CLUSTAL format seed alignment for MF_01023

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

HIS83_RHILO      ------------------------------MSDAKLQSVLSSLSQVARQLDALPSDTPAP
HIS8_STRGC       -----------------------------------------MVKLKG--LRQINPYVAGK
HIS8_LACLA       -----------------------------------------MSWQNN--LRSVSPYIAGE
HIS8_SYNAS       -----------------------------------MNAKGESMLSRR--LEALTPYVPGE
HIS81_OCEIH      ---------------------------------------MSKFWSSL--AKQVDPYIPGE
HIS8_BRAHW       ---------------------------------------MKSFLSDK--AKSIEPYTPGE
HIS8_CLOB8       ---------------------------------------MSKYWNDK--VREIEPYVPGE
HIS8_CLOB6       ---------------------------------------MSKYWSNI--TKNIEPYVCGE
HIS8_CHRSD       ---------------------------------------MSKFWSPA--VRELTPYVPGE
HIS8_ACEPA       ---------------------------------------MSRFWSPL--VHKLTPYVPGE
HIS8_MARMS       ---------------------------------------MSRFWTDK--IASLDPYVPGE
HIS82_PSYA2      ---------------------------------MSESKIDNRLWSSK--ARNLSPYVPGE
HIS8_ACIB5       ---------------------------------MTVSTAQMRFWSPE--VRELEPYVPGE
HIS81_METCA      ---------------------------------------MNPYWSAL--VRDLKPYVPGE
HIS8_SYNY3       ----------------------------------------MVSIRPS--VRHTPAYVPGE
HIS8_RHOBA       -----------------------------------------MQYRPA--LSKMKPYVPGE
HIS8_GEOBB       ----------------------------------------MIALREN--IAEMAGYVPGF
HIS81_NOSS1      ---------------------------------------MTNYFRSN--VEAMASYVPGE
HIS8_DEIRA       ------------------------------MTQTPPPAPGPSGVRQA--VRDIPAYPFTP
HIS81_LEGPL      -------------------------------------MSILNLVRAD--LLNSQNYVPGG
HIS8_SACS2       -----------------------------------MRFSLKLIYLFY--VAYLGFYIAPT
HIS8_CHLCH       ---------------------------------MNTPYSIEHLLNPA--LRNIATYKVEG
HIS8_BIFAA       -----------------------------MSETSSNAIPAYLPLRND--LIGEEPYGAPQ
HIS8_CUTAK       ----------------MTQHRQTSQPRPVAKPEPNSIQLADLPLRSE--LVGAQPYGAPQ
HIS8_MYCA1       ---------------------------MTGQRATPQPTLDDLPLRDD--LRGKSPYGAPQ
HIS83_BURL3      -----------------------------MQQPWKAVALSDLPLRED--LKLQHAYGAPQ
HIS8_PAEAT       -------------------------------MSDQLERLDRLPLRTN--LRGLSPYGAPQ
HIS8_FRACC       -------------------MIFKAAGSGAEDRPWRPWDADGLPLRDS--LRGLSPYGAPQ
HIS82_CAUVC      ----------------------MERGRMLVLDRKPLTPAWASPMRQA--LEGVQGYKAGM
HIS81_GLUOX      ------------MIPSHTAPSPFFPWSHRMNTAPECRTPPLSLARAE--VRQLPVYNAGL
HIS81_RHILO      ------------------------------------MSKASDMVRTE--VTRPSPYNSGL
HIS83_RHIME      ------------------------------------MAIPSRPIREE--IRSIAPYNAGL
HIS8_LEUMM       -------------------------------------------MKKT--VKALAAYQAEL
HIS8_LACF3       -------------------------------------------MKAG--INQIQSYVPEE
HIS8_LACPL       -------------------------------------------MKAS--IEQLEPYVPEK
HIS8_HALSA       -----------------------------------------MELRD---LSDHVEYRAGR
HIS8_HALWD       ------------------------------------------MQPRD--LSAHEPYVPGR
HIS8_DESAG       -------------------------MTEPAKREDSGLPEAVTAIRPE--VAAFKPYAPGL
HIS8_LEPIN       -------------------------------------MGVMIPFRSI--LNSLKSYEAGK
HIS8_HELHP       ------------------------------------------MFRSA--LKQIVTYEAGK
HIS8_NITSB       -----------------------------------------MRFNET--LEKIKTYEAGK
HIS8_ARCB4       -----------------------------------------MRFNEV--LKDVSTYEAGK
HIS8_CAMHC       -----------------------------------------MKFNDY--VENLQNYEAGK
HIS8_CAMFF       -----------------------------------------MKFNSH--IENLPIYEAGK
HIS8_RUBXD       -----------------------------------------MRFRAE--LEPLSPYNPPR
HIS82_LEGPL      -----------------------------------MSIDFQQLPHAG--IRSLIPYVPGK
HIS8_PELUB       --------------------------------------MTVPKFKKF----KIEAYKPGK
HIS8_HYPNA       ------------------------------------MSKPISQIEPLPHIAATKPYVPGG
HIS8_ZYMMO       -------------------------------------MTAAPELRPKSWIDSIAPYIPGS
HIS8_NOVAD       ---------------------------------MANAPQLPASPQPKDWILGIHAYVPGK
HIS8_JANSC       -------------------------------MTAPI------RPQPG--ILDIALYQGGA
HIS8_PARDP       ----------------------------------MSQNQTTIAPQPG--IMEISLYEGGA
HIS81_CAUVC      ------------------------------------------MPKPG--IMDIHAYVGGK
HIS8_ACICJ       -------------------------------------MSGLPTARPA--VFSVPPYVGGE
HIS8_GRABC       --------------------------------------MSNPRPNPG--IEAIHPYIGGE
HIS8_RHOCS       --------------------------------------MSGPIPNPG--ILDIAPYVGGE
HIS8_RHORT       -----------------------------------MTKAIIPQPRPG--IMEISPYVGGE
HIS8_MAGSA       --------------------------------------MTAPAPRPG--IMDIRPYVGGE
HIS8_MARMM       ---------------------------------------MAIEPRAG--ILDIRPYKPGS
HIS8_XANP2       ----------------------MSAVLKDPIPAPGRPESTRPEPRPG--VLAIEAYVPGK
HIS8_BDEBA       -----------------------------------------MKISPE--ILNLVPYKPGK
HIS8_METI4       -----------------------------------MTNKILSQVKPS--LQRLIPYEPGK
HIS8_DESPS       ------------------------------MPLFQKEIALKLDIPEN--IENIKPYPPGK
HIS8_ALKOO       --------------------------------------MTTNLFRKE--LEVLKPYVPGK
HIS81_PSYA2      -----------------------------MQSTQSTESNLLPLVPAYDSILALAPYQTGK
HIS8_AKKM8       -------------------------------------MSIESFANQH--VLELVAYQPGK
HIS82_HYDCU      ----------------------------------MSQSLFCDEVLPH--ISDIQVYQPGK
HIS82_HAEIN      -------------------------------------MQYINIANRG--VKSLSPYQAGK
HIS81_IDILO      ----------------------------------MAEFNALELVNPG--VKQLRPYQAGK
HIS81_NITOC      ----------------------------------MAESLFYQLAAAG--VQGLTPYQPGK
HIS81_CUPPJ      ------------------------------MAEQGKQGGKVPFGPDY--VRAISPYIAGK
HIS82_METCA      -------------------------------------MSITTLAVPG--VRGLTPYQPGK
HIS82_PSEF5      -----------------------------------MSGDFLALAQPG--VQQLSPYVPGK
HIS81_THIDA      --------------------------------MSGCDSICAATAPPH--VRAIAPYQPGK
HIS82_NITMU      -------------------------------------MNICDLAPAY--IRAISPYQPGK
HIS8_ANADF       ----------------------------------------MPLVPPH--VASLTPYVPGK
HIS8_SYMTH       ----------------------------------------MSSVRTA--VRRMKPYVPGK
HIS82_CARHZ      ------------------------------------------MVRKA--LENLKPYVPGK
HIS8_CALS8       ------------------------------------------MFREV--IRTISPYIPGK
HIS8_MOOTA       ----------------MMVRKSTASNRRLQDKGDEEPVATVPKCREA--ILSIKPYVPGK
HIS8_STACT       -------------------------------------------MKEQ--IQQLSAYQPGL
HIS8_MACCJ       -------------------------------------------MKPQ--LESLGVYKAGL
HIS82_OCEIH      -----------------------------------------MQGKEI--LKQLSPYKQGK
HIS8_LISIN       -----------------------------------------MKWKKS--LAGLSSYKPGK
HIS8_LYSSC       -----------------------------------------MKWKQQ--LDGMQAYKPGK
HIS8_BACSK       -----------------------------------------MLAKKQ--IQGLPPYAPGK
HIS82_BACAN      -----------------------------------------MQVKDQ--LSSLQPYKPGK
HIS81_BACAN      -----------------------------------------MRVKEQ--LLTLRAYVPGK
HIS8_BACHD       -----------------------------------------MKIKPQ--IIGLPPYKPGK
HIS8_ANOFW       -----------------------------------------MKVKQQ--LKQLKPYQPGK
HIS8_BREBN       -----------------------------------------MQPKQR--ILNAPVYQPGK
HIS8_THEMA       ----------------------------------------MNPLDLI--AKRAYPYETEK
HIS8_METLZ       ---------------------------------------MKPRVRSE--FVKS-GYVFAK
HIS8_METMJ       ---------------------------------------MRRLVRAC--YTGTGGYSYAK
HIS8_METJA       ----------------------------------MGDWMIENKVRDV--VKKLKPYVPGK
HIS8_METKA       -----------------------------MDRVRPLAGGRNVRIREA--VLNIDPYVPGK
HIS8_METST       ----------------------------------------MVKTRAI--LEEYKTYVPGR
HIS8_METTH       ---------------------------------MKLKSGSMVKIRNK--INDIEPYVPGR
HIS8_METS3       -----------------------------------------MKPRAI--VSEMDSYVPGK
HIS81_ARCFU      ------------------------------------------------------------
HIS8_METMA       ---------------------------------MLMSLSRRELIKKE--IFDIEEYVPGR
HIS8_METAR       ----------------------------------------MIRARQS--VQEIKEYVAGK
HIS8_FRAP2       ------------------------------MQKIVQNQTTESLIRKD--LQKFSAYSSAR
HIS8_XYLFA       --------------------------------MNTQTPTVLDLVRQE--LRNFAGYSSAR
HIS8_COLP3       --------------------------------------MIDKLAREE--LVDMVPYQSAR
HIS8_SHEAM       --------------------------MTSQVNAVPTDSLAARLARPE--LLSLEPYQSAR
HIS8_SHEON       MSQEPICQEPMSNVTVRSVPSDNSASNPLDKIVIESATLAARLARPE--LLELTPYQSAR
HIS8_BUCCC       ---------------------------------------MKRLIPKH--ISILKPYQSAR
HIS82_IDILO      ------------------------------------MSIVEQLQRQH--LKQLTPYASAR
HIS8_BUCAI       -----------------------------------MTDNVLKLSRKN--IKKLIPYQSAR
HIS8_BUCBP       -------------------------------------MDIKKLVRKN--ILQLVPYQSAR
HIS8_BUCMH       -------------------------------------MNIKKLVRKD--IRELIPYQSAR
HIS8_PSEA6       -------------------------------MAEPVNNLIDLLLNDN--IKGLKPYESAR
HIS8_AERHH       -------------------------------------MSIANLARRV--VRALTPYQSAR
HIS8_BLOPB       -------------------------------------MNIRYLARNN--ILTLKPYQSAR
HIS8_PHOPR       -------------------------------------MSIEQLARKT--VRELTPYQSAR
HIS81_HAEIN      ----------------------MNDYNSHILQWKKTIMTITTLSRQN--IQALTPYQSAR
HIS8_YERPE       ---------------------------------MSQSNNVTDLARAN--IRALTPYMSAR
HIS8_ECOLI       ----------------------------------MSTVTITDLAREN--VRNLTPYQSAR
HIS8_VESOH       ------------------------------------MSFINSWLRSD--IKMINAYHVPI
HIS8_HAHCH       ---------------------------------MSVKDRILQWVRPE--VQALSAYHVAD
HIS8_NEIMA       ------------------------------------MKSVRSFIRDD--IQAMSAYQIAD
HIS82_NITOC      ----------------------------------MTKDRVAQWIRPE--IQRLSAYRVAD
HIS81_NITMU      --------------------------------MAVMPFSPDQIIRPE--ILALSAYHVPP
HIS82_BORBR      ------------------------------MTGVAAPERIARAVRAD--IRALTAYPVAD
HIS8_CHRVO       -----------------------------------MKLTVQQLVRPE--IAAIGAYHVAA
HIS8_METPP       -----------------------MSSSNSNNGGPPLAPRLARFVRQD--VQNMHAYAIQP
HIS81_RALSO      -------------------------MNANAPVQPSLDDLLGRIVRDD--VRAMGAYHVPD
HIS8_HYDS0       ------------------------------------------MFSKR--IKLLKAYKTET
HIS8_AQUAE       ------------------------------------------MIPQR--IKELEAYKTEV
HIS82_ARCFU      -------------------------------------------MRDV--VRFINPYDPGL
HIS8_GLOVI       --------------------------------------MMQPYLRPD--LDRLQAYHAPH
HIS8_SYNJB       -------------------------------------MCALQYLRPD--LLYLKPYDAVP
HIS8_THEEB       ---------------------------------------MATFLRPE--LSNFRAYSTPT
HIS8_SYNE7       ---------------------------------------MLPFLRSE--LARCQPYHPNP
HIS82_NOSS1      ---------------------------------------MLPFIRSD--LAQFNAYKPHP
HIS8_CYAP4       ---------------------------------------MLPFLRSE--LAGLTAYVPHP
HIS8_DEHM1       -----------------------------------MTYDMKKYIRTD--LEGFAGYSACK
HIS8_ROSCS       -----------------------------------MPASITGLLRPD--IAALEPYTPIV
HIS8_YEAST       -----------------------------------MVFDLKRIVRPK--IYNLEPYRCAR
HIS8_CANMA       ------------------------------------MFDIKSIIRPN--ILTLEPYRCAR
HIS8_CYTH3       -----------------------------------MAFSLDSILRDN--IKNAKPYSSAR
HIS8_GRAFK       ----------------------------------MKDFNINKLVRPN--VAGLKPYSSAR
HIS8_BACTN       ------------------------------------MKTLQELTRPN--IWKLKPYSSAR
HIS8_PARD8       ------------------------------------MKDLKDLVRPN--VWNLKPYSSAR
HIS8_THEGJ       ------------------------------------------MISEL--VKSFQPYRVVE
HIS8_DESHD       ---------------------------------MVDKMNLEEWMRPS--IRTLKAYESKS
HIS8_RUMCH       --------------------------------------MIEELIRSE--IRSFIPYNANQ
HIS81_CARHZ      -------------------------------------MNKPRYFKEA--FAQLKPYEPHL
HIS8_PELTS       ---------------------------------MYTEFDAAALARAD--LKALTPYEAPY
HIS8_THEP3       --------------------------------------MIENLVREE--IKGFKNYEVHS
HIS8_CLOK5       --------------------------------------MIEKLFKQN--LQKFVPYTVPK
HIS8_CLONN       --------------------------------------MIQELFRKD--IKDFRPYDAKG
                                                                             

