVR
HIS1_LISIN       ----------MKALKIALT-KGRLEKDAVALLEKAGIDCSSMNDKKRK-LIFHSSTQPIS
HIS1_LISMO       ----------MKALKIALT-KGRLEKDAVALLEKAGIDCSSMTDKKRK-LIFHSSTQPIS
HIS1_BACAN       ----------MRNIQIALT-KGRLEKHVIPLFEQIGIDCSELKNKGRK-LVFQSKNTDIS
HIS1_BACCR       ----------MRNIQIALT-KGRLEKHVIPLFEQIGIDCSELKNKGRK-LVFQSKNTNVS
HIS1_STRMU       ---------MTKQLTIALT-KGRIEKDTVKLLERAGFDMSFMADKGRN-LIFESPDKSFR
HIS1_CLOAB       -------MDKNKTIRIALT-KGRLEKAAVEIFENIGLDCSELKDKGRK-LIFHDFKNSID
HIS1_LACPL       --------MTEPRLKIALT-KGRVEQQVLPLLEEAGLDCSQVRNKQRR-LIFDSETQPYE
HIS1_LACLA       ------------MIKIAIT-KGRIQKQVTKLLENADYDVEPILNLGRE-LQIKTKDD-LQ
HIS1_OCEIH       ----------MQPVTIALA-KGRPAKQTIKLLQAAGLTFEELDATSRK-LVFYNEDRTAR
HIS1_STAAM       ------------MLRIAIA-KGRLMDSLINYLDVIEYTTLSETLKNRE-RQLLLSVDNIE
HIS1_STAES       ------------MLRVALA-KGRLLKSFIEYLQQVNQIDIATVLLNRQ-RQLLLTVDNIE
HIS1_PYRFU       -------------MRFVLP-KGRLYQDSIKVLELAG----IKVPKRDE-RALIWGDGNNE
HIS1_SYNY3       ------------MLTIALP-KGSLLRDSIDRFQQIGLDFSAFLEPKNRQLQILDPTHRAK
HIS1_THEEB       ------------MLTIALP-KGALLKDSVAYFQRLGLNFEALLEPANRQLQVLSQDGRAR
HIS1_NOSS1       ------------MLTVALP-KGELLKNSIRLLQSVGLDFSAFLDSGNRQLQITDASGTAK
HIS1_PROMM       ------------MITVALA-KGALLNDSVARFQSAGLDFSAVLDPGNRQLMVPSHCGRAR
HIS1_SYNPX       ------------MITVALA-KGALLKDSAARFAAAGLDFSAALDKDNRQLMLPTPCGRAR
HIS1_PROMA       ------------MITVALA-KGALLKDSVTRLAQAGLDFSAVLDPTNRLLMVPSACGRAK
HIS1_GLOVI       -----------MNITIALP-KGALLKGTIARLQAIGIDFGEFLEGSNRLLRLEDRSGRYE
HIS1_PROMP       ------------MITIALP-KGALLEDSISIFKKAGLNFSDALLENSRSLTVESKCKRAK
HIS1_DEIRA       MTAQTTPERRPDHLTLALP-KGRIMDDAIALLSQAGLPLTRPEASRALRHEFPG----VT
HIS1_HELHP       ------------MIKVALP-KGRIANESLALF-ERLYGSKFVFDDRK--LILE--HQGFI
HIS1_WOLSU       ------------MITVALP-KGRIAEETLDRF-EKIFGERFVFEDRK--LILE--RGEFK
HIS1_AQUAE       ------------MIKVALP-KGRLFEETVDLLLKRGIIEKRIEEGRK--LILE--EGGIT
HIS1_LEPIN       ------------MLTLALP-KGRLAEESIDLMISKGWLSSKPDPNSKE-LIYNDPKGKIR
HIS1_THEMA       ------------MLKLAIP-KGRLEEKVMTYLKKTGVIFERESSILRE-------GKDIV
