CLUSTAL format seed alignment for MF_01021

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

HIS3_BACAN      ---------------------MKPNFSK--GLLPAVVIEEGTKEVLMLAYMNEEAYEKTL
HIS3_BACCR      ---------------------MKPNFSK--GLIPAIVIEEGTKDVLMLAYMNEEAYKKTL
HIS3_CLOAB      --------------MEYKKILEMMDFSK--GLIPAIVQDDENGEVLMLAYMNEEALKRTV
HIS3_LISIN      --------------------MNTVDFSK--GLVPTIILDDQNGEVLMLAYMNQESYQKTL
HIS3_LISMO      --------------------MISVDFSK--GLVPTIILDDQNGDVLMLAYMNEESYQKTL
HIS3_STRMU      ------------------MTDLSLDFKKQGGLLPVIVTDFQTGQVLMLAYMNEEAYQKTL
HIS3_LACPL      ---------------------MKPDFEKGDGLLTTVVTDADTKDVLMVAWMNAESYQRTL
HIS3_MYCTU      --------------MTLDPKIAARLKRNADGLVTAVVQERGSGDVLMVAWMNDEALARTL
HIS3_MYCPA      --------------MTLDPQIAARLKRNADGLVTAVVQERGSKDVLMVAWMDDAALARTL
HIS3_MYCLE      --------------MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTL
HIS3_COREF      MSHDPTPISDNPAEFTLDPVIAARLKLNDAGLIPAVVQAVDTREVLMMAWMDTHALAYTL
HIS3_CORGL      -------MSDNPQEYELDWDVEKRLKLNDAGLVPAIVQADGTNEVLMMAWMDTHALAYTL
HIS3_CORDI      --------MDDPASYELDPSIAQRVKFNSAGLVPAVVQSTD-GEVLMLAWMDAHALAYTI
HIS3_STRCO      MTSSSPTGGGPGRPSALAPEIADRLKRSADGLLPAIAQQYDTGEVLMLGWMDDEALHRTL
HIS3_STRAW      MTSTP----QPSRPSSLDAEIAARLKRSADGLVPAIAQQYDTGEVLMLGWMDDEALHRTL
HIS3_BIFLO      MTDTT----Y-DNSTELDPRIAARLKRDAKGLVAAVIQQYDTREVLMVGYMNDEALRRTL
HIS3_AGRFC      --MSIPFPSAPADKEALENAGLFSPKFDAHGLVTAVVTDARDGELLMVAHMNAEALSLTL
HIS3_RHIME      --MTLTFASPPQDKAELESGPAFTPRFDEKGLITAVVTDARDGELLMVAHMNAEALSLTL
HIS3_BRUME      ---MSIFPAQPSDKKAVEEGAAFMPRFDASGLITAIVTDARDGELLMVAHMNEEALRLTL
HIS3_BRUSU      ---MSIFPAQPSDKKAVEEGAAFMPRFDASGLITAIVTDARDGELLMVAHMNEEALRLTL
HIS3_RHILO      -MSALGFPKTPSDKKALEEGAVFSPRFDPAGLVTVVVTDAEDGMLLMVAHMNAQALALTL
HIS3_BRADU      ---------MSAHSHEIEEGLSFQPRFDASGLVTCVATDVATGDVLMVAHMNDEALRKTI
HIS3_RHOPA      MSSESRSASSPVAPDDIEEGVVLRPKFDAHGLVTVVATDARTGDVLMVAFMNGEALDRTI
HIS3_CAUVC      --MSTDLFPQAHSKHDLERGFALAPRFNADGLVVAVAQHADTGEILMLAWMNAEALKLTV
HIS3_ARCFU      ----------------------MELQFDEKGLIPVITQDVKTKEVLMLAYANEEAIKLTL
HIS3_HALSA      ----------MEEFDVDLDFGGAGHTDDGDGLVAVIAQDADSRDVLMLAYATREAVARTA
