CLUSTAL format seed alignment for MF_01020

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

HIS2_AGRFC       -----MSAFSLSDLERIVAKRAAAS---PDESWTAKLVAAG-----QERAAKKLGEEAVE
HIS2_RHIME       -----MTDFTLSDLEKIVATRARAA---PEESWTAKLVAAG-----QTKAAKKLGEEAVE
HIS2_BRUME       -----MSQFTLADLERIVAERASVT---DGTSYTASLVAKG-----QPKAAQKLGEEAVE
HIS2_RHILO       -----MAEFSFSDLEAIIRDRAHSG---DPDSWTAKLFARG-----IDKAAQKLGEEAVE
HIS21_BRADU      -----MPRFTIHDLAETIDARAAAG---GEGSYTRKLLDKG-----AEHCAKKFGEEAVE
HIS21_RHOPA      -----MARFTLHDLAATVDARAASG---GESSYTKKLLDKG-----PEHCAKKFGEEAVE
HIS22_BRADU      ------MSDSLERLYLAVLAARDLD---PATSRTARLFQRG-----PSKMAKKLAEEAIE
HIS22_RHOPA      ------MADSLDRLYQAVLAARDLD---PATSRTARLFQRG-----SGKMAKKLAEEAIE
HIS2_CAUVC       --MSQRLTDVLQRLAATIEARKGGD---PSVSYTAKLLN-D-----PALAAKKLGEEAVE
HIS2_LISIN       ---------MLSDLYEEIKLRKTQP---KEGSYTNYLFEKG-----LDKILKKVGEETTE
HIS2_LISMO       ---------MLNDLYEEIKLRKTQP---REGSYTNYLFDKG-----LDKILKKVGEEATE
HIS2_LACPL       -------MQNMEELYELIKQRKATP---KKGSYTDYLFTKG-----LDKILKKVGEESTE
HIS2_BACCR       ------MENAFKLLYKTIEERKGSP---LPESYTNYLFSKG-----EDKILKKIGEECAE
HIS2_CLOAB       ----MDKNEILSKLYNVIEDRKNNP---IEGSYTNYLFEKG-----IDKILKKVGEETTE
HIS2_LEPIN       -------MEFLLQLENILKKRKQDL---PDKSYTADLFRGG-----VDRILKKVGEEAGE
HIS2_METAC       --MPEADLSILNRVYDIILDRKENY---DENSYVCKLLNHR---KGMNKILEKVGEESIE
HIS2_METMA       --MPEADLSILNRVYDIILDRKENY---DENSYVCKLLNHR---KGMNKILEKVGEESIE
HIS2_METJA       --------MILEEVYEIIKQRIKEK---PEGSYVAKLTTDD-KKTAINKICEKIGEESTE
HIS2_METKA       ----MGDPEVLLEVYEVIRNRIEER---PEGSYVAELTEDDDTKPAINKICEKIIEESGE
HIS2_METTH       ----MVDEGILREVYRVLEDRR-DR---PIDSYTSRLMRDD-DKMAEDKILEKIGEEAAE
HIS2_HALSA       ------MSDPLRELFDVIEDRKETM---PENSYTASLLADD--EKGENAALEKVGEEATE
HIS2_NEIMA       -----MGDSVLSAIQQTITQRKSAN---PSESYVAQLLHKG-----EDKILKKVIEEAGE
HIS2_NEIMB       -----MGDSVLSAIQQTITQRKSAN---PSESYVAQLLHKG-----EDKILKKVIEEAGE
HIS2_CHRVO       -----MTPDVLKNIADTLEARREAA---PQSSYVASLFHKG-----EDAILKKVAEEAAE
HIS2_BORPA       MTTPTAGDDILSRIADTLATRRPEAGGDPQSSYVAKLLSKA-----PDAFLKKIGEEATE
HIS2_BORPE       MTTPTAGDDILSRIADTLATRRPEAGGDPQSSYVAKLLSKA-----PDAFLKKIGEEATE
HIS2_BORBR       MTPPTAGDDILSRIADTLATRRPEAGGDPQSSYVAKLLSKA-----PDAFLKKIGEEATE
HIS2_RALSO       ------MSDTLRRLGEVLESRKLANGGDPEKSYIARLFHKG-----DDAILKKIGEEATE
HIS2_PSEAE       ------MSDTLTRLAAVLEERKNAA---PDSSYVASLYHKG-----LNKILEKVGEESVE
HIS2_PSEPK       ------MSDTLNRLAEVLEERKQAA---PDSSYVASLYHKG-----LNKILEKLGEESVE
HIS2_PSESM       ------MTDTLSRLAEVLESRKDAA---ADSSYVASLYHKG-----LNKILEKLGEESIE