HIS1_AGRFC       ------------MITIALPSKGRMKEDASAVLERAGLKVASVGNDRSYRGRIEG-RDDIE
HIS1_RHIME       -----------MTVTIALPSKGRMKDEASAIFERAGMKIAAVGSDRSYRGRVEG-WDDVE
HIS1_BRUME       -----------MSVTLAFPSKGRLKENTLAVLEKAGYKVVLPDDDRNYRARVEG-EDDLD
HIS1_BRUSU       -----------MSVTLALPSKGRLKEKTLAVLEKAGYKVVLPDDDRNYRARVEG-EDDLD
HIS1_RHILO       ------------MITLAIPSKGRLKEQALEVLAKAGLAISLPGDERKYHARVEG-LDNVE
                              : ..:. **         :                            

HIS1_BACSU       FILAKPMDVTTYVEHGVADVGIAGKDVMLEEERD----VYEVLDLNISKCHLAVAGLP--
HIS1_BACVZ       FILAKPMDVTTYVEHGVADAGIAGKDVMLEEERD----VYEVLDLKISKCHLAVAGLP--
HIS1_BACHD       FILAKPMDVPTYVEHGVADVGVAGKDVMLEEERD----VYEVLDLKISECYLAVAGLP--
HIS1_CALS4       FMLVKPMDVPTYVEHGAADLGVCGKDILLEQKKD----LYEVLDLKFGFCRMVVAGPP--
HIS12_GEOSL      YMIVRATDVPTYVEYGCADLGIVGKDTLMEQEKD----LYEPLDLKFGYCRMMVAEPAGL
HIS1_NEIMA       LVIVRATDVPTYVRYGAADFGIAGKDVLIEHGGT---GLYRPLDLEIAKCRMMVAVRKGF
HIS1_CHRVO       LVIVRASDVPTYVQYGAADLGIAGRDVLIEHGGA---GLYQPLDLNIAKCKMMVAVQEGF
HIS1_BORBR       LIIVRASDVPTYVQYGAADLGIAGKDVLIEHAAQQSGRLYQPIDLNIAKCRLCVAVRQDF
HIS1_BORPA       LIIVRASDVPTYVQYGAADLGIAGKDVLIEHAAQQSGRLYQPIDLNIAKCRLCVAVRQDF
HIS1_BORPE       LIIVRASDVPTYVQYGAADLGIAGKDVLIEHAAQQSGRLYQPIDLNIAKCRLCVAVRQDF
HIS1_NITEU       LVMVRATDVPTYVQYGAADLGVAGKDVLLEHDGI---GLYQPLDLKIARCRMMVAVRDDY
HIS1_PSEPK       LLIVRATDVPTYVEHGAADLGVAGKDVLMEYGGQ---GLYEPLDLQIAQCKLMTA-----
HIS1_PSESM       LLIVRATDVPTYVEHGAADLGVAGKDVLMEYTGQ---GLYEPLDLQIAKCRLMTA-----
HIS1_PSEAE       LLIVRATDVPTYVEHGAADLGVAGKDVLMEYGGQ---GLYEPLDLRIANCKLMTA-----
HIS1_LISIN       FILVKAVDVMTYVKHGVADIGIVGKDVLMEAS----KSHYEMLDLEIGQCQFCLASTPD-
HIS1_LISMO       FILVKAVDVMTYVKHGVADIGIVGKDVLMEAS----KSHYEMLDLEIGKCQFCLASTPD-
HIS1_BACAN       FILVKAVDVATYVEHGVADIGVVGKDILMENE----KDIYEMLDLGVGVCKFCVASIPT-
HIS1_BACCR       FILVKAVDVATYVEHGVADIGIVGKDILMENE----KDIYEMLDLGVGICKFCVASIPT-
HIS1_STRMU       FLLVKAPDVTTYVRHGVADIGVVGKDVLIEHP----TGYLEMLDLNFGLCKFSVASTPD-
HIS1_CLOAB       FVLVKAPDVLTYVEHGAADIGIVGKDTLLEMK----KDFYEVLDLKVGKCKFSLASISS-