HIS3_METAC      -------------------MIDLDTLKYENGLILAVVQDQKSREVLMCAYMNREALEKTV
HIS3_METMA      -------------------MIDFGNLKYENGLIIGIVQDRASKEVLMCAYMNREALEKTV
HIS3_METKA      ---MSHVPLDPETARKVTSSLNYRFEIGGEPLVIAIAQDAENGDVLMTAFANEEAVYRTL
HIS3_METTH      ---------MIKSKGDVNILLNFRHNINGEDLIIAVAQDHETGEVLMVAYMNREALRRTL
HIS3_RHOBA      -----------MSSHVPNFDAGVPCPKTGQPLLPAIAQDATTGRVLMLAWMNREAWDETI
HIS3_CHLTE      ----------MGENQETQKSFLETVKFDSNGLVPAIVQDHETGKVLMMAWMNLESLKMTL
HIS3_GEOSL      --------------------MITIDFQKMGGLIPAIIQDHATNEVLMVAFMDEKTLNLTL
HIS3_NEIMA      ----------------MDKNLLEAVKFDEKGLVCAIAQDAETKRILMVAWMNAEALQKTV
HIS3_NEIMB      ----------------MDKNLLEAVKFDEKGLVCAIAQDAETKRILMVAWMNAEALQKTV
HIS3_PSEPK      -----------------MKDWLDEIKWNSDGLVPAIAQDHKTGRVLMMAWMNRESLALTA
HIS3_PSESM      -----------------MKDWLDEIHWNSDGLVPAIAQDRKTGRVLMMAWMNREALSLTA
HIS3_PSEAE      -----------------MKDWLDEIHWNADGLVPAIAQDHETGRVLMMAWMNREALALTA
HIS3_CHRVO      -------------MSSVSASWLDEVKWDDKGLVTAIAQDAASGRVLMVAWMNRESLQLTA
HIS3_BORBR      --------------MNTEPTWMAEVVFDENGLIPAIAQDAETGQILMVAWMNREALAETA
HIS3_BORPA      --------------MNTEPTWMAEVVFDENGLIPAIAQDAETGQILMVAWMNREALAETA
HIS3_BORPE      --------------MNTEPTWMAEVVFDENGLIPAIAQDAETGQILMVAWMSREALAETA
HIS3_NITEU      ----------------MTDKWLDTINWSADGLIPAIAQDKNNGKILMVAWMNREALKRTV
HIS3_RALSO      ----------------MSRKWLNKVKWDDHGLVPVIVQEQGSNDVLMFAFMNREALQKTV
HIS3_PYRAE      -----MEARPLATPEEAWRIASSLRYRHIEGTVVAVVQDVETKEVLMVGHMDPIAVVLTL
HIS3_SULTO      ---------MKLSENEASKLIEKLWFRHTDSTIIAVLQDYKTKEVLMVGHMNREAVFKTL
HIS3_METJA      ----------MDVEDTVKKLNLKFRNIEGERLILAITCDEN-KNVLMVAFMNEEALKKTL
HIS3_METVA      -MGIKDIDIKENFGKIVQNMDLKFRKIDDKELLIAIAIDKY-KNVLMTAFMDKESLKMTL
                                                .  :        :** .     :   * 

HIS3_BACAN      KTKRTWFYSRSRRSLWNKGETSGHVQHVQSLYLDCDQDAIVVFVKQVG--PACHTGEKTC
HIS3_BACCR      ETKRTWFYSRSRQSLWNKGETSGNVQYVQSLYLDCDQDSIVVNVKQVG--PACHTGEKTC
HIS3_CLOAB      DTKRTWFWSRSRKSYWNKGETSGHFQYVKSIGIDCDGDTILIKVKQVG--AACHTGNRSC