HIS83_RHILO      -DS-----------------SW---VKLNTNENPFPLPE-IIMQS----AIA--ALE-RQ
HIS8_STRGC       ---------------QPDEPDM---IKLNTNENAYGPSP-KVAEALQNFDAQ------EL
HIS8_LACLA       ---------------QPELTDI---IKLNTNENPYPPTS--VAQL----FNERYKTK-NL
HIS8_SYNAS       ---------------QPRDRKY---LKLNTNENPWPPSP-RIEALLREYDPD------QL
HIS81_OCEIH      ---------------QLNDDTI---IKLNTNENPYPPSN-QVIQA----IDE--ASK-NL
HIS8_BRAHW       -QP--------------KDKNY---IKLNTNESPYPPSP-YVKKALIESNFD------DL
HIS8_CLOB8       -QP--------------KDRKY---IKLNTNENPYPPSD-KVLEAMRNAVNG------DL
HIS8_CLOB6       -QP--------------KNKKI---IKLNTNENPYPPSP-KVLQAIKNAARD------DL
HIS8_CHRSD       ----------------QPRERL---IKLNTNENPYPPAP-GVEQVLREFPVD------HL
HIS8_ACEPA       -QP--------------KMTDL---IKLNTNESPYGPSP-RALEAIRAADND------TL
HIS8_MARMS       -QP--------------QDKKY---IKLNTNESPYSPSP-KAIEAMALEVSE------RL
HIS82_PSYA2      -QP--------------QHDDL---CKLNTNENPFPPSP-KVGEAITKVLAQ--QAD-DL
HIS8_ACIB5       -QP--------------KIQNL---LKLNTNENPYPPSP-KVVEAVQAVLHE--QAD-AL
HIS81_METCA      -QP--------------KLDNL---VKLNTNENPYPPSP-KVLAAIRGELGA------SL
HIS8_SYNY3       ---------------QPQTNDF---IKLNTNENPYDPPA-QVLAA----VAA--ELP-KV
HIS8_RHOBA       -QP-------------PPG-KF---IKLNTNENPYPPPA-PVVSAIQSAATG------PL
HIS8_GEOBB       -QP-------------LDVDSY---IKLNTNENPYPPSP-KVLEAIAKEAGE------GL
HIS81_NOSS1      -QP-------------PQGTQV---IKLNSNENPYPPSP-EALAAIKDIDGE------CL
HIS8_DEIRA       -ID-----------------VP---YKLDQNENPYDFPP-ELKQK----AAERMLAH-PW
HIS81_LEGPL      -ES-----------------AR---YRSHANELPWSPVT----------MGE----Y-NL
HIS8_SACS2       KLVRNKIKSWLLNASEYDFTDIKEGIRLHLNESPFEPPQ-FIIDAVKMYLS-------KG
HIS8_CHLCH       -----------------GQQAE---IKLNQNESPFDVPQ-WLKEE----IIGEFIRE-PW
HIS8_BIFAA       --------------LDVP-------VCLNVNENPYAPEP-AVVETIAQRVKE--IAP-TL
HIS8_CUTAK       -LD-----------------VP---VRLNVNENPYPPSE-AVRKDMAKAVAK--AAK-SL
HIS8_MYCA1       --------------LAVP-------VRLNTNENPHPPSR-ALVDDVVRSVAR--AAA-DL
HIS83_BURL3      --------------LDVP-------VCLNVNENPYPPSP-ALVERIATAVAD--AAR-AA
HIS8_PAEAT       --------------LDVP-------ILLNVNENTHGVPA-DVQAAITEAVAA--AAT-GL
HIS8_FRACC       -LD-----------------VP---VRLNTNENPHPPSV-GLVDAIGKAAAL--AAT-EA
HIS82_CAUVC      --T----LAEAARRTGLS--AF---SKLASNENLLGPSP-KVAEA----VMA--AMA-EP
HIS81_GLUOX      ------SEDAVRAKYGIP--RI---TKLGSNENPYGPSP-AALEH----WTE--IAS-SL
HIS81_RHILO      --T----ITEVMQRYAPA--RI---AKLGSNENPLGPSP-TLATM----LQA--GAE-MF
HIS83_RHIME      --T----LEEVRAKYHVD--EV---AKLSSNENPLGPSP-ALRRL----FPD--IGE-LA
HIS8_LEUMM       --P----VETVKAKYGLQ--HL---ARLSANESVYGPSP-KVAQA----VRA-VSDD-IL
HIS8_LACF3       --P----VQRVKSKYHLK--RL---ARLSANENPYGTSP-LVKEA----LINAINDG-AL
HIS8_LACPL       --P----LATLQAELGLT--EL---VRLSANENPYGTSP-KVATA----VKN-WDFT-QS
HIS8_HALSA       --G----IEEVARELGRDPSEF---VKLSSNENPHGPSP-KATIA----IRE--AAT-GV
HIS8_HALWD       -GT-----KEVARELEVDPDSL---IKLSSNENPHGPSP-AAVDA----IAD--TAE-TV
HIS8_DESAG       --S----IDEIKERYGLS--QV---VKMASNENPLGTSP-LVQQT----LRT--HAD-LA
HIS8_LEPIN       --P----IELVVREFGIDPNRI---IKLGSNENPFGCAE-SVMEV----VRQ--AIS-KM
HIS8_HELHP       --P----IELVVREYGIKPEDI---IKLGSNENPYGTSA-QVVES----LQK--NAH-KA
HIS8_NITSB       --P----IELVVREFGIEPQNI---IKLASNENPYGTSP-KVVDA----VRE--IAD-TM
HIS8_ARCB4       --P----IELVVREYGIDSKDV---IKLASNENPYGTSP-KVIAK----IQE--LAK-NM
HIS8_CAMHC       --P----VELVVREYGVKEDDV---IKLASNENPLGTGK-KAVKA----IYK--MAK-HA
HIS8_CAMFF       --P----IELVIREFGIDQNDI---IKLASNENPLGTSK-KVIEK----IKN--VAQ-NS
HIS8_RUBXD       --A----SQEAAAERGTG--GL---VKLTSNELSFGPLP-EAEAA----LAE--ALP-RA
HIS82_LEGPL      --S----IEELAKEKGIT--DI---IKLASNENPLGCSP-LALSA----IQT-MSSH-YI
HIS8_PELUB       -------------SNIAKIRNI---IKLSANESALGVSP-RVKKI----LQN--KKL-LI
HIS8_HYPNA       -------------KLHGAKGAV---AMLASNENPFGPSP-KAVEA----AKA--AAA-NV
HIS8_ZYMMO       -------------SKTLDGRPA---VKLSSNENPLGTSL-KAKEA----YRE--AID-SL
HIS8_NOVAD       -------------STGKDGQVL---TKLSANENPLGTSA-AALEA-----RA--HAG-DP
HIS8_JANSC       --S---------KIAGHA--DP---LKLSSNENPFGPSP-AAVQA----MAD--AVA-SS
HIS8_PARDP       -----------SKVAGVE--NV---VKLSSNENPFGPSD-KAREA----MIR--AAH-GL
HIS81_CAUVC      --S---------KVEGIA--HP---VKLSSNENILGSSD-KAKDA----YRN--AVD-RL
HIS8_ACICJ       -----------SRLDGVN--RV---IKLSSNEGAFGPPP-GAIAA----LTE--VAA-IA
HIS8_GRABC       -----------SKLPGVE--QV---IKLSSNEGAFGPPP-AAQQA----YLK--AVS-SL
HIS8_RHOCS       -------------HSAPGVTRL---LRLASNEGALGPSP-RAVEA----FRA--VGP-EI
HIS8_RHORT       -----------SKLAGVD--RI---IKLSSNEGALGASP-RVRDA----LIA--SAG-EA
HIS8_MAGSA       -----------SAIEGVD--RI---LKLSSNEGALGPSP-KAMEA----LRA--MAP-EM
HIS8_MARMM       -----------SEAPGIE--NP---VKLSSNENALGCSD-KAAAA----MTA--TAS-KL
HIS8_XANP2       -------------SHAPGVEKV---FKLSSNETPLGPSE-KAVAA----FAE--AGR-KL
HIS8_BDEBA       --P----ISETQREYGLT--TV---YKLASNENPLGPSP-KAMAA----VKQ--ALD-HQ
HIS8_METI4       --P----IEDLAREYGFSPSQI---IKLASNENPLGPSP-RALDA----LGR--NLH-KI
HIS8_DESPS       --P----LDELEREYGIT--DS---IKLASNENPWGASP-KAIKA----IGE--SLG-DM
HIS8_ALKOO       --P----IEEVQKEYGID--QI---EKLASNENPLGPSP-KAVEA----IMR--EVQ-HI
HIS81_PSYA2      --P----IEELTREYGVS--DV---VKLASNENPIGCSP-HVTLA----ITE--QIG-QL
HIS8_AKKM8       --P----IEETARELGLNPHDI---VKLASNENPLGPSP-KAVEA----IAR--AAA-GV
HIS82_HYDCU      --P----ISEVQREHNLL--RI---SKLASNENPLGASP-KAIKA----VQS--ELI-NM
HIS82_HAEIN      --P----IEELERELGIS--NI---VKLASNENPFGFPE-SAKKA----IFE--QLD-KL
HIS81_IDILO      --P----TSELQRELGLQ--HV---VKLASNENPLGLSE-KVKTA----LEA--ELT-DL
HIS81_NITOC      --P----IEELEREYGVR--GA---VKLASNENPLGPSP-MAIDA----IYG--VLG-ES
HIS81_CUPPJ      --P----ISEVAREFGLDEAGI---VKLASNENPLGMPE-SAKHA----AAA--AIA-EL
HIS82_METCA      --P----IGELEREFALK--RI---VKLASNENPLGASP-KVLEV----VRR--ILG-GT
HIS82_PSEF5      --P----VDELARELDIDPATI---VKLASNENPLGASP-KALAA----IRD--ELA-EL
HIS81_THIDA      --P----ISELARELGLAEADI---VKLASNENPLGPSP-FALAA----AQD--ALL-DM
HIS82_NITMU      --P----ISELAREMGMDEQSI---IKLASNENPLGTSP-MALNA----MSK--ALD-EV
HIS8_ANADF       --P----IEEVEREYGVS--NV---AKLASNENALGPSP-LALAA----ARE--ACA-KV
HIS8_SYMTH       --P----VEDVQRELGLH--DL---VKLNQNENPLGPSP-RAVAA----ARA--AMA-QV
HIS82_CARHZ      --P----VEEVERELGIT--NI---DKLASNENLWGISP-KVAAA----IKE--AVD-KV
HIS8_CALS8       --P----ISEVKRELGLE--KV---IKLASNENPLGPSE-NVKKA----IKE--SLD-DL
HIS8_MOOTA       --P----IEEVQRELGVK--DV---IKLASNENPLGPSP-DAVQA----LQE--ASD-RI
HIS8_STACT       --S----PRALKKEFGLD-IDL---HKLASNENLYGPSP-KAKEA----IKE--HVD-EV
HIS8_MACCJ       ------SEEALKRKFNVEG-EF---SRLASNENPIGPSP-QVYEA----IRS---QD-AL
HIS82_OCEIH      --Q----IKDIQKDYQLD--YI---VKLASNENPYGYSK-QVNEA----LST--ENF-DF
HIS8_LISIN       --R----EEEVMAELGLT--KI---TKLSSNENPLGTSK-KVAAI----QAN--SSV-ET
HIS8_LYSSC       --P----IEEVQREYGLK--EV---IKLASNENPFGCSP-KVTAY----LQN--NAV-NH
HIS8_BACSK       --P----IEDVKREYGLE--TV---IKMASNENPYGASP-AVAKA----IAD--GAS-KT
HIS82_BACAN      --S----PEQMKEVYGDH--SF---VKLASNENPFGCSP-RVLDE----LQK--SWL-DH
HIS81_BACAN      --N----IEEVKREYGLS--KI---VKLASNENPFGCSA-RVTEA----LTS--LAS-QY
HIS8_BACHD       --P----MEDVKRELGLE--TV---VKLASNENPFGASP-KVAEA----IQE--ALH-HT
HIS8_ANOFW       --P----IEEVKREYQLE--TV---IKLASNENPYGCSP-LVRQA----VMN--ELD-DL
HIS8_BREBN       --P----IDDVKREFGLT--EV---IKLASNENPFGSSP-KAKAA----ISE--QLD-NL
HIS8_THEMA       -------RDK---------------TYLALNENPFPFPE-DLVDEVFRRLNS--D---AL
HIS8_METLZ       --S----PADIAKEYGF--TEV---AMLGSNENPYPPSD-KVLRA----AEA--ELS-GV
HIS8_METMJ       -KA-----DDVAREHGFD--RV---ARLASNENPRPPSP-AALEA----ATV--ALR-EV
HIS8_METJA       --S----KEEIARAYGIKPEDI---IKLGSNENPWGPSP-KIKEK----ILD--EID-KI
HIS8_METKA       --S----KEEIAREYGIEPDEI---VKLGSNENPLGPSP-KAVKA----AKR--ELE-RL
HIS8_METST       --S----KKEIAEEYGVAEESI---IKLGSNENPWGPSP-KAKQA----IID--SID-EI
HIS8_METTH       --S----IKEIADAYGLKEDEI---IKLGSNENPLGPSP-AAVEA----MER--ELE-SV
HIS8_METS3       --S----QDEIASEFNLNKDDI---IKLGSNENPFGPSA-KAIEA----IGK--ECK-NI
HIS81_ARCFU      ---------------------M---VKLASNENPYGPSP-KAIEA----FR---SYS-DL
HIS8_METMA       --S----IEEIASTYGLKPESI---IKLGSNENPLGPSP-KAVKA----LIE--AAP-GA
HIS8_METAR       --N----VEEVAASYGIDEKSI---IKLASNESCLGASP-LAIEA----IRK--AAC-DA
HIS8_FRAP2       ---------------SLKVDGD---IWLNANESPYNDEY-------------------LY
HIS8_XYLFA       ---------------SVALTGD---LWLNANESAWPNPA---------------DSHATM
HIS8_COLP3       --------RLFASGDNEQANSR---TWLNANEAPGQGQY-QLSSE-------------NI
HIS8_SHEAM       ---------------RIGGSGE---IWVNANESPFNRTG----------------ID-GA
HIS8_SHEON       ---------------RLGGKGD---IWINANESPFNNVA----------VGE--LDLTKL
HIS8_BUCCC       ---------------RIGIQGR---IYLNANESPWINNI-QYKFN-------------NL
HIS82_IDILO      -----------RSMSGGN-------IWLNANESPYSNSY-TVDDS-------------KL
HIS8_BUCAI       ---------RIGGEHGN--------ILLNANESPVSIFF-KLKKK-------------PF
HIS8_BUCBP       ---------------SIGGNGD---VWLNANEFPISSCL-SLINI-------------SL
HIS8_BUCMH       ---------------KIGGKGD---IWLNANEFPEFNNI-KLNNI-------------IL
HIS8_PSEA6       -----------RLFSGAGNKQQ---VWLNANESPFANDF-TIDAE-------------RF
HIS8_AERHH       ---------------RIGGKGH---VWLNANEAPLAYPF-TIEGG-------------RL
HIS8_BLOPB       ---------------KCTHSGN---IWLNANEFPIAPDY-QFRYK-------------KI
HIS8_PHOPR       ---------------RLGGSGD---IWLNANESPFANEY-SVTCG-------------RL
HIS81_HAEIN      ---------------KLGGNGT---IWLNANEYPTSPEF-QLSGK-------------DL
HIS8_YERPE       ---------------RLGGNGD---VWLNANEYPLGTEY-QLTTQ-------------TF
HIS8_ECOLI       ---------------RLGGNGD---VWLNANEYPTAVEF-QLTQQ-------------TL
HIS8_VESOH       ------------------SADM---VKMDAMESPFSLSD-ELTDQYLTYLVDA-----QL
HIS8_HAHCH       ------------------ASGL---IKLDAMENPFDFPA-ALKAELGVDLRDA-----AI
HIS8_NEIMA       VPP-----------------GF---AKLDSMESPVHPFA--GHETLLQEWQARLAAA-PI
HIS82_NITOC      -AA-----------------DL---IKLDAMENPYTWSP-ELIEAWLERLR----QV-SV
HIS81_NITMU      ------------------ACGM---IKLDAMENPYPLPP-ELRDE----IAKLAGET-PV
HIS82_BORBR      -AA-----------------GC---IKLDAMECPYELPA-EVRDDIARAAR----ET-PL
HIS8_CHRVO       ------------------ADGF---IKLDAMENPWPLPI-ELQHELAAELAQV-----AL
HIS8_METPP       ------------------SDGF---VKLDAMENPHRLPA-ALQAE----LGRRLGAL-AI
HIS81_RALSO      ------------------ASGM---VKLDAMENPYHLPA-MLRDALGKRLAEV-----AL
HIS8_HYDS0       ------------------TPCH---IKLSSNENPFDLEE-SVKLELLEVIKNI-----EF
HIS8_AQUAE       -TP-----------------AS---VRLSSNEFPYDFPE-EIKQRALEELKKV-----PL
HIS82_ARCFU      --F----PEDFPDKEV---------VNLSSNENPYEPSE-EVREA----YLR--AVK-YI
HIS8_GLOVI       -FP-----------------EA---DKLDANELPHDLPE-WLKNK----LAFLLEQGVRT
HIS8_SYNJB       -AP-----------------AA---DKLDANEFPLDWPA-GFKQK----LSLLWEKGIPS
HIS8_THEEB       --------------SDSLPLEL---DYLDTNEFPWDLPT-ALKEV----LAQQYVSTLAS
HIS8_SYNE7       ---------------GGTGMAM---DILDTNECPYDLPT-DLKQT----LADRYVEAIAS
HIS82_NOSS1      --S----SDTASAVPPQL-------DRLDTNESPYDLPP-ELKQKLAWTFQQ---VI-ES
HIS8_CYAP4       -EA---------DADGAAARGL---DRLDANEFPLDLPE-DLKQKLAWSYQQ---EL-EA
HIS8_DEHM1       -----------APELVKTKNRI---IKLDANENLYGAAP-TVQKAMS-------TFD-QY
HIS8_ROSCS       --P----LETLAERLGLPVERI---IKLDANENPYGPSP-RALAALAAVEHD--APH-RY
HIS8_YEAST       ------------DDFTEG-------ILLDANENAHGPTPVELSKT-------------NL
HIS8_CANMA       -DD---------------FKTG---ILLDANENTHGPAI-PTPDE-----TE--LAL-EL
HIS8_CYTH3       --------------DEYKGTEG---IFLDANENPYG----SAIQK-------------MV
HIS8_GRAFK       ------------DEFKTQGAEM---VFLDANENPNDN---------------------GL
HIS8_BACTN       ---------------DEYKGAV-ASVFLDANENPYNLPH---------------------
HIS8_PARD8       -DE-------------FHGDAS---VFLDANENPWNMPY---------------------
HIS8_THEGJ       --------------------GN-YRIRLDKNENPYDLPG-EVKEEIFEELREV-----SF
HIS8_DESHD       -IP-----------------DC---VRLDANENPLPWPP-GMIEQ----LLG--SAI-AF
HIS8_RUMCH       -QP-----------------YK---IKLDANESPFTLPP-QMRKK----LAEYILEDPQL
HIS81_CARHZ      ---------------------VSYEIKLDANENPYLFPK-SLLEEIFSKIGTR-----DF
HIS8_PELTS       -YP-----------------EV---VKLDANENPYGFPP-EVLTA----ILSEVGSR-EF
HIS8_THEP3       --------------------IP-YRYKMDANETPFELPE-EVIKN----IQEIVKSS-QV
HIS8_CLOK5       --------------LDYE-------IKLDANESFLKLDD-YMMGKILNKIKDV-----EF
HIS8_CLONN       -EK-----------------YK---IKLDANESFIGLSK-EIKNK----IIRSLIEL-EF
                                                *                            