HIS1_LACPL       FILAKGPDVTTFLERGAADIGIVGSDILTEHE----STQYELLDLGVGKCQFVLASTAD-
HIS1_LACLA       IIFGKPNDVITFLEHGIVDIGFVGKDTLDENDF---DDYYELLYLKIGQCIFALASYPD-
HIS1_OCEIH       VIFLKGMDVPIYVEKGAADIGIVGKDNIIESQ----AEVYELLDLGIGKCKFSIAAKQG-
HIS1_STAAM       CILVKGSDVPIYVEQGMADIGIVGSDILDERQYN----VNNLLNMPFGACHFAVAA----
HIS1_STAES       MILVKGSDVPTYVEQGIADVGIVGSDILNGQKYN----INKLLDLPFGKCHFALAA----
HIS1_PYRFU       FLLARAFDVPVYVEHGI-DIGIAGSDVVEERGSD----VFIPLELPFGKCRLSIAVPKE-
HIS1_SYNY3       ALLVRAWDVPVYVEYGQAQLGIVGYDILREKKPA----VAQLADLNFGGCRLSVAVPQAS
HIS1_THEEB       ALLVRAQDVPVYVQYGQAQLGIVGYDVLREKNPH----VAKLADLGFGQCRLSVAVKASS
HIS1_NOSS1       GLLVRGQDVPVYVEYGQAQIGIIGYDVLREKQPQ----VAHLVDLQFGYCRMSVAVKASS
HIS1_PROMM       ALLVRNGDVPVYVAYGQAQLGVVGYDVLREHQMP----VAQLVDLGFGGCRMAVAVKASS
HIS1_SYNPX       ALLVRNGDVPTYVAYGQAQLGVVGYDVLREHQLP----VAQLVDLGFGGCRMAVAVKASS
HIS1_PROMA       ALLVRNGDVPVYVAYGQAQLGIVGFDVLSEKQMP----VANLVDLGFCGCRMSVAVKATS
HIS1_GLOVI       GLLVRAQDVPVYVAYGQAQVGIVGFDVLKEKQLP----VAQVADLGFGYCRMSVAVKSDS
HIS1_PROMP       ALLVRNGDVPVYVSYGQADLGIVGYDVLQESELK----VAKLLDLEFGGCHMSLAVKNNS
HIS1_DEIRA       VLELRNQDVPVYVDLGVADAGIVGKDVLLEAGRP----VYEPVDLHFAECRLSLIREIGA
HIS1_HELHP       FMLVRSQDVPTYVIHQAVDIGIVGLDVIEEQQAN----VVKLLNLGIGKCKV-VVGSELG
HIS1_WOLSU       FLLVRNQDVPTYVLHQAADIGIVGLDVLEEQESD----LIRLLDLGIGRCKV-VIGSPMG
HIS1_AQUAE       FFLVKPSDVPVYVESGVSDLGVCGYDVYLEKKPS----VYRLMDLGIGFCRIAVAGKPES
HIS1_LEPIN       ILLVRSQDVATYVEQCAADAGISGWDVLKEGGYD----LATPLDLKIGKCRL-SLAAPNG
HIS1_THEMA       CFMVRPFDVPTYLVHGVADIGFCGTDVLLEKETS----LIQPFFIPTNISRMVLAGPKG-
HIS1_AGRFC       VAYLSASEIAREIGAGTVDFGVTGEDLVREGLTNADAQVEFCARLGFGHADVVVAVPEIW
HIS1_RHIME       IAYLSASEIAREIGSGAVDFGVTGEDLVREGLADADARVDFAARLGFGHADVVVAVPEIW
HIS1_BRUME       ILFLSASEIARKLGYGSVDLGVTGEDLVRETLAHADERVAIEAQLGFGHADVVVAVPEVW
HIS1_BRUSU       ILFLSASEIARELGYGSVDLGVTGEDLARETLAHADERVAIEAQLGFGHADVVVAVPEVW
HIS1_RHILO       IAFLSASEIAGEIGQGAVDLGITGEDLVRENLADWEARAEIAARLGFGHADVVVAVPEIW
                        ::   :     : *. * *                  :    . .        