HIS3_LISIN      ETGYTWFFSRSRNELWNKGETSGNTQKVKQIWTDCDNDTLLIRVIQTG--PACHTGKKSC
HIS3_LISMO      ETGYTWFFSRSRNELWNKGATSGHTQKVKQIWTDCDNDTLLIRVTQIG--PACHTGKKSC
HIS3_STRMU      DSKEMYYWSRSRNELWHKGDTSGHYQYVKSIKTDCDQDTLLIAVEQVG--AACHTGAYSC
HIS3_LACPL      ASGQTWFWSRSRQELWHKGATSGNLQDVVSMTLDCDQDTLLVAVHPHG--PACHTGHTSC
HIS3_MYCTU      QTREATYYSRSRAEQWVKGATSGHTQHVHSVRLDCDGDAVLLTVDQVG--GACHTGDHSC
HIS3_MYCPA      ETREATYYSRSRGQQWVKGETSGHTQYVHSVRLDCDGDTVLLTVDQVG--GACHTGDHSC
HIS3_MYCLE      ETREANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVG--GACHTGAHSC
HIS3_COREF      ATRRGTYYSRSRDEYWIKGLTSGNVQEVTDVALDCDGDTVLVTVHQTG--GACHTGARTC
HIS3_CORGL      ATRRGTYFSRSRNEYWIKGLTSGNVQEVTGLALDCDGDTVLLTVKQTG--GACHTGAHTC
HIS3_CORDI      ATRKGTYFSRSRNEYWIKGLTSGHTQQVTGLQLDCDGDTVLMTVVQQG--GACHTGDRTC
HIS3_STRCO      TTGRCTYWSRSRGEYWVKGDTSGHFQWVKSVALDCDADTVLVKVDQVG--AACHTGTRTC
HIS3_STRAW      TTGRCTYWSRSRGEYWVKGDTSGHVQYVKSVALDCDADTVLVKVDQVG--AACHTGAHTC
HIS3_BIFLO      TTGRVTFWSRSRQEYWRKGDTSGHVQYVKGVSLDCDGDALLVEVDQVG--AACHTGKRSC
HIS3_AGRFC      ETGIAHYYSRSRDKIWKKGETSGNLQTVKEFRTDCDQDAVWLKVSVAGHDATCHTGRRSC
HIS3_RHIME      ETGFAHYYSRSRDRLWKKGESSGNLQTVREIRTDCDQDAVWLKVSVAGHDATCHTGRRSC
HIS3_BRUME      ETGIAHYWSRSRKTLWKKGETSGNLQSVVELRTDCDQDALWLKVHVAGDGPTCHTGRRSC
HIS3_BRUSU      ETGIAHYWSRSRKTLWKKGETSGNLQSVVELRTDCDQDALWLKVHVAGDGPTCHTGRRSC
HIS3_RHILO      ETGIAHYWSRSRNALWKKGETSGNFQHVVEMRTDCDQDALWLRVKVLGHDATCHTGRRSC
HIS3_BRADU      ATGEAWYFSRSRNALWRKGETSGQTQRVVEMRTDCDQDAVWIRVEQIG--AACHTGRRSC
HIS3_RHOPA      QTGEAWYYSRSRKRLWKKGETSGHIQKVLEMRVDCDQDAVWIKVDQTGG-AACHTGRHSC
HIS3_CAUVC      ETQIAHYFSRSRNELWKKGDTSGQLQDVVELRVDCDQDAVLLKVRPRGDGGACHVGFRSC
HIS3_ARCFU      KTGFAHYWSRSRKKLWKKGETSGNVQRVVEIRYDCDCDALLYLVEQKG--NACHTGNYSC
HIS3_HALSA      TTGRAHYYSRSRDELWEKGATSGNTQSVDEIRVDCDGDALLYLVAQTG--GACHTGHESC
HIS3_METAC      KTGIAHFWSRSRKQLWKKGETSGHLQKVKEIRIDCDMDSVLLLVEQVG--GACHMGYRSC
HIS3_METMA      ETGIAHFWSRSRQKLWKKGETSGHLQKVKEIRIDCDMDSVLLLVEQVG--GACHMGYRSC
HIS3_METKA      TTGYAHYWSTSRREVWKKGEESGHVQRVVEVRVDCDKDAVLYVVEQEG--GACHTGYRSC
HIS3_METTH      ETGTAHYWSTSRGKLWLKGESSGHVQRVKDVLVDCDGDAVVLKVEQEG--GACHTGYRSC