HIS83_RHILO      YLYPED-DNISLREAAANA--------YS-------------V-S-MD-QVIAGNGSSEL
HIS8_STRGC       RKYSSL-DQAELCQALAAN--------LG-------------V-S-PD-QLIIGNGSDDI
HIS8_LACLA       RLYPST-DAKSLRKKLADY--------HH-------------L-E-VE-QVIIGNGSDEV
HIS8_SYNAS       RLYPDP-WSLSLRQKIARK--------YS-------------V-D-VD-NIFVGNGSDEI
HIS81_OCEIH      RLYPSP-TVDELRSEIGEM--------YG-------------L-S-QD-HIFIGNGSDEV
HIS8_BRAHW       RLYPDP-NVSDLKKEIAEL--------YN-------------I-N-TN-NIFIGNGSDEI
HIS8_CLOB8       KLYPDP-TCSELTSEIANY--------YK-------------L-D-EN-EIFIGNGSDEI
HIS8_CLOB6       RLYPDP-NCDALRKTIANY--------YN-------------L-S-KE-EVFIGNGSDEI
HIS8_CHRSD       RLYPDP-SATALREALAET--------YD-------------V-A-TE-QVFVGNGSDEV
HIS8_ACEPA       RLYPDP-EALALRKALGAR--------IG-------------L-G-PE-YVFVGNGSDEV
HIS8_MARMS       RLYPDP-NCATLKNALAKS--------YQ-------------L-D-AN-QVFVGNGSDEV
HIS82_PSYA2      RLYPAP-ESEELRGALAAL--------YN-------------L-D-IN-QVFVGNGSDEV
HIS8_ACIB5       RLYPDP-DATALKQAIAKQ--------QN-------------I-D-VS-QVFVGNGSDEV
HIS81_METCA      RLYPDP-NAELLKQAIARY--------HG-------------V-G-AN-QVFVGNGSDEV
HIS8_SYNY3       RLYPDP-VSTQLRQAAADL--------YG-------------V-D-LN-QVLAGNGSDDI
HIS8_RHOBA       NRYPDP-MATSFRRAAANA--------LG-------------L-PGPE-WVLAGNGSDEI
HIS8_GEOBB       RRYPDA-ASRLAREEAAKV--------YG-------------F-D-PS-WIIMANGSDEV
HIS81_NOSS1      RRYPEP-FGEEFRKAVSQL--------LG-------------V-P-CN-WVIVGNGSDEI
HIS8_DEIRA       NRYPDL-HADTLRAAIAGY--------EG-------------W-D-AA-GVVITPGSNVL
HIS81_LEGPL      NYYPNIGLQIELQKQLAKR--------YQ-------------I-N-SD-QIILTRGSDDG
HIS8_SACS2       NRYQHPDLLEKYRELAAEY--------SK-------------V-E-PE-NIYPSVGADGS
HIS8_CHLCH       NRYPDI-LPYRAMEAYANF--------VG-------------V-P-AE-CVIMSNGSNEM
HIS8_BIFAA       NRYPDR-EHIELRKAFSTY--LERESGVK-------------L-S-VD-QLWGANGSNEI
HIS8_CUTAK       NRYPDR-EATGLREDLARY--I----GFG-------------I-S-SS-QIWPANGSNEV
HIS8_MYCA1       HRYPDR-DAVQLRSDLARYLTAQTGVQLG-------------V-E----NLWAANGSNEI
HIS83_BURL3      NRYPDR-DFAALRSHLAAY--LTHDTGVT-------------V-D-AS-SVWAANGSNEV
HIS8_PAEAT       NRYPDR-EFTELREALAEY------LGHG-------------L-S-PD-NIWAANGSNEV
HIS8_FRACC       NRYPDR-DAEALRADLAYY--LTPDAGFG-------------V-H-TS-QVWAANGSNEI
HIS82_CAUVC      HIYPDP-HSDVLRAAIGAR--------LG-------------V-S-PA-RVVVSPGSEAL
HIS81_GLUOX      FRYPDA-SAEGLREELSRQ--------TG-------------I-D-TD-RIVIGNGSEQI
HIS81_RHILO      RLYPDP-AGRELRQAIAAK--------YG-------------F-G-ED-QIILGNGSEDL
HIS83_RHIME      RLYPDP-QGRALCARLAAS--------FD-------------V-E-NN-QVILGNGSEDL
HIS8_LEUMM       GYYPDG-QATELREAVAKL--------NH-------------V-D-PQ-HLVFGAGADEL
HIS8_LACF3       NRYPDG-DASELRALVGQQ--------LN-------------V-A-GD-QLVFGVGLDEI
HIS8_LACPL       NRYPDA-DAQELRQAVAQQ--------QG-------------I-D-PN-SIVFSVGLDEM
HIS8_HALSA       HRYPKA-VHADLTGALADR--------WD-------------V-G-DD-QVWVANGGDGA
HIS8_HALWD       NTYPKS-SHTDLTARIADY--------WG-------------L-S-PE-QIWLSPGADGA
HIS8_DESAG       FRYVQS-GNPRLVSAIARS--------FG-------------V-A-AE-SVVTGNGSDEV
HIS8_LEPIN       SFYPDD-SYLDLKTAIASK--------FD-------------L-T-TD-RIIPGNGSDQV
HIS8_HELHP       FLYPDD-SMYELKNALASH--------FD-------------V-E-SK-HIIIGAGSDQI
HIS8_NITSB       YMYPDD-SMFELKSALAKR--------FE-------------I-D-QK-NIIIGAGSDQV
HIS8_ARCB4       CLYPDD-SMYELKDALAKK--------YN-------------L-E-SS-NIIIGSGSDQI
HIS8_CAMHC       NLYPDD-SMFELKGALADK--------YG-------------V-S-EK-NVIIGAGSDQI
HIS8_CAMFF       SLYPDD-SYYELKDGLSNL--------YK-------------V-E-PK-NVIIGSGSDQI
HIS8_RUBXD       NRYPDR-YAAALREAVAAA-------NPG-------------S-D-VA-NVLVGNGSSEV
HIS82_LEGPL      ATYPSP-WNHPLMSKLASY--------LK-------------V-K-PE-QLFLSNGSDYL
HIS8_PELUB       SKYPDG-KAKNLRKEISKK--------FK-------------C-D-FE-RIICGAGSDEI
HIS8_HYPNA       HVYPDP-DYGPLRAAIAAA--------KG-------------IAD-AS-RVVTSAGSDEI
HIS8_ZYMMO       SLYPDS-GATALREAIGAC--------YN-------------L-D-PA-RIIHGTGSDEI
HIS8_NOVAD       ARYPDP-DSKDLRAAIGEV--------HG-------------I-D-PS-RIVMGTGSDEL
HIS8_JANSC       HRYPNT-DHADLRAAISEI--------HG-------------L-E-AD-NIICGVGSDEV
HIS8_PARDP       HRYPNT-DHAGLRGAIGEV--------HG-------------L-D-PD-RIICGVGSDEI
HIS81_CAUVC      HIYPDG-KANFLRAAVAER--------YK-------------L-E-PE-RLTFGDGSDEI
HIS8_ACICJ       HRYPDG-GATSLRAAIGRR--------FC-------------L-D-PA-RIVCGNGSDDL
HIS8_GRABC       HRYPDG-GSHALREAIGRY--------FG-------------L-D-PA-RIVCGVGSDEM
HIS8_RHOCS       HRYPDG-GSTRLREAIGHR--------FG-------------L-D-PA-RVLCFNGSDEV
HIS8_RHORT       HRYPDG-NATALREALGRT--------HG-------------L-D-PA-RIVCGAGSDEL
HIS8_MAGSA       HRYPDG-GAEDLRKAIGAR--------FG-------------L-D-AS-RIVCGAGSDEL
HIS8_MARMM       HLYPDG-GATKLREAIAEA--------EG-------------L-E-AE-NIVCGTGSDEL
HIS8_XANP2       EDYPDG-SATVLRQAIATA--------YG-------------L-D-PA-RIICGAGSDEI
HIS8_BDEBA       HLYPDP-SHYELLQTLSKE--------WG-------------F-P-TK-QLAIGNGSDEL
HIS8_METI4       HLYPDG-YGYYLKEALSHH--------LD-------------I-D-AE-NIVLGNGSNEI
HIS8_DESPS       QRYPDG-SAYYLTEAIAKY--------AG-------------V-G-MS-EIILGNGSNEV
HIS8_ALKOO       NIYPDA-YAMKLKEEIAKR--------TN-------------L-T-HE-NIITGNGGEQI
HIS81_PSYA2      SRYPDG-NGYYLKQALADF--------ND-------------V-N-VD-QITLGNGSDDL
HIS8_AKKM8       NIYPDG-AAFRLRSAIAEF--------CG-------------V-E-FG-QTVVGTGSSEV
HIS82_HYDCU      GRYPDG-NSFYLKQDLADF--------LQ-------------K-Q-PT-EIALGNGSNEL
HIS82_HAEIN      TRYPDA-NGFELKQTIAKK--------FG-------------V-Q-PN-QITLGNGSNDL
HIS81_IDILO      VRYPDA-NGYYLKSRLAEL--------NE-------------V-G-TQ-QITLGNGSNDV
HIS81_NITOC      GRYPDG-NGFALKTALSQC--------LG-------------I-P-AN-QITLGNGSSDL
HIS81_CUPPJ      GRYPDS-NGFELKAALSTK--------LG-------------V-P-QD-WLTLGNGSNDI
HIS82_METCA      HLYPDG-SGFELKAALAEK--------LG-------------V-E-PA-QIVLGNGSNDV
HIS82_PSEF5      TRYPDG-NGFALKSLLAER--------CG-------------V-E-ID-QVTLGNGSNDI
HIS81_THIDA      ALYPDG-AGYALKAKLSAR--------LG-------------V-D-AA-QIVLGNGSNDV
HIS82_NITMU      SLYPDG-SGFELKAALSER--------YG-------------V-T-SD-QIVLGNGSNDV
HIS8_ANADF       HLYPDG-SAYLLRNAIAAK--------LG-------------V-P-PE-EVMVGNGSNEL
HIS8_SYMTH       HTYPEG-TARRLRERLAQM--------WN-------------L-P-AD-WFLIGNGSDEV
HIS82_CARHZ      NYYPDG-GAFRLKEKIAAK--------YG-------------V-T-PD-NIILGNGSDEL
HIS8_CALS8       SLYPDG-NCTELKLKLAKK--------LN-------------V-K-PT-QIIFGAGSDEI
HIS8_MOOTA       FLYPDG-NCYYLKEALAAK--------LG-------------V-K-QE-NLIIGNGTDEI
HIS8_STACT       LYYPET-GAPTLRKKIADT--------LN-------------I-D-EN-RILFGAGLDEV
HIS8_MACCJ       NYYPDP-EAIQLKASLSEF--------YQ-------------V-D-SE-QILVGAGLDEI
HIS82_OCEIH      HIYPDG-YTSDLRTDLTQK--------LN-------------I-D-ES-EIIFGSGSEEI
HIS8_LISIN       EIYPDG-WASSLRKEVADF--------YQ-------------L-E-EE-ELIFTAGVDEL
HIS8_LYSSC       ALYPDG-YAQNLRTAVANH--------LG-------------V-Q-ET-QLLFGNGSDDI
HIS8_BACSK       FLYPDG-YGTALRKALAAK--------HK-------------V-D-EG-QLILGNGTDEV
HIS82_BACAN      ALYPDG-GATTLRQTIANK--------LH-------------V-K-ME-QVLCGSGLDEV
HIS81_BACAN      ALYPDG-HAFELRTQVAKH--------LG-------------V-K-AE-QLLFGSGLDEV
HIS8_BACHD       AIYPDG-YARTLRDKVAHY--------VG-------------V-A-PE-ELIFGNGSDEV
HIS8_ANOFW       ALYPDG-YSRTLREALAAH--------IG-------------I-S-EK-QLIFGNGSDEV
HIS8_BREBN       ALYPDG-ASLNLRWDLADF--------LG-------------V-K-PS-QLFFGNGSDEI
HIS8_THEMA       RIYYDS-PDEELIEKILSY--------LD----------TDFL-S-KN-NVSVGNGADEI
HIS8_METLZ       NRYPDP-KAAAFHAALRTY-----------------------ICD-CP-VVTSGLGMDGV
HIS8_METMJ       NRYPDE-RTSVLVEALRRY--------HG-----------------DY-RFVTGSGMDGV
HIS8_METJA       HQYPEP-VNPILMKELSKF--------LN-------------V-D-EENIIVGGDGADEI
HIS8_METKA       HEYPEPLAPPSLYEAIIDY--------LA--DPPYPAGEPVEI-T-REHLVVGGDGADEI
HIS8_METST       NRYPES-NHEYIKEQIAKY--------AN-------------V-T-KDQVIIGGDGADEL
HIS8_METTH       HRYPES-ALTDLREAIADY--------AG-------------V-G-MDQVIVGGDGADEI
HIS8_METS3       NRYPES-VLNELQQELANY--------SG-------------V-K-QSQVIIGGDGADEI
HIS81_ARCFU      HIYPNP-EYRELREKISDY--------TG-------------W-D-AD-RVVVGAGIDGI
HIS8_METMA       NIYPSA-DAHELREALSKY--------TG-------------F-PVSN-IVASGPGMDGL
HIS8_METAR       HVYPSV-DAIELREALAMR--------HG-------------V-P-VR-NIVCGNGMDAV
HIS8_FRAP2       NRYPEP-QPRKLVEKLAKI--------YD-------------V-D-AS-NILVTRGSDEG
HIS8_XYLFA       RRYPEP-QPPKLRQMLAAL--------YG-------------C-V-PE-QLLIGRGSDEG
HIS8_COLP3       NRYPDF-QPQALLKAYSNY--------CN-------------L-P-VD-NILATRGADEG
HIS8_SHEAM       NRYPEC-QPPGLIAAYAAY--------AG-------------V-A-AH-ELVCGRGADEA
HIS8_SHEON       NRYPEC-QPPALINAYSQY--------SG-------------V-V-ES-KIVASRGADEA
HIS8_BUCCC       NRYPEF-QPYKLLKKYSLY--------SG-------------V-P-IN-QILITRGADEG
HIS82_IDILO      NRYPEF-QSKPLNQAYAEY--------AG-------------I-N-AS-KVLSSRGSDEG
HIS8_BUCAI       NRYPEC-QPSKLISSYAHY--------VN-------------L-S-CN-QILATRGADEG
HIS8_BUCBP       NRYPEF-QPKKLLNAYAFY--------LG-------------I-C-SE-KILVTRGSDEA
HIS8_BUCMH       NRYPEC-QPEQLTSCYSSY--------IG-------------I-N-KS-NILITRGIDEA
HIS8_PSEA6       NRYPDC-QPPAVIDAYAAY--------AG-------------V-Q-PE-QLLVSRGADEG
HIS8_AERHH       NRYPEC-QPAEVVNGYAAY--------AG-------------V-N-PD-QVLVSRGADEA
HIS8_BLOPB       HRYPTC-QPQEVINNYAYY--------AG-------------V-R-SD-QILVSRGADES
HIS8_PHOPR       NRYSEC-QPADLIQAYADY--------AG-------------I-D-SK-QVLTSRGADEG
HIS81_HAEIN      NRYPEP-QPQRVVQAYANY--------AG-------------V-S-TE-NVLVTRGGDEG
HIS8_YERPE       NRYPEC-QPKHVIERYAAY--------AG-------------L-P-PE-QVLVSRGADEG
HIS8_ECOLI       NRYPEC-QPKAVIENYAQY--------AG-------------V-K-PE-QVLVSRGADEG
HIS8_VESOH       NRYPSP-SSDKLNQTLRLL--------MN-------------I-P-KEFGVLLGNGSDEL
HIS8_HAHCH       NRYPDP-DAGAIRTALREL--------YS-------------L-P-ASADMLFGNGSDEI
HIS8_NEIMA       HLYPNP-SGSGLQEALRSA--------FD-------------IPD-CA-DIALGNGSDEL
HIS82_NITOC      NRYPDP-QARSLKLRLRQY--------LA-------------L-P-EDMEMILGNGSDEL
HIS81_NITMU      NRYPDP-DAAALKAALREA--------LS-------------I-P-DGMDIMLGNGSDEI
HIS82_BORBR      NRYPAA-ANPALQAQVRQA--------FE-------------V-P-AQAGLLFGNGSDEL
HIS8_CHRVO       NRYPDA-DGGGLKAALRAA--------FA-------------I-P-AAAGIVLGNGSDEL
HIS8_METPP       NRYPGT-RTDELRAALARH--------AG-------------L-P-PGCALMLGNGSDEL
HIS81_RALSO      NRYPVP-TADALKAQLKRV--------MR-------------V-P-AGADVLLGNGSDEI
HIS8_HYDS0       NRYPDP-HATKLRQTLSKL--------YE-------------V-E-PE-NIMVCNGSDEA
HIS8_AQUAE       NKYPDP-EAKELKAVLADF--------FG-------------V-K-EE-NLVLGNGSDEL
HIS82_ARCFU      PRYPKA-DYARLKKALAEY--------TG-------------F-E-VE-NIAVGCGASEL
HIS8_GLOVI       NRYPEG-DPLALKAAIAEY--------CG-------------V-T-SE-MVCVGNGSDEL
HIS8_SYNJB       NRYPDA-HHRGLKQAIAAY--------AG-------------A-E-PE-QISLGNGSDEL
HIS8_THEEB       HRYPDS-HHWPLRQAIARY--------VS-------EQSPTEI-S-PH-QIAVGNGSDEL
HIS8_SYNE7       NRYPDG-SHTDLKAAIVDY--------LS----EQ-TAGQWQP-G-PE-HVTVGNGSDEL
HIS82_NOSS1      NRYPDG-GHETLKSAIAEY--------VN----ESANISSLRF-T-AA-NISVGNGSDEL
HIS8_CYAP4       NRYPDG-GHWELKRAIAEY--------VN-----EALPVPSWI-D-HS-HVSIGNGSDEL
HIS8_DEHM1       HIYPDA-TQFEIRRLLAEY--------TG-------------V-N-ME-QIICGAGSDQL
HIS8_ROSCS       AIYPDP-DHTRLRAALSRY--------VG-------------Q-P-PE-RIICGAGSDEL
HIS8_YEAST       HRYPDP-HQLEFKTAMTKY--------RNKTSSYANDPEVKPL-T-AD-NLCLGVGSDES
HIS8_CANMA       NRYPDP-HQLELKQQVIDF--------RE---KHPNKYTKEKL-S-VE-NLCLGVGSDES
HIS8_CYTH3       NRYPDP-LQRDVKTALSAL--------KN-------------V-S-AE-HIFFGNGSDEP
HIS8_GRAFK       NRYPDP-QQTSVKEKLSET--------RG-------------V-S-PN-NILLGNGSDEV
HIS8_BACTN       NRYPDP-MQWELKTLLSKI--------KK-------------V-S-PQ-HIFLGNGSDEA
HIS8_PARD8       NRYPDP-LQWKLKDRLAVL--------KG-------------V-D-RS-SIFLGNGSDEA
HIS8_THEGJ       NRYPHI-TSMPAREAIADF--------YG-------------V-S-PD-NVAVGNGSDEL
HIS8_DESHD       NRYPDG-GAQELKEALSRY--------TG-------------V-P-AE-GILTGNGSDEL
HIS8_RUMCH       NLYPDT-DSVQLRQALGEY--------WS-------------V-D-KE-NIIVGTGSDQL
HIS81_CARHZ      PLYPDP-LAGRLRIRLSEK--------LG-------------V-L-PE-NIVLGNGSDEL
HIS8_PELTS       SRYPDA-AAGRLRESLAGY--------TG-------------V-D-PE-NIMVGNGADEL
HIS8_THEP3       NVYPDP-TAEKLKEELARY--------CG-------------V-V-PT-NIFVGNGSDEI
HIS8_CLOK5       NRYPDA-GAEKVCRAYSKY--------VG-------------I-N-RE-NIMAGNGSDEL
HIS8_CLONN       NNYPDP-DATKLKKAYGDY--------IG-------------I-D-EK-NIMVGNGSDEL
                   *                                                    * .  