HIS2_GEOSL       ---MNERDDILQAVYEVILDRKGAL---PESSYTASLFHKG-----IDKILKKVGEEATE
HIS2_NITEU       ----MTASTILQRLARTIEARKNAD---PSISYTAKLLNSS-----QDKVLKKIAEEAAE
HIS2_CORGL       -------MKTFDSLYEELLNRAQTR---PEGSGTVAALDKG-----IHHLGKKVIEEAGE
HIS2_COREF       ---MMYCVKTFDSLYEELLDRAQNR---PEGSGTVAALDKG-----VHHIGKKVIEEAGE
HIS2_CORDI       -------MKNFDSLYHELAERAEKR---PEGSGTVAALNSS-----LHTLGKKVIEEAGE
HIS2_MYCTU       -MQQSLAVKTFEDLFAELGDRARTR---PADSTTVAALDGG-----VHALGKKLLEEAGE
HIS2_MYCPA       -MKQSLAVKTFEDLFAELGERARTR---PAGSATVAALDGG-----VHGLGKKILEEAGE
HIS2_MYCLE       -MKQSLAVKTFEDLFAELSERARTR---PTDSATVASLDGG-----IHALGKKILEEAGE
HIS2_BIFLO       -------MKTFESLFAELSEKAQTR---PEGSLTVDELDKG-----THFIGKKIIEEAGE
HIS2_STRCO       -----MSKKTFEELFTELQHKAANGD--PATSRTAELVDKG-----VHAIGKKVVEEAAE
HIS2_STRAW       -----MSKKTFEELFTELQHKAANGD--PSTSRTAELVGKG-----VHAIGKKVVEEAAE
HIS2_RHOBA       ---MPESLLPLDRLMTTLRTRAAER---PEGSYTTKLMNGG-----AEAIGRKIREEAEE
HIS2_SACS2       -----MSNEIVDELYKIILDRIEKR---PTGSYTAEIVNKG-----KPYVARKVGEESVE
HIS2_SULTO       -----MSSNVLDTLYSIILDRISNK---KEGSYTVKLLEKG-----KPYIARKVGEEATE
HIS2_PYRAE       -----MSCQIFEKLEAVIRQRIAEG---NPQSYTYRLYSSG-----VSTIARKVGEEAVE
                           .  :   :             *                   .*. **  *

HIS2_AGRFC       AVIAAIAQ---DRD--------GLKNEAADLLYHLLVVLKIADIPLSDVFAELERRTGQT
HIS2_RHIME       TVIAAIGE---DRK--------NLVDESADLLYHLMVVLNIAAVPLQDVMSELARRTSQS
HIS2_BRUME       TVIAAVSG---DRA--------GVVSESADLLYHLAVVWNIAGVALEDVLQELQRRTAQT
HIS2_RHILO       TAIAAVKG---DRQ--------GLVSESADLIYHWLVVLGLSGVPLSDVLKELESRTGRS
HIS21_BRADU      TVIAAVEN---DRA--------HLIAEGADLLYHFLVLLKARGIKLEEVEAALGKRTSMS
HIS21_RHOPA      MVIAAVEN---DRG--------HLISETADVLFHMLVLLKSRGVKLEEVEAALAQRTSMS
HIS22_BRADU      VVIDAVNG---DTD--------AVVRESADLLYNLTVLWASAGVRPEDVWREMTRREDML
HIS22_RHOPA      VVIDAVNG---NRE--------AVIRESADLLYNLTVLWASAGVRPEDVWAEMRRRENLL
HIS2_CAUVC       TVIAAVAQ---GSD--------ALAAESADLLYHWLALMAASGVSLDAVAEKLEAREGTS
HIS2_LISIN       VVIAAKN----NNE--------ELISEITDLTYHLLVLLAEKDIPLEDIKQELQSREGKL
HIS2_LISMO       VVIAAKN----DNQ--------ELIAEVSDLAYHLLVLLAEKNIPLVAIQTELQKREGKL
HIS2_LACPL       VIVAAKNP---GDD--------ELTYETADLLYHVLVLLVERGVSFDQIKQELAKREGKM
HIS2_BACCR       VIIACKNN---DKE--------EVVKEMVDVFYHCFVLLAEKNIALEDVMREVKERNGKL
HIS2_CLOAB       VIIASKDD---NKE--------DLINEICDVIYHTLVLLNYKNIKLEDIEKELQKRNEKI
HIS2_LEPIN       VIIAAKNS---DKK--------ELTHEVADLLFHLQVLLVEQGLSLQEIVEELHKRHS--
HIS2_METAC       TILAVRNE---DHK--------EIVSESSDLIFHLLVLLAANNVTLDEIAGELSARHEKM