HIS3_RHOBA      SGNRAVYFSRSRGKLWRKGDTSGHAQVVREIRVDCDADTILLSVEQTG--AACHENYESC
HIS3_CHLTE      EKKKACYWSRSRNKLWLKGESSGNMQEVHDILIDCDGDTLLLKVSQKG--GACHVGYHSC
HIS3_GEOSL      ESGKTWFFSRSRNKYWMKGEESGNTQEVVEVLTDCDADAVVIKVKQNGP-AACHTGNRSC
HIS3_NEIMA      ETGFAHYYSRSRQKQWMKGEESGHTQKVRELRLDCDGDAIVMLIAQNGG-IACHTGRESC
HIS3_NEIMB      ETGFAHYYSRSRQKQWMKGEESGHTQKVRALRLDCDGDAIVMLIAQNGG-IACHTGRESC
HIS3_PSEPK      AEQRAIYWSRSRGKLWRKGEESGHVQKLHELRLDCDADVIILMVEQLGH-IACHTGRESC
HIS3_PSESM      SENRAIYWSRSRGKLWRKGEESGHVQKLHELRLDCDADVIILMVEQIGG-IACHTGRESC
HIS3_PSEAE      SENRAIYWSRSRGKLWRKGEESGHVQKLHELRLDCDADVVILMVEQVGG-IACHTGRESC
HIS3_CHRVO      DTGIAHYWSRSRRKLWKKGEESGHLQTVRELRLDCDGDVIVMQIEQIGG-IACHTGRESC
HIS3_BORBR      ATGRAVYWSRSRQRLWRKGEESGHAQDVHELRLDCDGDVILLKVHQNGG-IACHTGRASC
HIS3_BORPA      ATGRAVYWSRSRQRLWRKGEESGHAQDVHELRLDCDGDVILLKVHQNGG-IACHTGRASC
HIS3_BORPE      ATGRAVYWSRSRQRLWRKGEESGHAQDVHELRLDCDGDVILLKVHQNGG-IACHTGRASC
HIS3_NITEU      ESGEAVYWSRSRKKLWHKGEESGHTQKISAIHLDCDEDILLLSVEQKGG-IACHTGRQSC
HIS3_RALSO      ETGEAVFWSRSRKRLWHKGEESGHIQQVHEIRLDCDEDVVLLRVTQVGG-IACHTGRHAC
HIS3_PYRAE      TTGLAHYYSTTRKRIWLKGETSGHYQIVKEFRSDCDGDAVVIKVVQIG--AACHTGSRSC
HIS3_SULTO      TTGYVHFWSLSRKKLWLKGETSGHFQLVEDFKIDCDGDAMVFLVKSVG--PVCHTGNRSC
HIS3_METJA      ETGYMHYYSTSRKKLWRKGEESGNVQKLIKFYRDCDGDALLFIVEQKG--VACHEGYYSC
HIS3_METVA      KTGLMHYFSTSRNKIWMKGEESKNVQKVLEVFKDCDGDALLFIVEQTG--WACHEGYMSC
                      ::* :*   * **  * : * :  .  *** * :   :   *   .** .  :*

HIS3_BACAN      FHYKII---------------------------------
HIS3_BACCR      FYYQII---------------------------------
HIS3_CLOAB      FYRSFEFEDGGAK--------------------------
HIS3_LISIN      FFNLIKEDF------------------------------
HIS3_LISMO      FFNLIKEDF------------------------------
HIS3_STRMU      FFNEIYNPE------------------------------
HIS3_LACPL      FFNPVELEQGA----------------------------
HIS3_MYCTU      FDAAVLLEPDD----------------------------
HIS3_MYCPA      FDADVLLHPQD----------------------------
HIS3_MYCLE      FDSAMLLAPQD----------------------------
HIS3_COREF      FDADPLLGPGQ----------------------------