HIS83_RHILO      LGLVYRAFLT-PGD-SVAMMSPGFSFNRKLATLQGAQFVEIEFS--KD------HSLPME
HIS8_STRGC       LSMAFLAFFN-SGE-SVLFSDLTYGFYKVWADLYQVPFREIPLT--AD------FEVHPS
HIS8_LACLA       LSLSFLTFFN-SQS-PLLMPDITYSFYPIYCELYRIPFQKVPVD--DD------FKVLIK
HIS8_SYNAS       LSFVWYAFFD-GLYGKLVFPQFTYSFYPVYCDFYEIPYRRIPLR--PD------FTLDLE
HIS81_OCEIH      LAFSFMSFFE-PGN-RIKYPEITYSFYPVYAKLFNISTDVIPLN--DD------YTIPVE
HIS8_BRAHW       LAFCFMAFFN-RGD-KIYYPNITYSFYSVYSSLFDLNEVKIPLK--DD------FTIDIN
HIS8_CLOB8       LAFSFMTFFS-KNK-KILFPDISYTFYKVYAELFDLNYELVKLD--DN------FDIPLE
HIS8_CLOB6       LAFSFLTFFN-PEE-TVVFSDISYSFYPVYANLYKLDYKLAKLR--ED------FSIDIN
HIS8_CHRSD       LALAFQAFFR-QSR-PLLMPAISYSFYPVYCKLYDVAYRSVALD--DQ------WRVPLT
HIS8_ACEPA       LAHAFQAFFA-HGE-PLLFPDVTYSFYKVYCGLYSLPFRNVPLT--DD------MQVNVA
HIS8_MARMS       LALAFMGYFA-GGK-PLAFADITYSFYKVYAGLYSIEPKLIPLN--DD------FDIIPA
HIS82_PSYA2      LALVFASFFL-KNR-PVLAPDISYSFYPVYANTFGIELVQIPLE--AD------FSISPD
HIS8_ACIB5       LAHIFKAFFL-QDE-PILYPDITYSFYPVYSQFFGTKTKEIPLN--ES------FEIDVR
HIS81_METCA      LAHAFQALLK-QTR-PILFPDITYSFYPVYCGLYDIAHETVPLT--ES------FEIRIE
HIS8_SYNY3       LNIVVRTFVD-PGE-TVAFLDLTYSLYETIASVHGAKVQKIATD--AN------FDLTGP
HIS8_RHOBA       LTLLVRGFVG-EGE-SLRLPYPSYILYRTLADIQGANWEQVPFN--DP------WELPQS
HIS8_GEOBB       LNNLIRACAG-EGE-EIAFINPSYSYYGTLAEVQGARVRTFGLS---E-------SFEPE
HIS81_NOSS1      LSIVIRACAE-PTR-KVVYPVPTYVLYRTLTEMQAADILEIPYR---E------YNILPV
HIS8_DEIRA       IKILTE-LGG-IGQ-TVLTTDPTFSVYTLEAAMLGAELVLTPLN--PD------FSLPVE
HIS81_LEGPL      IDLTTRLFLT-AGKDAFMQFPPTFPMYAFYVRLQQAELIECPLD--RR---TN-FRLTLD
HIS8_SACS2       IRAIFYNLVE-PGD-TILTNYPSYSMYSVYSSVRGTKVIKVNLK--ED---NEWWKENTD
HIS8_CHLCH       LYTIFLACLG-PGR-KVLIPNPSFSLYEKLALLLQSDIVEVPMK--SD------LSFDVE
HIS8_BIFAA       MLQLFQAFGG-PGR-IALGCDPTYSMYPEYARDTFTTWKLAHRN--AD------FTLDVD
HIS8_CUTAK       MTHILQAFGG-PGR-SMLTFTPTYSMYPEYARNTHTNYVTRPRN--AS------WGLTTD
HIS8_MYCA1       LQQLLQAFGG-PGR-SAIGFVPSYSMHPIISDGTRTEWLQAARA--DD------FSLDVD
HIS83_BURL3      IQQILQAFGG-PGR-SALAFTPAYPMYDEYCRTTFTRLHTLPRT--ED------FALDLN
HIS8_PAEAT       LQQILQAFGG-PGR-KALGFPPTYSMYPLLASGTDTEYVRGVRA--DD------YGLDAQ
HIS8_FRACC       LQQLLQAFGG-PGR-VALGFEPSYSMHRLIALATATEWVAGQRA--ED------FTLSPA
HIS82_CAUVC      IDYVFRAVLH-PGD-SILLSSPTFPTYEIFGRCAEARIIDVPRL--AN------FDIDVP
HIS81_GLUOX      IRMICEAFLS-PGD-RLVTVLPSFGLHLIWPQMMGARAEAIPMT--AD------ARFDLP
HIS81_RHILO      LSVISRAVLR-PGD-SVVTLYPSFPLHEDYATLMGASVKRVTVN--DD------LTINAD
HIS83_RHIME      IAVICRSVVR-AGD-TVVTLYPSFPLHEDYTTLMGGKVDRVTVT--PD------LSVDMD
HIS8_LEUMM       IELLTRVVLE-PGS-NIIIPNPTFGEYAMHAQIEQSTTKKIPVN-VDN------GNVDFD
HIS8_LACF3       IELVARAFLT-PDD-QVVVAKPAFSEYALHATVEGAAVKEVPVNPATG-------HFDFA
HIS8_LACPL       IVMLSRTFLA-TND-QVLVSAPTFSEYGLHAEIEGGQLISVPTL--PN------DHVNFE
HIS8_HALSA       LDYLARATLD-PGD-SVLVPSPGFTYYGMSARFHHGNVAEYDVA--EG---ADGFEMTAD
HIS8_HALWD       IDYLSRAFLT-PGD-TMLISDPGFSYYPMSARYHHGSIRTYPVSKEQD------FQQRAS
HIS8_DESAG       IDLIIRVKAR-PGKHNIVAFNPCFSMYELQTRFCGVEFRQVPLR--AD------FSFDYD
HIS8_LEPIN       LDFVCRCVLD-QGD-SVLINRITFAMYKIYALQCGAKIHSTDSV-----------THDLN
HIS8_HELHP       IEFCMQALNH-HNA-QVLMAKTTFAMYEVYAKLAGVEISKTPSD-----------EHILE
HIS8_NITSB       LEFCARAVLN-EKS-SVLMSKITFAMYEIYALQQGAKIIRSSC-----------YRHDLE
HIS8_ARCB4       LEFCIHAKCK-KDS-KILMAKTTFAMYEIYGKHVGAEIIKTNSE-----------QHNLE
HIS8_CAMHC       IEFLIHAKCN-ENN-GILTAGTTFSMYGIYAKHAKAKHFSTASK----------F-HDLK
HIS8_CAMFF       IEFALHAKAN-EKK-GILVSGVTFAMYEIYAKHVGAKIYKTKSK-----------EHNLA
HIS8_RUBXD       LQNLLMLVER-PGE--VLFPWPTFTLYPSIAGTLGLRARRVPLT--EE------HRVKPE
HIS82_LEGPL      FNILLNCFAL-HTDRHILTHDYAFSTYAIQANSLQIPINSVPIG--HN------WEVNIT
HIS8_PELUB       IQMICQLYLK-PSD-EVIVPQYSFLMYRIYAQIVGAKVVFSKEK---N------FKVSIN
HIS8_HYPNA       IHLLTQCYAG-PGD-EVLFTEHAFSMYRVSAGAHGATSVTVPET---D------MTAGVN
HIS8_ZYMMO       LHLAAGAYAG-QDD-EVLYPRYSFSVYPLAARRVGATPVEAPDD---D------YRCSVD
HIS8_NOVAD       LNLAAQAYAG-PGD-EVLYVRYGFSVYDIAARRCGAVPVVAPDA---D------YGTDVD
HIS8_JANSC       IHFLCQCYAG-PGD-EVLYTQHGFGMYPIAAKAAGATPVQVAED---A------RHVDVD
HIS8_PARDP       IHFLCQAYAG-PGT-EVLFTEHGFLMYRISAHAAGAIPVQVAER---D------RVTDID
HIS81_CAUVC      FALLCQVYLE-PGD-NIVQGEHGFAAYAIGARACQGEVRMAKEV---N------HRVDID
HIS8_ACICJ       IALLIQSYGG-PGT-ELVMSRHGFLIYEIAARLAGMNVRKAPER---N------LTADID
HIS8_GRABC       IAHLCMAYSN-PDS-ELIMSVHGFSVYEMYGHYAGAKVVKVPEQ---A------LTTDVD
HIS8_RHOCS       LHLLAQAYAG-PGG-EVLYSRHGFLVYPIAARAAGATPVAAPER---N------LTTDVD
HIS8_RHORT       IGLLCRAYAG-PGD-SIVQSAYGFLMYGIYARGVGAEPILAPES---D------LTADID
HIS8_MAGSA       LGILCRAYAG-PGD-EVLYSAHGFLMYAIAAKACGATPVTAPEV---D------LTANVD
HIS8_MARMM       LQLLGRAYLN-PGD-KVVQSQYGFLVYRLVAMQCGANLVSAPER---D------YRSDVD
HIS8_XANP2       LNLVAHTYVG-PGD-EVIFSEHGFLVYKIATLASGGTPVVARER---D------LTADVD
HIS8_BDEBA       IDLLCRIYCE-HHD-GVLTSAAAFNAYEVSAPANRAVIHKVPMA--EG------YRFDLP
HIS8_METI4       IELLFHVFAT-NEEDEVLFSKYAFAVYKLMAELFGVPFKEIADV---S------FNHDLK
HIS8_DESPS       IEFLVKAFVQ-DDS-EVITSHPSFLMYQKFVQVRGGVNRVIPLK---D------MHHDLQ
HIS8_ALKOO       IQLIAQTFIN-PGD-EAIMADTTFGLYETSVLNMKGVPVILPLK---D------YKHDLD
HIS81_PSYA2      LDILARSFVG-ADD-AIVYSQYAFVVYSMLAKMQGAMDVEVPAQ---R------FGHDLK
HIS8_AKKM8       IELICHALLN-PRA-EVVAAKHAFSMYPIMSKLFGAAYVEVPNK--ED------WTHDLD
HIS82_HYDCU      LELVARIFAG-KGD-EIIYSQYAFAVYSISTQAVGATGIEVPAK---E------WGHDLE
HIS82_HAEIN      LELFAHTFAT-EGD-EIMYSQYAFIVYPLVTKAINAIVKEIPAK---N------WGHDLQ
HIS81_IDILO      LEILARTFVS-DKD-EVIFSQHAFVVYPLVTQAIGAKPVAVPAV---D------YGHDLD
HIS81_NITOC      LEFAARVLIS-PEH-EVIYSQYCFALYPLLIQILGAKGHAVPAK---G------FGHDLE
HIS81_CUPPJ      LELAAHALVT-PGQ-SIVYAEYSFAVYALATQEIGARAIVVKAR---D------YGHDLD
HIS82_METCA      LDLVARAFLT-AGR-NAVYSEYAFAVYPIATQTAGATGKTAPAH---DGSRGPRFGHDLE
HIS82_PSEF5      LELVARAYLA-PGL-NAVFSEHAFAVYPIVTQAVGAQARVVPAK---N------WGHDLP
HIS81_THIDA      LDMVARAYLA-PGT-SAVYAQYAFAVYPIATHTVGAHGIAVAAR---D------FGHDLE
HIS82_NITMU      LELAARVFLK-PGA-STVYSQHAFAVYPLVTKAVGGIGISVPAR---N------YGHDLD
HIS8_ANADF       IELLVRTFVL-DGE-EVLTSAQSFVAYKLAAHEHGRTLVEAPMK--GR------FHYDLD
HIS8_SYMTH       FRLLAEVYLE-PGD-RVVVPEPSFAAYRFVAELMGAEVVAVPLA---G------WTMDLP
HIS82_CARHZ      VMFLAMALID-PGD-EAIMPVPSFPRYEPVVTMMNGIAREIPLK---E------HRLDLK
HIS8_CALS8       TQLIASIFIN-PGD-NSIMARPSFPRYETVTKVMGGIPIEIPLK---N------YTHDLE
HIS8_MOOTA       LKMLAETYIN-PGD-EIVVADPTFSEYEFAAQVMGGRAIKVPTR---N------FRHDLA
HIS8_STACT       ILMISRAVLT-PGD-KIVTSQATFGQYYHNAIVESAEVVQVPLK--EN------GQFDLD
HIS8_MACCJ       IMMISRARLN-PKG-HILTSEGTFIQYTTHALIEDNEVVSIPLK---E------GKFDLE
HIS82_OCEIH      IQLLCRSYII-PGS-NVVMATPTFPQYKHYSLIENAEIKEIPTD--KE------GYHQLD
HIS8_LISIN       IELLTRVLLD-TTT-NTVMATPTFVQYRQNALIEGAEVREIPLL--QD------GEHDLE
HIS8_LYSSC       IAIITRALLY-PGV-NTIMADLSFSQYWHNAEIEGAEIRKIPCV---E------GAHDLE
HIS8_BACSK       IQLLCRSFLT-PET-NTVMATPSFSQYKLNATIEGATIKEITVK--ED------GSHDLD
HIS82_BACAN      IQMISRAVLK-AGD-NIVTAGATFPQYRHHAIIEGCEVKEVALN---N------GVYDLD
HIS81_BACAN      IQMISRALLH-EGT-NVVMANPTFSQYHHHAVIEGAEVREVSLK---D------GIHDLD
HIS8_BACHD       IQILCRAFLN-EQT-NTVMAEPTFSQYKLNAVIEGAELREVPLK---D------GVHDLD
HIS8_ANOFW       VQIICRAFLQ-KGT-NTVMATPTFPQYRHNAIIEGAEVREIPLQ---D------GHHHLE
HIS8_BREBN       LLMISRAFLS-EGT-NAVMATQTFSQYRSNGIIEGADLIEVPLK---D------GVHDLE
HIS8_THEMA       IYVMMLMFDR------SVFFPPTYSCYRIFAKAVGAKFLEVPLT--KD------LRIPEV
HIS8_METLZ       IETVIRTIVE-PGD-KVVISTPTFSMYGLAAKAASARVVNVSRS--AD------FSVDLD
HIS8_METMJ       IETVIRTVVE-PGE-TMVVSTPTFSFYGIAAAAHGARVVNVPRR--ED------FSVDTG
HIS8_METJA       IDTIFRTFVD-DGD-EVIIPIPTFTQYRVSATIHNAKIKYAKYDKEKD------FKLNVE
HIS8_METKA       IDVLTRVLVD-PGD-PVVIPVPTFSQYGISARACGAEVRKPRFDPERG------FELDED
HIS8_METST       FEVLAKTVID-EGD-EFIVHQPTYTYYEYTFKQSNAKAVYATWNIEEN-------KLDVD
HIS8_METTH       IDVLGRTFLE-PGE-SFVVPMPSYMYYEYTLQAHDARAVHARWDVNEN-------RLDLE
HIS8_METS3       IDVLAKTFID-EGD-EFIVPLPSYMYYEYLLQQYGARPVYAKWN---L----EENKLDTD
HIS81_ARCFU      LETLFRILID-EGD-EVVIPIPTFPYYHILTKLSCGKEVLVRRG--EN------YRIDES
HIS8_METMA       LDGLCRIIIE-KGD-EVIVPIPTFSYYELPARACGAEPVFIRRN--QD------FSLNPE
HIS8_METAR       IETLLRAFLE-TGD-EVVIPLPAFSYYENVTRFCGATPKYCARR--AD------FSLDVD
HIS8_FRAP2       IDLLFRLYCE-YQKDSAFAVEPTFGMYKIAAQLQGVDYKTLKLKEENN------FEINIT
HIS8_XYLFA       IDLLVRAVCE-PGCDPVLVTPPVFGMYAVSAQLQNAPVIQVPLV--DD---AAGFHADVP
HIS8_COLP3       IELIIRSFCR-AYQDSVLICPPTYGMYAISAENHGAGIISVPLV---N-TPEAQCQLDLE
HIS8_SHEAM       IELLIRTFCV-PGQDSIGIFSPTYGMYAISAATFNVAVNTLPLA--ED------FSLPDD
HIS8_SHEON       IELLIRAFCI-PGIDSIATFGPTYGMYAISAQTFNVGVKALSLS--AE------YGLPAD
HIS8_BUCCC       IEIITRTFCE-SNIDKIMFFPPTYDMYNVIANIFNIKKIIIPIL--SN------FQLDIK
HIS82_IDILO      IELLIRAFCE-PGQDKVLICPPTYGMYAISAKTFAVGVTEVPLL---NSGEVNNWQLDTE
HIS8_BUCAI       IELLIKAFCE-PGKDAIIYCPPTYDMYRINATIAGVEIKEIPTI--KN-----TWQLDLL
HIS8_BUCBP       IELLIKTFCE-PRKDKIMYFPPTYDMYDISAKILNVESIGIPLL--KS------FQLDLN
HIS8_BUCMH       IELLIKTFCN-PQNEKIIFCPPTYDMYNISAKIIGIKSYEVPLL---N----FSWQLDIN
HIS8_PSEA6       IELLIRAFCT-PGKDSVLICPPTYGMYAISAETCDVGIERAGLN--DD------FSLNVD
HIS8_AERHH       IELLIRTFCE-AGEDQILICPPTYGMYAISAETCGVGIVEQPLT--TS------RQPDWP
HIS8_BLOPB       IELLMKVFCN-PGKDVIIFCPPTYGMYKTTAEILGINYRIIPKK--EN------WQLDLA
HIS8_PHOPR       IELLIRTFCE-PNQDSILYCPPTYGMYAISAETFDIKTKTVPLT--PE------WQLDLP
HIS81_HAEIN      IELIIHTFCE-PKQDAILFCPPTYGMYAVSAETAGVLSKTVPLT--DD------FQLNLP
HIS8_YERPE       IELLIRAFCE-PGQDAILFCPPTYGMYAVSAETFGVERRTVPAQ--AD------WQLDLP
HIS8_ECOLI       IELLIRAFCE-PGKDAILYCPPTYGMYSVSAETIGVECRTVPTL---D-----NWQLDLQ
HIS8_VESOH       IQLLALA-CN-TGD-TVLSVEPSFVMYGMITKFTRLNYQSVLLT--DD------FEIDDD
HIS8_HAHCH       IQILAMAVAG-PGR-TILSVEPSFVMYKMIATFIGAEYVGVPLN--DD------FQIDAQ