HIS1_BACSU       --------------NTDW-SGVAPRIATKYPNVASSYFREQG--EQVEIIKLNGSIELAP
HIS1_BACVZ       --------------GADW-NGVAPRIATKYPNVASSYFREQG--EQVEIIKLNGSIELAP
HIS1_BACHD       --------------NYEKKHDLNPKVASKYPHLATRYFKEQG--EQVEIIKLNGSIELAP
HIS1_CALS4       --------------NVKDSFLTNKRVATKFPNVAEEFFKKKG--ENVEIIKLNGSVELAP
HIS12_GEOSL      A------------LDDDPSSWTNIRIATKYPNVTEKYFARKG--VQVEIIKLYGSIELAP
HIS1_NEIMA       D------------YEAASQPGCRLKIATKYPEIAASHFAGKG--VHVDIIKLYGSMELAP
HIS1_CHRVO       D------------YDAAVRRGARLKIATKYPQIAREHFAKKG--VHVDIIKLYGSMELAP
HIS1_BORBR       D------------YQAAVHQGARLRVATKYVQSAREHFAAKG--VHVDIIKLYGSMELAP
HIS1_BORPA       D------------YQAAVHQGARLRVATKYVQSAREHFAAKG--VHVDIIKLYGSMELAP
HIS1_BORPE       D------------YQAAVHQGARLRVATKYVQSAREHFAAKG--VHVDIIKLYGSMELAP
HIS1_NITEU       D------------YASAVFRGARLRVATKYVKTARNHFAAKG--MHVDLIKLYGSMELAP
HIS1_PSEPK       G------------VVGAAEPKGRLRVATKFVNVAKRYYAEQG--RQVDIIKLYGSMELAP
HIS1_PSESM       G------------AIGAVEPKGRLRVATKFVNVAKRYYAEQG--RQVDIIKLYGSMELAP
HIS1_PSEAE       G------------AIGAPEPKGRLRVATKFVNVAKRYYAEQG--RQVDVIKLYGSMELAP
HIS1_LISIN       --------------FDPSS-YRRKIIATKYPAVSSKFFRAKG--EDVEIIKIEGSVEIAP
HIS1_LISMO       --------------FDPSS-YRRKIIATKYPTVASKFFREKG--EDVEIIKIEGSVEIAP
HIS1_BACAN       --------------YNPKS-YRKKCIATKYPHITSNYFHNKG--EDVEIIKIEGSVEIAP
HIS1_BACCR       --------------YNPKS-YRKKRIATKYPHITSTYFHDKG--EDVEIIKIEGSVEIAP
HIS1_STRMU       --------------YNPSD-HKRKRIATKYPTVARDFFNQKG--EDVEIISIQGSVEIAP
HIS1_CLOAB       --------------FKLNEGFNRMKIATKYPNVTREYFREKG--IDVEIIKIEGSVELAP
HIS1_LACPL       --------------FDPVA-PRRKIIGTKYPLITQRYFDRLG--QDVEIIKIEGSVELAP
HIS1_LACLA       --------------FSNKNFQRHKRIASKYPRVTKKYFAQKQ--EDIEIIKLEGSVELGP
HIS1_OCEIH       --------------VTLSS-DNEITIATKYPIVAKRYFSKRN--QSIDVVKLNGSVELAP
HIS1_STAAM       ----------------KPETTNYRKIATSYVHTAETYFKSKG--IDVELIKLNGSVELAC
HIS1_STAES       ----------------KPETSCYKKVATSYVHTATQFFNKEG--MDVEVIHLNGSVELSC
HIS1_PYRFU       -------------KVVDPENMDGYKIATKYPNITKRYFENLN--IEVEVIKLHGSIELAP
HIS1_SYNY3       P------------YRRSVDLPPHGRVASKFVHCALEHFRRLD--LPVEIIPLYGSVELGP