HIS2_METMA       TILAVRNE---DHR--------EIVSESSDLIFHLLVLLAANNITLEEIADELSTRHEKM
HIS2_METJA       LILAAKDD---KKD--------EIIYEAADLIFHTMVLLAYKNIEFEELLKEFERRKK--
HIS2_METKA       LILAAKDG---DRE--------GVVYESTDLIFHVLVLLAYLGIEIGEVFDEFERRRK--
HIS2_METTH       VIIASKND-----E--------NLVEEAADLIFHTLLLLVYKGVPLDSLLEEFAARRK--
HIS2_HALSA       FLLAAKDG---DTD--------ELAHEGADVVYHMLVVLAQQDMDVEALLAELDDRR---
HIS2_NEIMA       VLMASKDK---NPS--------HLVYEVADLWFHTMILLTHHDLKAEDVLDELARRQGLS
HIS2_NEIMB       VLMASKDK---NPS--------HLVYEVADLWFHTMILLTHHDLKAEDVLDELARRQGLS
HIS2_CHRVO       TLMASKDK---DKL--------HLVREVADLWFHTMVLLTYHGLRPEDVVMELHRREGIS
HIS2_BORPA       LVMAAKDG---QPD--------RIISETADLWFHCLVALTHYNLRPEDVLAELARREGLS
HIS2_BORPE       LVMAAKDG---QPD--------RIISETADLWFHCLVALTHYNLRPEDVLAELARREGLS
HIS2_BORBR       LVMAAKDG---QPD--------RIISETADLWFHCLVALTHYNLRPEDVLAELARREGLS
HIS2_RALSO       TVMAAKDA---RAAGMTDEARGKVVYEVADLWFHTMVLLSHFDLTPDDVVNELARREGLS
HIS2_PSEAE       TIIAAKDA---AASG----DCQDLIYETADLWFHSLVMLSALGQHPQAVLDELERRFGLS
HIS2_PSEPK       TIIAAKDA---QISK----DYSDVIYETADLWFHSLVMLSALGQHPQAVLDELERRFGLS
HIS2_PSESM       TIIAAKDA---AVSG----DCSDVIYETADLWFHSMVMLAALGQHPQAVLDELDRRFGLS
HIS2_GEOSL       VIIAGKGG---KRE--------EIVYETADLLFHTLVLLGHYDIAPADVYNELRRRFGTS
HIS2_NITEU       TIMACKDN---DRE--------QIIYETADLWFHCLIMLTRHDISPEDILRELERREGIS
HIS2_CORGL       VWIAAEYE---TDE--------ELAGEISQLIYWTQVIMVARGLKPEDIYKNL-------
HIS2_COREF       VWIAAEYQ---SDE--------ELAEEISQLMYWTQVMMVARGIKPEDVYKNL-------
HIS2_CORDI       VWLAAEYQ---SDA--------ELAEEISQLMYWAQVIMIKRGLTPEDIYKYL-------
HIS2_MYCTU       VWLAAEHE---SND--------ALAEEISQLLYWTQVLMISRGLSLDDVYRKL-------
HIS2_MYCPA       VWLAAEHE---SDD--------ALAGEISQLLYWTQVLMTARGLSLDDVYRKL-------
HIS2_MYCLE       VWLAAEHE---PKE--------VLAEEISQLLYWTQVLMISRGLSLDDVYRKL-------
HIS2_BIFLO       TWMAAEYE---GAD--------RTAEEMSQLLYHVQVMMIKHGLTLEDVYKHL-------
HIS2_STRCO       VWMAAEYE---GKD--------AAAEEISQLLYHVQVMMVARGISLDDVYAHL-------
HIS2_STRAW       VWMAAEYE---GKD--------AAAEEISQLLYHVQVMMVARGISLDDVYAHL-------
HIS2_RHOBA       LIEAADEPDEAGRQ--------HAIYEAGDLIYHAMVLMAWRGIELDEVAAELARREGTS
HIS2_SACS2       TIVASLAE---NKE--------RFISEVADLIYHLLVLMALEGVTPEDIYRELERRRK--
HIS2_SULTO       VIVASLSE---GRE--------RFISEVADLIYHLFVLMAVEGVKPEDVYEELKRRMK--
HIS2_PYRAE       VAVAALAE---GRE--------RVVEESADLLYHLLVLLNSLGLSLGDVCKELERRMK--
                                           *  :: :               :   .       

HIS2_AGRFC       GLAEKAARPTP----------------------------
HIS2_RHIME       GLQEKANRQNP----------------------------