HIS8_NEIMA       IQFITMLTAK-PGA-AMLAAEPSFVMYRHNAALYGMDYVGVPLN--GD------FTLNLP
HIS82_NITOC      IQMVLLAVAG-PGR-SVVAPEPTFVMYRQIAALLGLQYQGVALR--ED------FSLDLP
HIS81_NITMU      IQIIALACGK-PGA-VLMSVEPAFVMFRMIATFASMNYVGVPLH--PD------FSLDAE
HIS82_BORBR      IHLIIQACCE-PGD-TVLSPWPSFVYFDMAARLSHARFVGVPLT--AG------LELDLP
HIS8_CHRVO       ITLVTQALAR-PGA-KLLALEPSFVMYKMNALFSGLQYVGVPLR--AD------FTLDLP
HIS8_METPP       ISLLSMACDV-PGA-TVLAPLPGFVMYEMSARLQGLRFVGVPLT--AD------FELDAA
HIS81_RALSO      ISLIAIAAAK-PGA-TVLAPVPGFVMYAMSAQLMGLKFVGVPLR--AD------LTLDRE
HIS8_HYDS0       IQYLMLGIGE-LDE-GVLIPRPTFPMYEVIANALGKPIYDVDLD--EN------FQMNKQ
HIS8_AQUAE       IYYLSIAIGE-LYI-PVYIPVPTFPMYEISAKVLGRPLVKVQLD--EN------FDIDLE
HIS82_ARCFU      ISCICNVLLE-ELD-RVVIPMPSYTLYSIYAMLRSAS-ISFPVF--EG------YRVDPD
HIS8_GLOVI       IRSLITATCL-GGRGTVASAEPTFSMYRILAETLAVPYIGVART--AN------YGVDAD
HIS8_SYNJB       IRSLLIATCL-GGRGGILVAEPTFSMYAILAQSLGIPVVRVPRD--PE-----TFALDLE
HIS8_THEEB       IRSILLATAI-GGYGSILVAEPTFSIYGILAQTLGIPVHRATRD--PD-----TFAVEIA
HIS8_SYNE7       IRSILIATCL-GGQGSVLVAEPTFSMYGIVAETLGIPVVRIGRD--PQ-----TWEMDLA
HIS82_NOSS1      IRSLLIATCL-SGEGSILVANPTFSMYGILAQTLGIPVVSVSRN--PD-----NFAIDLT
HIS8_CYAP4       IRSLLITTCL-NQQGAILVAEPTFSMYRITAETLGIPVVAVGRN--PD-----TFEIDCS
HIS8_DEHM1       IDLLLRLFIN-PGD-EVINCPPTFAMYKFYTDLNRGTVVNVPRD--AG------YDVNIG
HIS8_ROSCS       IDLIMRAVLR-PGD-VMVDCPPTFAMYSFDAALYGARIVAVPRT--EQ------FDVDVE
HIS8_YEAST       IDAIIRACCV-PGKEKILVLPPTYSMYSVCANINDIEVVQCPLTVSDG-----SFQMDTE
HIS8_CANMA       IDMLLRCVCV-PGKDKMLICPPTYGMYSICATVNDVVIEKVPLT--VP-----DFQIDIP
HIS8_CYTH3       IDLLIRATCQ-PGKDSILILPPTYGMYEVSAGINDVDIISVPLT--KA------FDLDVD
HIS8_GRAFK       LDLIFRAFCE-PGKDNVITLPPTYGMYKVLSDINNIENREVLLN--HD------FEPDLT
HIS8_BACTN       IDLVFRAFCE-PEKDNVVAIDPTYGMYQVCADVNNVEYRKVLLD--EN------FQFSAE
HIS8_PARD8       IDLVIRAFCE-PGLDSVVTISPSYGMYEVAANVNNVECRKVSLD--EN------FDLDAE
HIS8_THEGJ       LSYLVRLF---EGN-HIVITPPTFGMYSFYAKLNGVPVVEVPLR--ED------FTLDGE
HIS8_DESHD       IQLLMTTFGGEKG--AVVIHPPTFSMYEAAARVTGTEVLEVPLLLTET---SRDFRLDVE
HIS8_RUMCH       IQIIANVFLE-KGD-KVLYPTPSFGMYKDSCVIAGGRAVDYILDQNDN------FSYSAD
HIS81_CARHZ      ILCLYLAFGG-YGR-IALSFSPSFVMYRHHAFVTQTEFFEVSYR--DD------FSLDLD
HIS8_PELTS       ILNIMLTFGT--GA-KFAIATPTFSMYGIHGRIASCEKVEVPRL--DG------FRVDVE
HIS8_THEP3       IHLIMLAFIN-KGD-VVAYPHPSFAMYSVYSKIAGAVEIPVRLR--ED------YNYDVD
HIS8_CLOK5       IQIIIAALVD-KNE-NIMTVEPDFSMYGNYSEIGGGKALIFQLD--EE------FNLDVD
HIS8_CLONN       IQILTNAFLD-KNE-KIVTLNPDFSMYEVYTKVRGGKVSVFDLD--ED------FKLNVN
                                        :                                    

HIS83_RHILO      Q----LLF---GP----AK----DAKFILLANPNNPTGTFVP---VADIERLVAKS----
HIS8_STRGC       D----YFG---------DN------GGIILANPNAPTGIYLP---LKQLEEILASN--Q-
HIS8_LACLA       D----YCI---------EN------GGIVIANPDAPTALALN---LKDIEEILKKN--Q-
HIS8_SYNAS       A----MIE---NG--GEPS------CGMAFPNPNAPTGIALT---LKQIEDLLNRY--P-
HIS81_OCEIH      H----FYN---------SE------GGVIFPNPNAPTGIFLE---IDQIKRILENN--P-
HIS8_BRAHW       D----YKN---LD------------SGIFIANPNAPTGLLLT---LDQLEEIIINN--K-
HIS8_CLOB8       E----LKK---------TN------GGVIIPNPNAPTGKYIN---TESLKSLIEAN--K-
HIS8_CLOB6       D----FKN---AK------------GGAVITNPNAPTGVYLS---LDSVKQILEDN--V-
HIS8_CHRSD       A----FDT---------DN------GGIVFANPNAPTGHGHS---RDAIAALLERN--T-
HIS8_ACEPA       D-----YA---------GP-----CSGVVVANPNAPTGIALD---LADVRKLLELQ--P-
HIS8_MARMS       D-----YE---NL----DV------SGVVITNPNAPTGKALP---LADIEAILKAN--P-
HIS82_PSYA2      A-----YR---------RP-----CSGIIIANPNAPTGLLLS---LADIRKLAGEH--S-
HIS8_ACIB5       D----YTQ---------PN------GGVIITNPNAPTSIALS---LAEIEQVLQAN--P-
HIS81_METCA      D----YLR---------PN------GGVVFPNPNAPTGRLLP---LADIETLLSKN--R-
HIS8_SYNY3       V----ICP---EA------------KLIFLASPNPPKGKHLN---REFLWQTCAQA----
HIS8_RHOBA       F-----GE---NR----ED-----LKLVLLPNPNSPSGTIVS---KPQIAELSNSL----
HIS8_GEOBB       G----IPE---HY----DG------KLFFLTNPNAPLGFTYS---QRYIADLAGRL----
HIS81_NOSS1      A----DLI---AA----HG------SVTFIASPNSPSGHVVP---SDDLRKLASEL----
HIS8_DEIRA       A----TLQ---AL--AAHA-----PGVFYVTQPHAPTGHSDR---PEDVRRVVEVA----
HIS81_LEGPL      Q----IEN---SW----KP----NCKVIMFCSPNNPTGNLVD---LNLIAKTCELY--T-
HIS8_SACS2       D----LLA---QA----EK-----VELVIIDDPNNPTGSPMLNGKKELIGQLAENT----
HIS8_CHLCH       A----IMK---AA--HNEA-----VDVIVLSNPNNPTSTSMS---YDAVRKIAEST----
HIS8_BIFAA       A----TIK---AI--EDVK-----PAMIVLTSPNNPTGTPLK---PEDLKRVLEAARTA-
HIS8_CUTAK       E----ILS---AI--EEVK-----PDVVLLTTPNNPTGTTIP---VAVIDEVCAGT----
HIS8_MYCA1       A----AVA---AV--TERT-----PDVVFVASPNNPSGQSVS---LSGLRRLLDAA----
HIS83_BURL3      Q----ALD---SI--RAHQ-----PGVVLLTSPNNPTGTALP---IDDIRAILDAA----
HIS8_PAEAT       S----AAA---QV--RETG-----ANIVFLCSPNNPTGTGLS---LDVVEAVYEAG--EA
HIS8_FRACC       V----VTD---AI--ARHR-----PALVFLCSPNNPTGTALP---PEVVAAACEAVEAT-
HIS82_CAUVC      A----VCA---AA--ALGP------KLLVLCTPNNPTGNALK---AADFQAILAAT--P-
HIS81_GLUOX      Q----LHQ---AV--TSDP-----LKVLMFSNPSNPVGCLMT---GDAMQSLIDAC--P-
HIS81_RHILO      A----LID---AV--RERP------RMLLFSNPMNPVGSWLS---AGDLSKVLDAV--S-
HIS83_RHIME      A----LLA---AI--ARKP------RMLMFSNPMNPVGSWLT---PLQLAKVVAAL--D-
HIS8_LEUMM       A----ILD---AI--DDKT------AMVWIANPNNPTGVFET---TSSIKRFLDKL--P-
HIS8_LACF3       G----ALA---VI--NEAT------RLVWICNPNNPTGVLES---PQAIEDFVRQV--P-
HIS8_LACPL       G----LMK---AI--TPHV------KMVWLCNPNNPTGTVES---LAAIEAFVQQV--P-
HIS8_HALSA       A----VVD---AY---DGE------RVVYLTTPHNPTGARFT---LDEIVAVADRT--D-
HIS8_HALWD       D----ILT---QY--DDE-------RLLYVTTPHNPSGSELP---IPEITALAEGV--D-
HIS8_DESAG       A----FVG---AA--DADT------AVAFITTPDNPSGYCPP---VEEIIDLARRL--P-
HIS8_LEPIN       A----FLDLAKLI----RP------KIIFLCTPSNPAGDALS---KSDVYEFLSKI--S-
HIS8_HELHP       E-----FF---QL--YQSEKERKHISAVFLCAPNNPLGECLD---AAAIEQFIQAV--D-
HIS8_NITSB       E----FYD---LY--KKHH-----PDIIHICTPNNPTGDALD---AEYLYSFLDNV----
HIS8_ARCB4       E----FSE---LY--KKHG-----ADIIFLCIPNNPLGECLD---KNDVYEFLKTI--D-
HIS8_CAMHC       E----IKE---LYESHKDE-----ISVIFLCVPNNPLGECLD---AKDVIKFIKSI--D-
HIS8_CAMFF       E-----FR---EI--YRTN--KNDISVIFLCLPNNPLGECLD---ADEVFSFIKDV--S-
HIS8_RUBXD       A----LLS---AV--TGET------RAVILCNPNNPTGTHLT---LEEVSALADAL--P-
HIS82_LEGPL      D----IVN---AC--NQKT------GIIFIANPNNPTGVLIQ---QEEIKYLLEQI--P-
HIS8_PELUB       E----IIK---KV--TRKT------KLVFIANPNNPTGTYLT---RAELIDLRKKL--N-
HIS8_HYPNA       A----ILG---AV--SPRT------KILFLANPNNPTGTMLS---VDELKALQDAL--P-
HIS8_ZYMMO       A----LLK---AV--TPRT------RVVFIANPNNPTGTWIT---RAEVEKLHNGL--P-
HIS8_NOVAD       A----LLA---CV--TERT------RVVFLANPNNPTGSWLP---REEVARLHAGL--R-
HIS8_JANSC       A----LIA---GI--TPAT------RLIFIANPSNPCATMID---NGEITRLADAL--P-
HIS8_PARDP       A----LIA---GA--TPRT------RLIFVANPNNPTGTMVG---LPELERLARAV--P-
HIS81_CAUVC      E----VIK---CV--DERT------RLVFIANPANPTGTWLT---GEEIRALHAAL--P-
HIS8_ACICJ       A----MLA---EV--TPAT------RLVFLANPNNPTGSLVP---ASDVSRLRAEL--P-
HIS8_GRABC       A----LLD---AI--TPRT------KVVCIANPNNPTGTMLP---TAEIARLRASL--P-
HIS8_RHOCS       A----LLA---RV--SERT------RIVYVANPNNPTGSYLP---ADALARLHAGL--P-
HIS8_RHORT       A----MLA---AV--RDTT------KLVFLANPNNPTGTCLP---TSEVVRLREGL--R-
HIS8_MAGSA       N----LLA---AV--TPRT------KILFLANPNNPTGTYLP---ATEVARLRAGL--R-
HIS8_MARMM       A----ILE---AA--GDDT------RIVFLANPNNPTGTYIS---AAEVRRLRDGL--P-
HIS8_XANP2       A----ILA---LV--TPRT------RLVFLANPNNPTGTYLP---FDEVRRLHAGL--P-
HIS8_BDEBA       AIADYFLK---HP--EKNI------RLIFVSNPNNPTGTYAT---KAEVEAFLQKVGNR-
HIS8_METI4       A----MLE---AI--GPKT------KLIFIANPNNPTGTRVS---NEDLYLFLERV--P-
HIS8_DESPS       T----ILD---TV--NEKT------RLIFIDNPNNPTGTYLE---PELLIDFINSL--P-
HIS8_ALKOO       G----FVE---KI--NENT------KIIYICNPNNPVGNILS---KEEMEGFVARV--P-
HIS81_PSYA2      A----MSQ---AIENNSNT------KIVFIANPNNPTGTQLE---HGELREFVASV--P-
HIS8_AKKM8       G----FLA---AI--TENT------RVVFITNPTNPVGTVVG---QQEIDDFMAKV--P-
HIS82_HYDCU      A----MAE---AI--TDKT------KLIYLANPNNPTGTLFT---QKEWEAFISKV--P-
HIS82_HAEIN      G----FLT---AL--SDKT------KLIYIANPNNPTGNFLT---SQEIEDFLAEV--P-
HIS81_IDILO      G----MAK---AV--TDKT------KMIFIANPNNPTGTFLS---TSALKSFLDKI--P-
HIS81_NITOC      A----MVK---AV--NSQT------RLVYIANPNNPTGTWLH---SDELEAFLAAL--P-
HIS81_CUPPJ      A----MAA---AI--TSDT------RLVFIANPNNPTGTFVP---AAALETFLAKV--P-
HIS82_METCA      T----MLE---RV--DPDT------RVVFIANPNNPTGTLLG---RGELYSFLAAL--P-
HIS82_PSEF5      A----MLK---AI--DDRT------RVVFIANPNNPTGTWFG---AEELDEFLQDV--P-
HIS81_THIDA      R----MRA---AI--RDDT------RVVWIANPNNPTGTFLP---WNEIEAFLETV--P-
HIS82_NITMU      A----MLD---AV--APET------RVVFIANPNNPTGTLLP---ADDVLRFLERV--S-
HIS8_ANADF       A----LRK---LL--SRRT------KLVFLANPDNPTGTWFT---EAELTPFLDAV--P-
HIS8_SYMTH       A----MAE---AA--ARGA------KLLFLCRPNNPTGTVFA---EADLRAALERV--P-
HIS82_CARHZ      T----MAE---AV--NEKT------RLVYLCNPNNPTGTYIT---KGELEEFLERV--P-
HIS8_CALS8       E----FSK---HI--NERT------RVIWICNPNNPTGTIVK---KDELYNFIKSV--P-
HIS8_MOOTA       A----MAA---AI--TPRT------RLVFVCNPNNPTGTIVG---QAALDGFLKQV--P-
HIS8_STACT       G----ILN---EI--DEDT------ALVWICNPNNPTGTYVT---HEELEAFLEKV--P-
HIS8_MACCJ       S----FKD---KM--NDET------SIIWICNPNNPTGTYVT---ETELTGFLESV--H-
HIS82_OCEIH      K----MLG---SI--DDHT------AIVWLCTPNNPTGAAFS---KEELITFLDNC--P-
HIS8_LISIN       G----MLN---AI--DEKT------TIVWICNPNNPTGNYIE---LADIQAFLDRV--P-
HIS8_LYSSC       A----MAA---AI--DDQT------AVIWVCSPNNPTGVVIP---DTALRAFLAKV--P-
HIS8_BACSK       A----MLA---AI--DDQT------RIVWVCNPNNPNGVALG---EAELKTFLDAV--P-
HIS82_BACAN      E----ISS---VV--DNDT------KIVWICNPNNPTGTYVN---DRKLTQFIEGI--S-
HIS81_BACAN      A----MLQ---QV--DDQT------KIVWICNPNNPTGTYVE---KQKLLSFLESV--P-
HIS8_BACHD       G----MLE---VI--DENT------RIVWVCNPNNPTGTYVS---AEAFQSFLAKV--P-