HIS1_THEEB       P------------YRSARDLPPHCRVASKFVRCADAFFQQLD--LPVDIVPLYGSVELGP
HIS1_NOSS1       P------------YKSPLDLPAHSRVASKYVNSAREFFQGLD--LPVEIVPLYGSVELGP
HIS1_PROMM       G------------YQHAADLPPHCRVASKFTHCAREFFDALD--LPVELVHLTGSVELGP
HIS1_SYNPX       G------------YERAADLPPHCRVASKFTHCAREYFDGLD--LPVELVHLNGSVELGP
HIS1_PROMA       G------------YRSAVELPPHCRVASKFTSCARQFFEDID--LPVELVHLTGSVELGP
HIS1_GLOVI       P------------YRSVQDLPAHCRVASKFTTCARSYFEERE--LPVELIPLYGSVELAP
HIS1_PROMP       N------------YLKPTDLPANCKVASKFTKTARAYFDDLN--IPVEIVHLTGSVELGP
HIS1_DEIRA       -------------------SGPIARVGTKYPRAARAYLQERG--IPAEVVKLSGNIELAA
HIS1_HELHP       --------------KSIDYQKPQLKIATKMPHITRKYFSNKA--ISIEALKLYGSIELAP
HIS1_WOLSU       --------------SEIDYSKPQIKIATKMTNIAKKHFAKQA--LAVDLIKLYGSIELAP
HIS1_AQUAE       --------------EEKYFSSTHISVATKYPNIAYEFFKKKG--VKADIYYLNGSVELAP
HIS1_LEPIN       --------------FTLEAHHRKIRVATKYPNLAREFFFLKG--LSCEIFKLYGSIELAP
HIS1_THEMA       ----------------RGIPEGEKRIATKFPNVTQRYCESKG--WHCRIIPLKGSVELAP
HIS1_AGRFC       LDVDSMADLGDVASEFRARHGRRLAIATKYWRLTQQFFSRQHGIQLYRIVESLGATEGAP
HIS1_RHIME       YDVDTMADLGDVAADFRARHGRRLAIATKYWRLTQQFFSGSHGIQLYRIVESLGATEGAP
HIS1_BRUME       RDVTTMADLDDVAADFRQRHGRRLRIATKYWRLTQQFFSQKHGIQVYRIVESLGATEGAP
HIS1_BRUSU       RDVTTMADLDDVAADFRQRHGRRLRIATKYWRLTQQFFSQKHGIQVYRIVESLGATEGAP
HIS1_RHILO       LDVDTMADLDDVAADFRQRHGRRLRIATKYWRLTQQFFSQKHGIQVYRIVESLGATEGAP
                                          :.:.    :  .                *  * . 

HIS1_BACSU       LIGLADRIVDIVSTGQTLKENGLVETEHICDITSRFIVNPVSYRMKDDVIDEMASRLSLV
HIS1_BACVZ       LIGLADRIVDIVSTGRTLKENGLVESEHICDITSRFIVNPVSYRMKDDVIDEMAARLARV
HIS1_BACHD       LIGLADRIVDIVSTGRTLRENGLVELEKMMTITSRLIVNPVSYRMKDERIDEMVERLLQV
HIS1_CALS4       IVGLSEVIVDIVETGRTLRENGLVVIEEIFPSTARLIVNKASMKTKSERIKDIILKLREV
HIS12_GEOSL      LVGLSERIVDLVSTGETLRQNGLVEVETIAEITTRLIVNRASLKTKHPRITEIIEGLEKH
HIS1_NEIMA       LVGLSDAIVDLVSTGNTLKANGLEAVEHIVDISSRLVVNKAALKTKYALLEPIIQAFGGA
HIS1_CHRVO       LVGLADAIVDLVSTGGTLRANKLAAVEHIIDISSRLVVNQAALKLKYDAIQPVLDAFAGA
HIS1_BORBR       LVGLADAIVDLVSTGGTLRANGLAAVEDVMPISSRLIVNQAALKTRGARLQPLIDAFRRA