HIS3_CORGL      FDNDVLL--------------------------------
HIS3_CORDI      FDADVII--------------------------------
HIS3_STRCO      FDTDVLLADQ-----------------------------
HIS3_STRAW      FDADVLLKDGDSGVPAADQ--------------------
HIS3_BIFLO      FLEGGPLPVVEGHRPAEQ---------------------
HIS3_AGRFC      FYRTVELS-NGDAVTKITDDTRHFDPATTYSNT------
HIS3_RHIME      FYRTVGVA-DGEAKVAITDDHRHFDPAQIYAGN------
HIS3_BRUME      FYRQVVSS-GGKVALTMASDHDQ----------------
HIS3_BRUSU      FYRQVVSS-GGKVALTMVSDHDQ----------------
HIS3_RHILO      FYRTVGLV-DGKGTLVDDGSKPLFDAEFTYRKPSS----
HIS3_BRADU      FYRKVEAE-DGGAKLVFVDADRLFDPDAVYKK-------
HIS3_RHOPA      FYRRIDRGGDGAPVLIETDSERKFDPDKVYGK-------
HIS3_CAUVC      FYRVLENG------VLVEREAPLHDHA------------
HIS3_ARCFU      FYRRLEGD---------EVRC------------------
HIS3_HALSA      FHRTLDGD---------TVGDQVFDPDDAY---------
HIS3_METAC      FYRNLKGE---------VVGEKVFEPKDVY---------
HIS3_METMA      FYRNLDGE---------VVGEKVFEPEDVY---------
HIS3_METKA      FYRRVTRD-----GSFEVVMDRVFNPDEVYR--------
HIS3_METTH      FYRSIDGDE----LKVREDAVKVFDPEEIYGDG------
HIS3_RHOBA      FFRRVDPD-----------GTTHITEERIA---------
HIS3_CHLTE      FYRRTV-----DGESMEICDTLMFDPEEVYGKQS-----
HIS3_GEOSL      FYVRWE-----DGQWVEHSEPL-FDPAEVYKK-------
HIS3_NEIMA      FYKVWR------GGAWETADAVLKDEKEIYGSTH-----
HIS3_NEIMB      FYKVWR------GSAWETADAVLKDEKEIYGSTH-----
HIS3_PSEPK      FYRVYE------DGQWKIVDPVLKDPDAIYSAGH-----
HIS3_PSESM      FYRVYE------QSGWKTVDPVLKDPDAIYPAGH-----
HIS3_PSEAE      FYRVFE------NGAWKTVDPVLKDPDAIYEHAGHHHE-
HIS3_CHRVO      FYRRFE------NGGWTTVDAVLKDPRAIYHP-------
HIS3_BORBR      FYRRLEGT--ASQAEWITIDPVLKDPELIYK--------
HIS3_BORPA      FYRRLEGT--ASQAEWITIDPVLKDPELIYK--------
HIS3_BORPE      FYRRLEGT--ASQAEWITIDPVLKDPELIYK--------
HIS3_NITEU      FFRQLK------NGEWVVTEPVIKDPSQIYTK-------
HIS3_RALSO      FFQKFEGT--AEDGDWHTVEPVLKNPDDIYAGKPGHNHE
HIS3_PYRAE      FESKYSLIKALKLSLRHG---------------------
HIS3_SULTO      FYRNFSDLI------------------------------
HIS3_METJA      FHYKIE------DGELKITGEYYSKR-------------
HIS3_METVA      FHNKVDLN----TGNSTVIGDKLD---------------
                *