HIS8_ANOFW       A----MLE---AI--DDHT------RVVWICSPNNPTGTYVN---DASLRAFLNKV--P-
HIS8_BREBN       A----MAA---AI--NEQT------KVVWVCNPNNPSGTIVT---TSELEAFMKKT--P-
HIS8_THEMA       N--------------VGEG------DVVFIPNPNNPTGHVFE---REEIERILKTG--A-
HIS8_METLZ       T----FLN---EA----KD-----ARLSFLCTPNNPTGTVTP---VEDIEYILDRI----
HIS8_METMJ       A----FID---AC----HG-----AKLAFLCSPNNPTGNSVP---PEDVEAILEGM----
HIS8_METJA       S----VLN---NI--TDKT------KVIFLCTPNNPTGNIIE---NRDVERVINET----
HIS8_METKA       S----LFE---AL--DREV------RLVYLCTPNNPTGNRIR---ERVVRDVVEEC----
HIS8_METST       S----VLN---NI--TDKT------KVIFLCTPNNPTGGLIP---QEDIVRIIEAT----
HIS8_METTH       S----VLD---AV--DEST------RLVFLCTPNNPTGGLID---KKDIRAVLEST----
HIS8_METS3       S----ILN---SI--NNKT------KMIFLCTPNNPTGTLID---EKDIRDIASGN--P-
HIS81_ARCFU      I-----FD---AI--TQKT------KIILICNPNNPTGNAED---AKLIEELVNST----
HIS8_METMA       K----ILE---AV--SPRT------KIIFLCSPNNPSGNLLP---EADLRKIIENT----
HIS8_METAR       A----VLK---QV--TDRT------KFIFITSPNNPTGNLTS---LAEIRSVANAV----
HIS8_FRAP2       E----LLA---NI--PDNC------KLLFLCTPNNPTGKSIP---LADIEQILSEL--A-
HIS8_XYLFA       A----IIT---AA-QTSRA------KLVFLCSPSNPVGAAIP---LQQIETILQTL--A-
HIS8_COLP3       G----LKQ---QV----GK-----AKVVFLCSPGNPTGNTLS---SAQIKAAIEIF--K-
HIS8_SHEAM       I----------SA--LTGS------KLVFVCNPNNPTGTLLP---LGEIARVAKTF----
HIS8_SHEON       F-----AT---AA----RG-----AKLVFICNPNNPTGTVID---KARIEQAIQAL--P-
HIS8_BUCCC       N----IKK---KI----NN-----VKIIYICYPNNPTGNFFS---RNKIIRIINSV--S-
HIS82_IDILO      S----IIE---AA---AEC------KVIFLCSPSNPLGNALN---TDDIEQVLQHS----
HIS8_BUCAI       N----IKL---NL---SRV------KLIYICNPNNPTGNIFF---KKDLIFLLNIT--L-
HIS8_BUCBP       L----IFR---NI----CG-----VKLIYLCNPNNPTGNLIK---KQDIIALLTYT--K-
HIS8_BUCMH       N----IAK---YI----SD-----AKLIYICNPNNPTGNLIN---YQDIITLLNIT--L-
HIS8_PSEA6       A-----IK---AF----KG----KVNLVFICSPNNPTGTSVD---KNQLLEVVEHF--A-
HIS8_AERHH       A----IAD---RL----SD-----VKLVFLCSPNNPTGDLVG---RDGLIALLEKA--R-
HIS8_BLOPB       S----IKS---QL----NN-----VKLIYICNPNNPTGNIIH---LNSLKKLLKII--Q-
HIS8_PHOPR       S----IQN---NL----DG-----VKLVFVCSPNNPTGNVMN---RRDIEKLLDMT--T-
HIS81_HAEIN      E----IKN---HL---NDV------KVVFVCSPNNPTGNLLK---QSDILDLLQIT--A-
HIS8_YERPE       A----IAN---NL---EQV------KVIYVCSPNNPTGNLIN---PADLQAVLALA--Q-
HIS8_ECOLI       G----ISD---KL----DG-----VKVVYVCSPNNPTGQLIN---PQDFRTLLELT--R-
HIS8_VESOH       T----MQK---AI--KTYN-----PKLIFIAYPNNPTGNMFN---REIIEHIISST----
HIS8_HAHCH       T----TLD---AI--KRHQ-----PALVFIAQPNNPTGNLFD---DETLRQIVAAS----
HIS8_NEIMA       A----VLE---AV--RKHR-----PALTFIAYPNNPTGVCFT---RAEIEAVIEAS----
HIS82_NITOC      A----MLQ---VI--RERV-----PAVVFIAYPNNPTGNLFS---AEELQAIIEAS----
HIS81_NITMU      A----MLA---AI--ARYQ-----PAVIFIAYPNNPTGNLFD---AVEISRIIDAA----
HIS82_BORBR      A----TLA---AI--EAHQ-----PKVVFLALPNNPTGGLWP---DAAVRAILDAA----
HIS8_CHRVO       A----TLA---AI--EREQ-----PAVVFVSYPNNPTGPRYG---RDEVMAICRAA----
HIS8_METPP       A----MLA---AV--REHR-----PALTYLAYPNNPTANLWD---DAVIERVVDAV--RE
HIS81_RALSO      A----MLA---AM--AEHQ-----PAVIYLAYPNNPTGNLFD---AADMDALLRAARGPV
HIS8_HYDS0       T----LQK---AL--EKKP------SIAFISNPNNPTGNLFR---DEDIALIRKHT----
HIS8_AQUAE       R----SIE---LI--EKEK-----PVLGYFAYPNNPTGNLFS---RGKIEEIRNRG----
HIS82_ARCFU      V----IAE--------ERP------KLVFLCSPNNPTGNSLS---REIVQKVAESA----
HIS8_GLOVI       V----LEA---AV--GANG-----VRVLFLANPNSPTGNLLS----DEIIERLGSL----
HIS8_SYNJB       R----CQQ---AL--REHP-----IRVVCLVDPNSPTGNGLT---AAEWEWVEGLP--E-
HIS8_THEEB       A-----AN---TL--IAQA--APPVRVLFMLQPNSPTGNPLT---AAEVDWLRQLP--E-
HIS8_SYNE7       A----AET---AI--TQTE--GTPVRLCFVVHPNSPTANPLT---EAEKDWLRQVP--P-
HIS82_NOSS1      A----AQS---AI--EQTL--NPPIRVVFVVHPNSPTANPLT---ANELRWLKSLS--E-
HIS8_CYAP4       A----AQA---AIEATEQN--RPPIRVVFVVHPNSPTGNGLT---IAEQEWLRTLP--P-
HIS8_DEHM1       G----IKN---AL--TPKT------KLIFIAAPNNPTGTAIS---KEDIRQILDLG----
HIS8_ROSCS       G----VAE---AV--ERDG-----AKLLFLAAPNNPTGTPLA---RTTVERLLDLP----
HIS8_YEAST       A----VLT---IL--KNDS----LIKLMFVTSPGNPTGAKIK---TSLIEKVLQNW--D-
HIS8_CANMA       A----ILS---KV--KSDP----NIKLLYLTSPGNPTGKLIN---VDSIITLLEELLNC-
HIS8_CYTH3       A----ILA---AV--KTHT------KIIFICSPNNPTGNLMS---EDKVKRILNAF----
HIS8_GRAFK       A----IFK---QI--TKDT------KIIFLCSPNNPSGNSFE---AEKIEMILEKF----
HIS8_BACTN       K----LLA---AT--DERT------KLIFLCSPNNPTGNDLL---RSEIEKILREF----
HIS8_PARD8       A----VLE---SA--DEWT------KVIFLCSPNNPSGNSLD---RGSIYKILKNY----
HIS8_THEGJ       A----VAE-------KAKN-----ARVVFIASPNNPTGNLQP---EEEIIRVLETR--R-
HIS8_DESHD       G----ILK---AA--AQPQ-----VHMIVLCNPNNPTGTLFP---REEILRIVAES----
HIS8_RUMCH       K----IIK---TY--ELEQ-----PKVIYICNPNNPTGNLMP---QDEILRVLKAC--T-
HIS81_CARHZ      E----TKK---AI--EKYQ-----PHLVFLANPNNPTGTLVD---IETIKKLLAYD--H-
HIS8_PELTS       A----MKR---AA-GEPGV------KIAVICTPNNPTGNATP---PEEIEEILKST----
HIS8_THEP3       S----FIK---VI--EKYQ-----PKLVFLCNPNNPTGSVIE---REDIIKIIQKS----
HIS8_CLOK5       K----LIE---SA--NVEK-----VKVLFLSNPNNPTGKVLK---REQIFKILNGC----
HIS8_CLONN       K----IIE---YI-NEEKP------KMFIFSNPNNPTGGVIP---KYDIIKIIENV----
                                              .  *  * .                      

HIS83_RHILO      -DR--------LIVLDEAYVDFA---------P-ENGL-RLINR---YS--------NLL
HIS8_STRGC       -DA--------VVVVDEAYINFG---------G-QSAL-PLLDT---YP--------NLF
HIS8_LACLA       -NS--------IVLINEAYIDFG---------G-ETCL-PLLKK---YD--------NLV
HIS8_SYNAS       TDR--------VVVIDEAYIDFG---------G-ESAV-GLIDR---YA--------NLL
HIS81_OCEIH      -NQ--------VVIIDEAYIDFA---------L-ESAV-TLVEA---FP--------NLL
HIS8_BRAHW       -DN--------IVIIDEAYIDFA---------AIESAY-KLTKK---YD--------NLL
HIS8_CLOB8       -DR--------VVIIDEAYIDFG---------G-QSMV-KYMHE---YD--------NLL
HIS8_CLOB6       -NK--------VVIVDEAYIDFG---------G-ESSV-SLIKD---YP--------NLL
HIS8_CHRSD       -ES--------VVLVDEAYVDFG---------G-ESAV-PLVER---FP--------NLL
HIS8_ACEPA       -NR--------VVLIDEAYVDFG---------A-ESAV-SLIKE---YP--------NLL
HIS8_MARMS       -DV--------VVLVDEAYVDFG---------A-QSAV-SLINQ---YP--------NLL
HIS82_PSYA2      -DS--------VIVIDEAYIDFAQLEEASAESQ-MSAI-SLINE---FD--------NLL
HIS8_ACIB5       -DR--------VVVIDEAYVDFG---------A-ESAV-SLINR---YE--------NLV
HIS81_METCA      -DS--------VVIVDEAYIDFG---------G-ESAA-ALVNR---FP--------HLL
HIS8_SYNY3       -EG--------VVVIDEAYGDFS---------D-EDHW-DFLQE---FD--------NVI
HIS8_RHOBA       -NC--------PLVVDEAYADFA---------E-ENCL-DLVQS---DE--------NIF
HIS8_GEOBB       -SG--------VLVVDEAYVDFA---------E-ETSL-ELVRS---FD--------NVV
HIS81_NOSS1      -SG--------VLVIDEAYVDFA---------E-ESAL-NLVQD---HE--------NVI
HIS8_DEIRA       -DR-----LGWVTVIDEAYSQYA---------G-TDYR-ELVRA---GK--------HVL
HIS81_LEGPL      NQS--------IIVVDEAYIEFA--------NA-PSAT-SLIGE---FE--------NLI
HIS8_SACS2       -KG--------FVVIDEAYYEFG---------G-YTVS-PYIYD---YP--------NVL
HIS8_CHLCH       -QA--------LVLVDEAYIEFS--------RE-RSMV-DTIEE---LP--------NVV
HIS8_BIFAA       EVAGAAEGVHPVVVVDEAYIEFR------DPGT-PTAL-ELIGE---YE--------NLA
HIS8_CUTAK       -DT--------IVVVDEAYQEFT------DAPE-DSSI-ALLPK---YG--------RLI
HIS8_MYCA1       -PG--------IVIVDEAYGEFS---------SQPSAV-QLVGE---YPT-------KLV
HIS83_BURL3      -PG--------VVVVDEAYAEFR------RHGV-PSAV-TLLPA---YP--------RLI
HIS8_PAEAT       SQA--------IVIVDEAYHEFA------HDNT-PSAL-TLLPG---RE--------RLI
HIS8_FRACC       GSG--------MVVVDEAYAEFR------RAGV-PSTL-TLLPR---HP--------RLV
HIS82_CAUVC      RST--------VVFVDEAYREYH---------EAFDTF-AMLDA---WGG-------PWV
HIS81_GLUOX      ADT--------LIVIDEAYWEYA----RSSPDY-ADSL-TILKN---QSR-------PWM
HIS81_RHILO      DET--------LIVVDEAYAEYA-----EGDDY-ASSLPDLCER---DQ--------PWI
HIS83_RHIME      PET--------LIVVDEAYAEYA-----AGDDY-PSAA-EVLKV---TGL-------NWV
HIS8_LEUMM       ANI--------TLVVDEAYYDFV-------DEP-DATVAPLVAE---YT--------NLV
HIS8_LACF3       KDT--------LVFIDEAYLDFA----DD-PAK-ATCL-PLVKR---YQ--------NVA
HIS8_LACPL       PET--------MVLIDEAYIDFT----PG-AAQ-VTAM-QLPAK---YP--------NVV
HIS8_HALSA       EDT--------LVLVDEAYGEFT---------ETPSAV-TLFDG---QPAGGHAPRDDIA
HIS8_HALWD       DQT--------LIVIDEAYGEYS---------NNPSAI-KLIQE---YD--------NIA
HIS8_DESAG       SSC--------LLVVDEAYMDFA----DD-PAA-HSVL-PHLTE---FP--------NVA
HIS8_LEPIN       LDT--------LVVIDAAYMEFG----KK-KDP-NKFI-PAKEVTDLFP--------NVF
HIS8_HELHP       KDT--------LVIVDGAYQEFA----AY-KDK-AKAI-NPKQLIERFS--------NVI
HIS8_NITSB       QEP--------LVIVDGAYMEYA----AF-KDE-KKRI-HPQDLIKKYP--------NVI
HIS8_ARCB4       KNT--------LVVVDGAYQEYA----AF-KDE-KKRI-CPKDLIDTFP--------NAI
HIS8_CAMHC       DDT--------LVVIDAAYNEFA----SF-KDK-HKHI-EPAEIVK-LK--------NAI
HIS8_CAMFF       EDT--------LVVIDGAYMEFA----KF-KSS-KKEI-DPKTLIQTFS--------NAL
HIS8_RUBXD       EDV--------LLILDEAYQEFV----AD-PAY-HGSH-ALALE---RP--------NVA
HIS82_LEGPL      KST--------LLVLDEAYYEFA----AS-QLT-VNSL-DWLEE---HP--------NLV
HIS8_PELUB       KNI--------LLVLDDAYFEYM----KN-KDY-KSGL-DLFKN---KD--------NVV
HIS8_HYPNA       PHV--------LFVVDGAYSEYL------GPDY-EAQLRDLVDR---RD--------NTV
HIS8_ZYMMO       RNC--------LLVIDQAYAEYL----DP-ECD-DGAL-ALAKN---TK--------NVL
HIS8_NOVAD       SDI--------LLVLDGAYAEYL----DP-AND-DGAL-DLAVT---AC--------NVL
HIS8_JANSC       DQC--------LLILDGAYVEFA-------DGY-DGGK-NLVEA---RD--------NVV
HIS8_PARDP       -QA--------ILVVDAAYAEYV-------GDY-DGGA-ELATR---LP--------NVF
HIS81_CAUVC      PSV--------VLVLDGAYAEFC----SD-PHF-EDGL-ELART---AE--------NVI
HIS8_ACICJ       PDV--------LLVLDAAYAEYV----ER-ADY-DPGV-ELVDS---GQ--------NTV
HIS8_GRABC       SDV--------LLVLDAAYAEYV----DD-PDY-DPGV-KLVDA---GD--------NTV
HIS8_RHOCS       PHV--------LLVIDAAYAEYV----TA-NDY-ADGT-ALVAR---FD--------NVV