HIS1_BORPA       LVGLADAIVDLVSTGGTLRANGLAAVEDVMPISSRLIVNQAALKTRGARLQPLIDAFRRA
HIS1_BORPE       LVGLADAIVDLVSTGGTLRANGLAAVEDVMPISSRLIVNQAALKTRGARLQPLIDAFRRA
HIS1_NITEU       LVDLADAIVDLVSTGSTLKANHLQAIEEIMPISARLIVNQAALKLKNTAIQPLLETFSAA
HIS1_PSEPK       LINLADKIIDVVDTGNTLRANGLEPQELIATISSRLVVNKASMKMQHARIQSLIDTLRAA
HIS1_PSESM       LIGLADKIIDVVDTGNTLRANGLEPQELIATISSRLVVNKASMKMQHARIQALIDTLRKA
HIS1_PSEAE       LVGLADKIIDVVDTGNTLRANGLEPQELIATISSRLVVNKASMKMQHGRIQSLIDTLRDA
HIS1_LISIN       VLGLADAIIDIVETGSTLKENGLVIYEKMYPISARLIVNKASLKQNKTQIFQLIDQLEQA
HIS1_LISMO       VLDLADAIIDIVETGSTLKENGLIIYEKMYPISARLIVNKASLKQNKTQIFHLIDQLEQA
HIS1_BACAN       ILGLADAIVDIVETGKTLQENGLIVFEEMYSISARMIVNKAALKTKKDEIFSIINMMEQE
HIS1_BACCR       LLGLADAIVDIVETGKTLQENGLIVFEEMYFISARMIVNKAALKTKKDEIFSIINMMEQE
HIS1_STRMU       VIGLADAIVDIVETGNTLVANGLEVFEDICRISARMIVNKASLK-NKPELLAFIKKMENL
HIS1_CLOAB       ILNLADAIVDIVETGTTLKENGLVIFDDICDISARMIVNRASMKLNKDRITDIIQKVKNY
HIS1_LACPL       LTGLADAIVDITETGTTIRENHLQIYDYLQPVSTRLVVNRLALKQQQAAIFDLVDRLATV
HIS1_LACLA       VVGLADAIVDIVETGNTLSANGLEVIEKISDISTRMIVNKSSFKFKKDKIIEMVERLEDA
HIS1_OCEIH       LIGLADYIVDIVETGNTLRENGLEILEDIETISTKAIVNKASFATRSAEIQSIINRLSTV
HIS1_STAAM       VVDMVDGIVDIVQTGTTLKANGLVEKQHISDINARLITNKAAYFKKSQLIEQFIRSLEVS
HIS1_STAES       VVDMVDAIVDIVQTGSTLTANGLVEKKYISEINAKLITNKESYFKQSSEIERLIKQLGVS
HIS1_PYRFU       RIGIADAIVDIVETGNTLRSNGLVEVAKIMDVSALLLVNRISQKMFFEEINSFITKIRRS
HIS1_SYNY3       ITGMSEAIVDLVSTGRTLQENGLMEIEVLFDSSARLIAHPLSYRVNGDRLLDWVEKLRSV
HIS1_THEEB       ITGMAEAIVDLVSTGRTLKENGLVEIEQIFSSTAYLIAHPRSYRLNLNGLGHYVPQLTGA
HIS1_NOSS1       ITGMSEAIVDIVSTGRTLKENGLVEITTLYESTARLIAHPLSYRLNTGNLHQLVEQLREG
HIS1_PROMM       LTGIAEAIVDLVATGRTLRDNGLVAIEELFQSSARLIGHPLALRLDRGDLQLIVEAMRIQ
HIS1_SYNPX       ITGMSEAIVDLVATGRTLRDNGLVAIEDLFHTTARLVGHPLSMRLDDGSLNAIVEAVRTA
HIS1_PROMA       LTGIAEAIVDLVATGRTLRENGLIEIDQLFYSTARLIAHPLSLRLDNGRLQEIIEIMQSS
HIS1_GLOVI       LTGMAEAIVDLVSTGRTLKDNGLVELEKIFDSTARLIAHPLSYRLGRVGLHELLGQIRTA
HIS1_PROMP       ITGMAEAIVDLVATGKTLKENGLSKIDDLFYSTARLIANPLSLRLDSNPLRDVILSIESS
HIS1_DEIRA       LTGLADAVIDLVQTGSTLRANHLEEVDVLFHSSARLIVNRTALKLRRERLRPLIARLREL
HIS1_HELHP       LVGLSDAIVDIVETGVTMKQNNLKIDEVIMESSAYLIANKNSFYEKKELILALYERLKST