HIS2_BRUME       GLAEKASRPKG----------------------------
HIS2_RHILO       GIAEKASRPKG----------------------------
HIS21_BRADU      GLEEKASRKE-----------------------------
HIS21_RHOPA      GLEEKASRKRD----------------------------
HIS22_BRADU      GIAEKLPKSAMKLPKVASPRVAARRPIVALEGRTARKRH
HIS22_RHOPA      GIAEKLPKSRIGKPAAPH---ATRRPVIPQEARAVRKHR
HIS2_CAUVC       GIAEKASRA------------------------------
HIS2_LISIN       SKTS-DRKEINDL--------------------------
HIS2_LISMO       STTR-DRKEINDL--------------------------
HIS2_LACPL       SDYK-DRPEIKNL--------------------------
HIS2_BACCR       SRVG-DRREIDTL--------------------------
HIS2_CLOAB       LNKKQERRPIENI--------------------------
HIS2_LEPIN       ---------------------------------------
HIS2_METAC       KRD------------------------------------
HIS2_METMA       RRD------------------------------------
HIS2_METJA       ---------------------------------------
HIS2_METKA       ---------------------------------------
HIS2_METTH       ---------------------------------------
HIS2_HALSA       ---------------------------------------
HIS2_NEIMA       GLAEKAARTES----------------------------
HIS2_NEIMB       GLVEKAARTES----------------------------
HIS2_CHRVO       GLDEKASRKPTA---------------------------
HIS2_BORPA       GLEEKARRPRD----------------------------
HIS2_BORPE       GLEEKARRPRD----------------------------
HIS2_BORBR       GLEEKARRPRD----------------------------
HIS2_RALSO       GLEEKALRKSQARDAAGD---------------------
HIS2_PSEAE       GHAEKAARQPSA---------------------------
HIS2_PSEPK       GHDEKAARQPSA---------------------------
HIS2_PSESM       GHTEKAARTAE----------------------------
HIS2_GEOSL       GHAEKASRNE-----------------------------
HIS2_NITEU       GIEEKLSRSQPNKTE------------------------
HIS2_CORGL       ---------------------------------------
HIS2_COREF       ---------------------------------------
HIS2_CORDI       ---------------------------------------
HIS2_MYCTU       ---------------------------------------
HIS2_MYCPA       ---------------------------------------
HIS2_MYCLE       ---------------------------------------
HIS2_BIFLO       ---------------------------------------
HIS2_STRCO       ---------------------------------------
HIS2_STRAW       ---------------------------------------
HIS2_RHOBA       GLVEKASRPAKKDSGTADS--------------------
HIS2_SACS2       ---------------------------------------
HIS2_SULTO       ---------------------------------------
HIS2_PYRAE       ---------------------------------------