HIS8_RHORT       DDI--------ILVVDAAYAEYV----ER-NDY-DAGA-RLVDS---HP--------NTV
HIS8_MAGSA       ADI--------LLVIDAAYTEFV----SR-NDY-SGGI-ELVEA---GD--------NVV
HIS8_MARMM       AST--------LLVLDAAYAEFV----DN-PDY-EAGI-ELARE---RD--------DVI
HIS8_XANP2       ANV--------LLVLDAAYAEYV----RR-NDY-ETGL-ELALT---AD--------NVL
HIS8_BDEBA       DDV--------MIIFDEAYNEFV----RA-KDY-ASAQ-GYMGQ---YK--------NLI
HIS8_METI4       DEV--------IVAIDEAYIDFV-------PDP-PQTL-SFVKK---RD--------NIV
HIS8_DESPS       EHV--------ILVLDEAYVDFM----DL-DKW-LDVP-SLIKNQAGRC--------GIV
HIS8_ALKOO       ENV--------VIVLDEAYYDYA----KVNPEY-PESL-DVLAK---RP--------NTV
HIS81_PSYA2      SSV--------LVVLDEAYIEYS--------PE-SNNR-ALLDE---FD--------NVV
HIS8_AKKM8       EHV--------LVVFDEAYREFS-------DNP-PDTL-KFVRE---GR--------NVV
HIS82_HYDCU      SNV--------IVVLDEAYTEYV----TH-DEY-ANGL-NYLEQ---YP--------NLI
HIS82_HAEIN      ENV--------IVVLDEAYTEFT----RS-EER-VDSF-SLLKK---YS--------NLI
HIS81_IDILO      QHI--------IVVLDEAYYEYV----PE-DQR-APSV-EWIKE---YP--------NLV
HIS81_NITOC      EHV--------LVVLDEAYYEYV----NE-AQY-PYSL-AWMSR---YP--------NLM
HIS81_CUPPJ      AEV--------VVVLDEAYNEYL----DD-DQQ-YDSV-AWVRR---YP--------NLL
HIS82_METCA      EHV--------IAVVDEAYFEYA----RR-PDH-PDAL-EWLGE---FP--------GLI
HIS82_PSEF5      AHV--------LVVLDEAYIEYA----EG-SDL-PDGL-DFLAA---YP--------NLL
HIS81_THIDA      PRV--------LVVLDEAYGEYL----AP-ASR-CDTA-AWVVR---FP--------NLL
HIS82_NITMU      PDV--------LVVLDEAYNEYL----PP-ALK-GDSI-AWLKQ---FP--------NLL
HIS8_ANADF       KDT--------LVVLDEAYVEYV-----DAPGF-QDGL-ALRRK---YP--------NVV
HIS8_SYMTH       PST--------LVVVDEAYREFD-------ETP-FDSR-ALVQD---YP--------NVV
HIS82_CARHZ      EEV--------VVVLDEAYFEFA----RLFNDY-PDGL-NFFKK---RP--------NTV
HIS8_CALS8       SEI--------AVVVDQAYKEYI-----DDPEY-PDAI-HWLDE---FK--------NLI
HIS8_MOOTA       PSV--------LVVLDEAYSDYV-----TAEHY-PNSL-AYVRA--GRA--------NVI
HIS8_STACT       SNV--------PVLVDEAYFEFV----TA-DDF-PDTL-KLQEK---FP--------NAF
HIS8_MACCJ       EDV--------MVVLDEAYFEFV----LR-EDY-PDGV-ALLKR---FP--------NLI
HIS82_OCEIH      KEV--------LVVLDEAYYEYL----HS-DKD-LDAL-QLRFT---YS--------NVI
HIS8_LISIN       SDV--------LVVLDEAYIEYV----T--PQP-EKHE-KLVRT---YK--------NLI
HIS8_LYSSC       NDV--------LVVLDEAYIEYV----TH-PEH-KDTL-PIIDQ---YP--------NVL
HIS8_BACSK       TTC--------LVVVDEAYYEYV----EL-DDF-PNSV-ALLNA---YP--------QLV
HIS82_BACAN      ENT--------LIVIDEAYYEYV----TA-KDF-PETL-PLLEK---HK--------NIL
HIS81_BACAN      KSA--------LVIMDEAYYEYA----GA-EDY-PQTL-PLLEK---YE--------NLM
HIS8_BACHD       EDV--------LVVSDEAYVEYV----TA-DDY-PDTV-PMIRT---YK--------NLV
HIS8_ANOFW       QHV--------LVVVDEAYYEYV----QA-EDY-PNTV-SLLQQ---YE--------NMM
HIS8_BREBN       KDV--------LVVLDEAYYEYV----VD-PEY-PQTV-PMLAE---YP--------NLI
HIS8_THEMA       -----------FVALDEAYYEFH---------G-ESYV-DFLKK---YE--------NLA
HIS8_METLZ       -EG--------VLFLDCAYVEFS---------D-INYL-PLLSR----D--------NLI
HIS8_METMJ       -DG--------LLFLDNAYVDFA---------D-TDYR-PLMRR---YE--------NLV
HIS8_METJA       -DA--------LVVIDHAYIEYA-------KKE-YDWT-QKAPE---YD--------NVI
HIS8_METKA       -RG--------VVLIDHAYVEFA---------D-HDYT-PLALE---YD--------NVL
HIS8_METST       -DA--------LVVIDEAYWEFS---------E-VNNV-NLLKK---YN--------NIF
HIS8_METTH       -DT--------LVVVDEAYTEFA---------G-VDNT-DLLPD---HE--------NLF
HIS8_METS3       -DV--------LIVVDEAYFEYA---------E-VTNK-DLINE---FD--------NIF
HIS81_ARCFU      -NA--------LIFLDEAYVEFS-------------DV-SFSVD---AE--------NVV
HIS8_METMA       -DA--------LVFVDEAYVEFA---------D-RNLA-ALVNE---YD--------NVA
HIS8_METAR       -DG--------IVFVDEAYIDFS--------GG-KTAL-ELMKE---CD--------NIV
HIS8_FRAP2       GNC--------VVVVDEAYIEFS--------NE-KSVS-SIINK---YE--------NLV
HIS8_XYLFA       GTA--------LVVVDEAYGEFS--------DV-PSVV-PLLAR---YP--------HLV
HIS8_COLP3       DSA--------MVVVDEAYYEYT--NKELG-AE-QVNI-KLISQ---YD--------NVI
HIS8_SHEAM       PNA--------LVVVDEAYIEFA--HNADGSPA-QSAT-SLMAE---FE--------NLV
HIS8_SHEON       -DS--------IVVVDEAYIEFC--------PE-YSVA-DLLET---YP--------NLV
HIS8_BUCCC       KTT--------LIVIDEAYIDFS--------IK-YSFV-SELNN---FD--------NLI
HIS82_IDILO      PRS--------IVVVDEAYIEFS--------SG-DSVV-SWLER---YP--------NLV
HIS8_BUCAI       GQA--------LVVIDEAYIEFS--------PE-ESMT-NYLKD---YP--------NLV
HIS8_BUCBP       GKA--------LIVVDEAYIEFC--------AM-HSIV-QLIEK---YS--------NLV
HIS8_BUCMH       GKT--------LVIVDEAYIEFS--------PI-HSLT-NLIDT---YP--------NLV
HIS8_PSEA6       DSA--------IVVIDEAYIEFD--------KD-NSWA-AELTH---YP--------NIA
HIS8_AERHH       DRA--------IVVVDEAYIEFC--------PE-ASVV-DLLAR---FP--------NLV
HIS8_BLOPB       NRA--------LLVTDEAYIDFC--------PD-ASLV-RWLPM---YP--------HLV
HIS8_PHOPR       DKA--------LVVIDEAYIDFC--------LE-TSTV-DLLAK---YP--------HLV
HIS81_HAEIN      GKA--------IVVVDEAYIEFC--------PE-ASVI-NLLKN---YP--------HLA
HIS8_YERPE       GRA--------IVAIDEAYIEFC--------PQ-ASVS-NWLKD---YP--------NLV
HIS8_ECOLI       GKA--------IVVADEAYIEFC--------PQ-ASLA-GWLAE---YP--------HLA
HIS8_VESOH       -KA--------MVVLDEAYYAYT---------T-DSFL-TDIAK---YP--------NLV
HIS8_HAHCH       -PG--------LVVIDEAYTAFT---------N-ADYM-SWVSE---YD--------NVV
HIS8_NEIMA       -DG--------IVVVDEAYGAFN---------G-DSFL-PQAGS---IP--------NLI
HIS82_NITOC      -PG--------LVIVDEAYSVFA---------G-ETFM-PRLED---YD--------HLL
HIS81_NITMU      -PG--------VVVVDEAYHAFA---------D-ASFM-DKLAH---HP--------NLL
HIS82_BORBR      -PG--------LVVLDEAYQPFA---------G-HTWM-PRIMD---EP--------NAV
HIS8_CHRVO       -PG--------LVVVDEAYQSFA---------S-DSFM-DLAGE---LD--------NLL
HIS8_METPP       HGG--------LVVIDEAYQPFA---------S-RSYI-DRLAH---HD--------HVL
HIS81_RALSO      CQS--------LVVVDEAYQPFA---------Q-HSWM-PRLPE---FD--------HLL
HIS8_HYDS0       -----------FTVVDEAYYDFC---------G-KTYI-KDAIK---DD--------NMA
HIS8_AQUAE       --V--------FCVIDEAYYHYS---------G-ETFL-EDALK---RE--------DTV
HIS82_ARCFU      --E--------YVVLDEAYVEFS---------D-DSKI-EMVRD---YN--------NLI
HIS8_GLOVI       -PV--------LVVLDEAYYEFS---------R-FSAV-PLLWE---RP--------NLV
HIS8_SYNJB       -EI--------LVILDEAYFEFS---------R-HTAL-PKLAE---HP--------NWV
HIS8_THEEB       -DI--------LVVIDEAYFEFS---------G-KTLV-GDLAA---HP--------NWL
HIS8_SYNE7       -QI--------LVVIDEAYFEFS---------G-ETLL-AELPQ---HP--------NWL
HIS82_NOSS1      -RI--------LVVVDEAYFEFS---------Q-NTLV-SELAQ---RP--------NWI
HIS8_CYAP4       -DI--------LVVIDEAYFEFC---------R-STLA-GEIVQ---RS--------NWI
HIS8_DEHM1       --V--------PTVIDEAYYEFT---------G-QTMV-TDMPS---YP--------NLM
HIS8_ROSCS       --I--------ILAIDEAYAEFA---------G-TSVI-DLVGT---RP--------NLV
HIS8_YEAST       -NG--------LVVVDEAYVDFC---------G-GSTA-PLVTK---YP--------NLV
HIS8_CANMA       WQG--------LIVVDEAYIDFT-------EPG-SSMS-TLVNQ---YP--------NLV
HIS8_CYTH3       -SG--------IVVVDEAYIDFA--D------T-KGFV-PLLDQ---YP--------NMV
HIS8_GRAFK       -NG--------LVVIDEAYIDFS--------DS-KSWI-HRLED---FP--------NLI
HIS8_BACTN       -EG--------LVILDEAYNDFS--------EA-PSFL-EELDK---YP--------NLV
HIS8_PARD8       -EG--------IVVIDEAYIDFS--------AY-PSFL-KELSG---FP--------NLI
HIS8_THEGJ       -----------PVVLDEAYAEFV---------G-KSLW-RLIEE---YP--------NLV
HIS8_DESHD       -GK--------IVIVDEAYGEFS---------G-ESVV-DQIPY---CP--------NLL
HIS8_RUMCH       -KS--------VVVVDEAYAEFS---------D-TTVI-PFIKE---YE--------NLL
HIS81_CARHZ      -----------LLVVDEAYVEFS---------G-VSAI-DLLKK---YQ--------NLV
HIS8_PELTS       -GA--------IVVVDEAYAEFG---------G-RSCI-PLLNR---YP--------NLV
HIS8_THEP3       -NG--------IVVVDEAYFEFY---------G-NTIV-DVINE---FE--------NLI
HIS8_CLOK5       -DC--------AVVIDEAYVEFH---------E-ESIV-DSIYE---YE--------NLI
HIS8_CLONN       -NC--------IVVVDEAYMEFY---------G-DSIL-DYIKK---YD--------NLI
                                : **  :                                      

HIS83_RHILO      VLRTFSKSYAAAGVRVGFGF-GHPEIIGRLRNIQNVFN---MNVIGQAVGISVLAH--RA
HIS8_STRGC       ITRTFSKDAALAGLRVGYGI-GHPDLIAVMKAVKDSINPYSVDLLAERLALAAVQD--WD
HIS8_LACLA       VVQTFSKSRSLAGIRLGVAY-GSAEAISHLYDVKNSFNSYPIDSLAQIIGEASLMD--EH
HIS8_SYNAS       VARTFSKSFSLAGLRLGYAL-GSPELIRALFVTKDSFNSYTVGRLTQTIGEIAIED--EA
HIS81_OCEIH      VIQTMSKSRSLAGLRIGFAI-GNPELIIGLERIKNSFNSYTVDRLAIAGAIEAIRD--KD
HIS8_BRAHW       VVQTFSKSRSLAGIRLGFAI-GNENLIQGLKNIKYSFNSYTINRLSIIAGIEAIKD--NQ
HIS8_CLOB8       VIQTLSKSRSLAGLRVGFAL-GHKDLIEGLNRIKNSINSYTIDRVALAGAKAAIQD--SK
HIS8_CLOB6       VIQTLSKSRSLAGMRIGFAL-GQKELIKGLNRIKNSFNSYTIDRISSLAAIESIKD--EE
HIS8_CHRSD       VTGTFSKSRSLAGLRLGYAI-GSRELIEGLERVKDSFNSFPIDRITIDAGIAALHD--RA
HIS8_ACEPA       VVQTFSKSRALAGLRVGFAF-GQPELIEGLVRIKDSFNSYPLDRLAQVGATAAVED--EA
HIS8_MARMS       VVQTLSKSRALAGIRVGYAL-GHADLIEGLERLKNSFNSYPIDRVALVGATAAVED--EA
HIS82_PSYA2      VTQTFSKSRSLAGLRVGMAF-GNASLIEALTRMKNSFNSYPLDKLAQAGATASVLD--VE
HIS8_ACIB5       VCQTTSKSRSLAGLRVGFAI-AQSHLIAALEAVKNSFNSYPIDRFAIAAAVASFED--QA
HIS81_METCA      VIQTLSKSRSLAGLRVGFAL-GEPGLIEALERVKGSFNSYPLDRLAIVGGVAAFDD--RD
HIS8_SYNY3       ISRTLSKSYSLAGMRVGLAI-AAPALIEEMDKVRDSYN---LDRLAQVLGTAALRN--QA
HIS8_RHOBA       VTRTLSKSYGLAGIRFGFLV-AQPHVIAELTKIKDSYN---CDAISIAAATAAMGC--QE
HIS8_GEOBB       VTRTFSKSYSLAGMRLGLAI-ARPEIIAALNKIRDHYN---LDRLAQAAAAAALAD--QP
HIS81_NOSS1      LIRTLSKGYSLAGLRLGFGV-GNPQLLNGLFKVKDSYN---VDAIACKVATAAITD--QA
HIS8_DEIRA       SLRTFSKAWGLAGVRAGYLL-TNPELAGHLQKLVSAFT---INFLTQAVIETALEH--PE
HIS81_LEGPL      VLRTLSKAFGLAGLRLGCII-AQSPIIQAFNKIIAPYS---IATPSMELAKRALNN--SD
HIS8_SACS2       VVRTLSKAFSLASYRLGYTI-ANEEIVKALMKSSTPFD---IPLPSLIAGITALEN--PS
HIS8_CHLCH       VLRTMSKALALAGIRIGFAL-ANAPLMAEISKPKIPFA---SSRLAEITLMKVLAN--YR
HIS8_BIFAA       VSRTMSKAFAFAGARVGYLA-ANKGIIDCVRIVRMPYH---LSAVTQAAALAAFEH--TD