HIS1_WOLSU       LVGLADAIVDIVETGTTMKQNHLKIDEVIMESSAYMVANRNSFYEKKDKILELQRQFSKL
HIS1_AQUAE       LVGLSDFILDLVQTGRTLKENGLIVIEEVGKSTAWLIANKDSFRIKNGQIMEFLSRLVQH
HIS1_LEPIN       LVGLSDCIVDLVSTGGTLKANGLKELDIILESSARLVFNRSSLYGKRKEAVEFMDSLSKI
HIS1_THEMA       IAGLSDLIVDITETGRTLKENNLEILDEIFVIRTHVVVNPVSYRTKREEVVSFLEKLQEV
HIS1_AGRFC       AAGQADIIVDITSTGSTLKANHLKILSDGIIVRSEACFVRARKPEHEGD-AAIQEIASRI
HIS1_RHIME       ASGSADIIVDITSTGSTLKANHLKILSDGVILRSEACLVRARKATHEGN-PVIDRIVAAV
HIS1_BRUME       AAGSADMIVDITSTGSTLRANRLKVLEDGIILRSQACLVSARRSHTS---RRVEEIAARI
HIS1_BRUSU       AAGSADMIVDITSTGSTLRANRLKVLEDGIILRSQACLVSARRSHTS---RRVEEIAARI
HIS1_RHILO       AAGLADVIVDITTTGSTLRANHLKVLGDGVVLKSQACLVASKKARTAGDEATLRDIVTKM
                   .  : ::*:. ** *:  * *          :                          

HIS1_BACSU       VEGETAK----
HIS1_BACVZ       VEGETAQ----
HIS1_BACHD       VEGDGA-----
HIS1_CALS4       INGG-------
HIS12_GEOSL      V----------
HIS1_NEIMA       VKAK-------
HIS1_CHRVO       VPA--------
HIS1_BORBR       SERIA------
HIS1_BORPA       SERIA------
HIS1_BORPE       SERIA------
HIS1_NITEU       VPKNL------
HIS1_PSEPK       VESRHRG----
HIS1_PSESM       VESRHRC----
HIS1_PSEAE       VEARHRH----
HIS1_LISIN       IKEEQTR----
HIS1_LISMO       IKEELAE----
HIS1_BACAN       ILSGK------
HIS1_BACCR       ILSGK------
HIS1_STRMU       VGDREVAFK--
HIS1_CLOAB       VERES------
HIS1_LACPL       VDTNNPKEFV-
HIS1_LACLA       QTN--------
HIS1_OCEIH       VG---------
HIS1_STAAM       IANA-------
HIS1_STAES       ISYA-------
HIS1_PYRFU       VYGH-------
HIS1_SYNY3       I----------
HIS1_THEEB       IA---------
HIS1_NOSS1       ALTKV------
HIS1_PROMM       ESLPKNPA---
HIS1_SYNPX       SAAAGAAG---
HIS1_PROMA       KDSSAQ-----
HIS1_GLOVI       AVPA-------
HIS1_PROMP       KDILNI-----
HIS1_DEIRA       TAPAGEES---
HIS1_HELHP       LDSK-------
HIS1_WOLSU       KEVRE------
HIS1_AQUAE       NKDGLQVQGSS
HIS1_LEPIN       -----------
HIS1_THEMA       IEHDSNEQSRG
HIS1_AGRFC       KAAV-------
HIS1_RHIME       RAVL-------
HIS1_BRUME       RAGLEI-----
HIS1_BRUSU       RAGLEI-----
HIS1_RHILO       AAAVG------