HIS8_CUTAK       VVRTLSKAFALAGGRLGYAV-AAPAVVDALQMVRLPYH---LSDVSQVVARVALAH--AP
HIS8_MYCA1       VTRTMSKAFAFAGGRLGYLI-ATPAVIEAMLLVRLPYH---LSSVTQAAARAALRH--AD
HIS83_BURL3      VTRTLSKAFKFAGGRVGYCA-CAPAIVEALKLVRLPYH---LSAFTQAAACAALVA--RD
HIS8_PAEAT       VSRTMSKAFALAGARLGYMA-AAPEVTDAIRLVRLPYH---LSAVTQATALAALNH--RE
HIS8_FRACC       VTRTMSKAFALAGARVGYLA-AHPAVVDSLYLVRLPYH---LSSFTQAVARTALAH--AD
HIS82_CAUVC      SARTFSKAYGLAGLRMGYGVASSPELVDYLDRIRPPFN---VTAVSQAAALAAWED--QD
HIS81_GLUOX      VLRTFSKAYGLAGLRVGYALTSDPGLTAVMTRVRDPFN---SNSAALEMARLSLLD--QE
HIS81_RHILO      VLRTFSKAFGLAGLRIGFGIVGDPELRALLDRVRTPFN---ANGMAQAAALAALAD--EE
HIS83_RHIME      VLRTFSKAYGLAGLRIGYGIVSDGSLCDFFNRARTPFN---TNAIAQVSALAAFDD--TY
HIS8_LEUMM       VLRTLSKAYGLANLRVGYGI-MQDPLYSAMQAVRLPYN---LSTYQIAGGTAAVLD--QE
HIS8_LACF3       VLRTLSKAYGLANVRVGFAV-MPVALAAILQKIRLPYN---LNTLAQVAAVAALRD--QD
HIS8_LACPL       VMRTFSKAYGLANFRIGYAV-FNTKYAATMQTIRLPYN---VNSLAQVAALAAIDD--PN
HIS8_HALSA       VLRTFSKAYGLAGIRLGYAV-VPDSWADAYARVQTPFA---ASVIACQAGVAALDD--DD
HIS8_HALWD       VLRTFSKAYGLAGLRIGYAA-VPESWADAYARINTPFA---ANKTACQAALAAIED--QS
HIS8_DESAG       VLRTFSKSYGLAGLRLGFGV-MHPALADYVKRVRLPFS---INILAEYAGIAALQD--TT
HIS8_LEPIN       YTGTFSKVYGLGGMRIGYGI-GNQELISNLYKMRPPFS---VTNLSALAATEALKN--ES
HIS8_HELHP       YLGTFSKVYGLGGMRVGYGI-ASEHIISMLYKVRPPFN---VTTLSLQAALIALKD--QV
HIS8_NITSB       YLGTFSKAYGLGGMRVGYGI-ADQSVIGQLYKLRPPFN---ITTLSLKAATTALED--EG
HIS8_ARCB4       YLGTFSKAYSLGGMRVGYGF-AQNEIIQNLYKIRAPFN---ITTLSLAAAIEALKD--EE
HIS8_CAMHC       YLGTFSKVYGLGGLRVGYGV-ADEKIISALYKLRPPFN---VANLSLAAAVAALQD--KK
HIS8_CAMFF       YLGTFSKAYGLGGMRVGYGI-ANEEIIKALHRLRAPFN---ITTLSLAAAIEALKD--ND
HIS8_RUBXD       VARTFSKAHGLAGFRVGYGL-ASREIADYAERVRFPFS---VNLAAQVAATASMQA--RE
HIS82_LEGPL      VTRTFSKIYGMAGLRLGYAI-ANPSIINILKRVQLPFI---VNQVALAAAYAAIDD--DD
HIS8_PELUB       VIRTFSKIYGLASLRVGWGH-GPKKIISAMNLIRPPFN---VNQVAQMAAIEALKD--RK
HIS8_HYPNA       MMRTFSKIYGLAAMRLGWAY-MPAGIAAIYQRIRGPFN---VSSIAAAAGIACVGD--EA
HIS8_ZYMMO       VTRTFSKIYGLAAERIGWAY-ACPEIIDALNRIRAPFN---VTIAGQKAAVAALED--QA
HIS8_NOVAD       VTRTFSKIYGLAGERIGWGT-GHPAIVDMLNRIRGPFN---ISLTGQAAGLAAVRD--QA
HIS8_JANSC       MTRTFSKVYGLGGLRVGYGY-GPRHVIDTLNRIRGPFN---LSGMALAGAEAAVRD--VD
HIS8_PARDP       MTRTFSKIYGLGGLRVGWGY-GPREIVDVLNRIRGPFN---LSNVALEGAEAAMRD--RE
HIS81_CAUVC      VTRTFSKIHGLAALRVGWGY-APEHIIAPIERIRPPFN---TSIPAQEAAVAALFD--DD
HIS8_ACICJ       MTRTFSKMFGLGGVRLGWAY-APLAIVDVLNRTRMPFN---VSGPAAAAGIAALAE--PG
HIS8_GRABC       MTRTFSKIFGLGGLRLGWAY-APPAIVDVLNRVRGPFT---VNAAVQEAAIGALEE--PG
HIS8_RHOCS       MTRTFSKLFGLGGMRLGWAY-CPPAVADALHRVRSPFN---VSVAAQAAGVAALED--LE
HIS8_RHORT       MLRTFSKI-GLGGLRLGWSY-GPAHIIDVLNRVRGPFN---ICGQALVAGEAALAD--PA
HIS8_MAGSA       VCRTFSKMYALGGLRLGWAY-CPENVAGVLNRVRNPFN---VGAPALAAGLAAFND--TA
HIS8_MARMM       VTRTFSKIHGLAALRLGWAY-GNKAIIDVLHRVRGPFN---VNMAAIEAGTAAIQD--RD
HIS8_XANP2       MSRTFSKIHGLAALRIGWAV-GPAHVIDAMNRVRGPFN---MNTPALLAGAAAIAD--AA
HIS8_BDEBA       VLRTFSKIYGLAGFRLGAMI-APPEVVEVFNRVRKPFN---VNDLAQVAANAALQD--KE
HIS8_METI4       ILRTFSKMYGLAGLRIGYGV-ASKYVARYLERARQPFN---TNSLAQIAATASLED--TQ
HIS8_DESPS       SLRTFSKAYGLSGLRVGFGL-MAEEIVTCLHKVRQPFN---VNSLAQVGALAALGD--VD
HIS8_ALKOO       ILRTFSKVGGIAGVRVGYAL-TSKEIASQMSKVKDVFN---VNILAQAAALGVLED--TE
HIS81_PSYA2      IVRTFSKAYGLAGLRVGYAL-SSAAVADLLNRIRQPFN---VSRVALAAAAAALAD--QD
HIS8_AKKM8       VLRTFSKAYGLAGLRVGYGI-APEPVCSMLHKARAPFN---LHVLAQEAALAALED--RE
HIS82_HYDCU      VSRTFSKAYGLAALRIGYMV-ANEELIAYINRLRAPFN---INHLAQVAAKAALKD--PM
HIS82_HAEIN      ISRSLSKAYGLAGLRIGYAV-SNPEIADLLNRVRQPFN---CNSLALTAAVAVMND--DK
HIS81_IDILO      VSRTFSKAYGLAGLRAGYAV-SHESVADVLNRIRQPFN---MNSLSLKAAEVVLDD--HA
HIS81_NITOC      ITRTFSKIYGLAGLRIGYGV-SHPDLADLMNRVRPPFN---VNSLALAAATAALQD--HD
HIS81_CUPPJ      VSRTFSKAYGLAGLRIGYAV-AQPELTDLLNRIRQPFN---VNSVAQAAAVAALGD--TA
HIS82_METCA      VTRTFSKAYGLAGLRVGYAV-TGVEIADLLNRARQPFN---VNTLGLAAAAAALED--TG
HIS82_PSEF5      VSRTFSKAYGLAALRVGYGL-STPVVADVLNRVRQPFN---VNSLALAAACAALED--VD
HIS81_THIDA      ISRTFSKAYGLAGLRVGYGI-GHADVVDLLNRVRHPFN---VNASALAAAEAALDD--DA
HIS82_NITMU      ITRTFSKAYGMAGVRVGFGL-GHPDVAGLMNRVRQPFN---VNNIGLAGAVAALQD--EE
HIS8_ANADF       VLRTFSKIYGLAGMRLGYGL-ARPEVVEYVDRVRPPFN---TNLVAQAAGAAALGD--SA
HIS8_SYMTH       IARTFSKIYGMAGFRLGYGV-MRPEVLAPLYTARDPFS---VNGLAVAAGLAALDD--VE
HIS82_CARHZ      VLRTFSKAYGLAGLRVGYGF-APENLAKAINSLRPPFN---VNFLAQMAAVAALDD--EE
HIS8_CALS8       VLQTFSKIYGLASLRIGYAI-ASEEIIEKLNRVRPPFN---VNHVAQIAAIAALDD--QE
HIS8_MOOTA       ILRTFSKIYGLAGLRVGYGV-AVPEIIRDLNRVREPFN---VNLLAQVAAVAALKD--EA
HIS8_STACT       LMRTFSKAYGLAGLRVGYVI-ATKEAIHNYNIIRPPFN---VGRLSEYAAVAAFED--QD
HIS8_MACCJ       VLRTFSKAYGLAGLRVGYAI-TSKAYIDVFNKVKLPFN---VTALSLVGAIAALKD--QQ
HIS82_OCEIH      VLRTFSKAYGLAGLRIGYGI-ANSTIIETLDKVRGPFN---TNSVAQKAASYALKD--QE
HIS8_LISIN       ITRTFSKIYGLASARVGYGI-ADKEIIRQLNIVRPPFN---TTSIGQKLAIEAIKD--QA
HIS8_LYSSC       LLRTFSKAYGLASFRVGYAI-GQPTIIEKLDPVRGPFN---NTSLSQAVAAIALSD--QE
HIS8_BACSK       VLRTFSKAYGLAGLRVGYGI-SQREIARQIEPVRLPFN---NNILAHTAALAALED--EA
HIS82_BACAN      VLRTFSKAYGLASFRVGYAV-GHEELIEKLNVVRLPFN---VSSLAQKAATIAFGD--DE
HIS81_BACAN      VLRTFSKAYGLAAFRIGYAV-GNTELIGQLEVARLPFN---TSTVAQSVALAALED--QA
HIS8_BACHD       VLRTFSKVFGLAALRIGYGV-ANQALIEKIEPVRPPFN---NSTFSQVAAVAALED--EA
HIS8_ANOFW       ILRTFSKAYGLAALRIGYGI-AHEHLLQAIEPAREPFN---TSRLAQAAAFAALKD--QT
HIS8_BREBN       ILRTFSKIYGLAALRIGYGI-ASEELISSLEHVREPFN---TGTLGQVAARAALKD--QE
HIS8_THEMA       VIRTFSKAFSLAAQRVGYVV-ASEKFIDAYNRVRLPFN---VSYVSQMFAKVALDH--RE
HIS8_METLZ       IGRTMSKVYGLAGLRIGYAF-VPEWLEAPYNIAATPFT---MNRLSEAAASVAVSD--AA
HIS8_METMJ       IGRTMSKIFALAGLRVGYAF-VPEWLEPFYQRAATPFA---LNSVSMAAAGGALAD--TE
HIS8_METJA       VLRTFSKVFGLAGMRVGYGV-ANKKIIDYMMRVKPIFS---LTRLSQVCAITALRD--RE
HIS8_METKA       VLRTCSKALGLAGARVGYGI-ANPELIEHLHRIKPVFS---LTRPSAAAAEATFRD--RD
HIS8_METST       IIRTFSKVMGLAGLRIGYGL-SNPDFIEKMSRIKPVFS---VTVPSQKAVIATLND--EE
HIS8_METTH       ILRTFSKVMGLAGMRIGYGL-GDPQIIEYMHRVKPVFS---LTRLSHAAALATIRD--RD
HIS8_METS3       IIRTMSKVMGLAGMRMGYGL-ACSEIIEYMHRIKPVFS---LTRLSYVAALNTLRD--KN
HIS81_ARCFU      IARTFSKAFGLANLRIGYAL-LPEWLVSPFRAAMTPFP---LSTPAAKAAEAALDD--VE
HIS8_METMA       VGRTFSKVFGLAGLRLGYGI-MPEWLTKEYLRAATPFS---VSLPALRAGLAALSD--TE
HIS8_METAR       IGRTMSKAWGLAGMRIGYGF-MPDWIFREYMKVATPFA---LSRIAIAAALAALKD--EE
HIS8_FRAP2       VLRTLSKSFGMAGLRLGVVI-TNSDRIVWLRKILAPYP---IPKTTESTILAMLDDENLA
HIS8_XYLFA       VLRTLSKAHALAAVRIGSVI-ADAHLVAILRRCQAPYP---LPTPCVSLAEQGLSAAALQ
HIS8_COLP3       ILRTLSKAFALAGLRCGFTL-SNKAVITLLSKVIAPYP---IAAPVAEIASKVLTN-DLD
HIS8_SHEAM       ILRTLSKAFGLAGARCGFLL-AKPSVCELVMRVIAPYP---VPVPVSVIAEKALSVMGIA
HIS8_SHEON       VLRTLSKAFALAGARCGFLL-ANEEIIEIIMRVIAPYP---VPLPVSEVAEQALSPAGIA
HIS8_BUCCC       ILRTLSKSFGLSAIRCGFVL-SNVKIIKILKKVLAPYP---ISIPVSDIAIQSLCSQNIF
HIS82_IDILO      VLRTLSKAFALAGIRCGFLL-ANDDIIELLQKVLAPYP---LPDPTVQIAVQALQTSSLE
HIS8_BUCAI       VLRTLSKAFALAGIRCGFTL-AKKEIIQTLSKVISPYP---ISIPVSDIAIRSLEKDYVQ
HIS8_BUCBP       VLRTLSKAFSLAGLRCGFLL-SNSNIIKMLSKVINPYP---ISLPVSDLATQSLSKKNID
HIS8_BUCMH       ILRTLSKAFALAGLRCGFIL-TNVNIVKFLLKVINPYP---IPIPTTSIAVQFLSKNNIN
HIS8_PSEA6       ILRTLSKAFALAGLRCGFTL-AQAPVIQALMKVIAPYP---IPEPVAQIAAQALSSEGLV
HIS8_AERHH       VTRTLSKAFALAGIRCGFTL-ASPEVIAMLAKVIAPYP---IPEPIAQIAAQALSPMGLE
HIS8_BLOPB       ILRTLSKAFALAGLRCGFTL-ANPEIIKLLEKVIAPYP---LSTPVIDIAEQALTPISIQ
HIS8_PHOPR       ILRTLSKAFALAGLRCGFTL-ANTDVINLLLKVIAPYP---VPVPVADIAVQALSVAGRA
HIS81_HAEIN      IIRTLSKAFALAGLRCGFVL-ANPELIDILSKVIAPYP---IPVPSADLAEQALRPSNIA
HIS8_YERPE       ILRTLSKAFALAGLRCGFTL-ANSDIIQLLLKVIAPYP---LSTPVADIAAQALSPKGIE
HIS8_ECOLI       ILRTLSKAFALAGLRCGFTL-ANEEVINLLMKVIAPYP---LSTPVADIAAQALSPQGIV
HIS8_VESOH       LLRTVSK-IGFAGLRLGLLI-ATQDTVNQLNKLRLPYN---INILTQVSANFLLQE--KN
HIS8_HAHCH       VMRTFSK-VGLAGLRFGMLF-GAQEWIEQLNKVRLPYN---INCLTQNAVLTAIRH--FP
HIS8_NEIMA       VMRTVSK-IGFAGLRIGYAA-GCPEVIGELQKILPPYN---MNQLSLTTAKLALQH--YG
HIS82_NITOC      VMRTLSK-IGLAGLRLGMLM-GNPAWIKELEKVRLPYN---INQLTQVSAEFALEQ--PG
HIS81_NITMU      LMRTLSK-LGMAGLRLGLLA-GKPEWLRQLEKLRLPYN---VGIVTQRIAEKLLQH--RD
HIS82_BORBR      VMRTVSK-IGLAGLRFGYLA-GHPAWIAEFDKVRPPYN---MDVLSQAVLAAVLRH--KP
HIS8_CHRVO       VMRTLSK-LGLAGIRLGYAA-ASPAWINELNKVRPPYN---VNVLTIAAARFALKH--LD
HIS8_METPP       LMRTLSK-FGLAGVRLGYLM-GPTALVAEIDKVRPPYN---VSVLNCEAALFALEH--ED
HIS81_RALSO      VMRTVSK-LGLAGIRLGYVA-GHPKWIAELDKVRPPYN---VNVLTEATAAFVLDH--VD
HIS8_HYDS0       VMRTLSK-IGLASLRVGALI-GTKEFIREISKLKMPFN---VSYTSQAMADYIISN-HID
HIS8_AQUAE       VLRTLSK-IGMASLRVGILI-GKGEIVSEINKVRLPFN---VTYPSQVMAKVLLTE-GRE
HIS82_ARCFU      VLRSFSKFFGLAGMRVGYAV-CSAEIAEAIEKVRLPFG---ISYPAVETAIAALRS--LD
HIS8_GLOVI       ILRTFSKAFRLANFRVGYAL-ANPEIAAVLEKVRLPYN---LPGLSQLAAFAALEH--RD
HIS8_SYNJB       ILRTFSKAFRLAAHRVGYAV-GHPQLMQVLDGIRLPYN---LTALSQWAVQMALEH--AE
HIS8_THEEB       ILRTFSKAFRLAAHRVGYAI-GNAEVIAVLEKVRLPYN---LPTFSQVAAQVVLDH--RQ
HIS8_SYNE7       ITRTFSKALRLAAHRVGYGI-GDPQLIAALEAIRLPYN---LPSVAQLAATLALEA--RS
HIS82_NOSS1      ILRTFSKAFRLAAMRVGYCV-AHPEAIAILEKVRLPYN---LPSFSIASALVALQN--RA
HIS8_CYAP4       ILRTFSKAFRLAAHRVGYAI-AGPELIAVLEKIRLPYN---LPAYSQLAAQLALSQ--RQ
HIS8_DEHM1       ILRTFSKWAGLAGLRVGYGL-FPPVIADYLSRIKDPYS---VNIAADAAVRQTMLQ--RE
HIS8_ROSCS       VLRTFSKWAGLAGLRIGYAA-MHEDVITYLWKIKQPYN---VNVAAEVAAVASLDD--LD
HIS8_YEAST       TLQTLSKSFGLAGIRLGMTY-ATAELARILNAMKAPYN---ISSLASEYALKAVQDSNLK
HIS8_CANMA       VLQTLSKSFGLAGIRLGITF-CSKELSWYLNAMKYPYN---ISSLTSNVALKATKQ-GLE
HIS8_CYTH3       VLQTFSKAWGMAALRLGTAF-ASKEIVSVLNKIKPPYN---INLLTQEAALEALQN--VS
HIS8_GRAFK       VTQTFSKAFGRAGIRLGVLY-SSDEIIAILNKIKPPYN---VNQLTQKESLKILFN--LD
HIS8_BACTN       VFQTFSKAWGCAAIRLGMAF-ASEAIIGILSKIKYPYN---VNQLTQQQAIAMLHK--YY
HIS8_PARD8       VLQTLSKAWGAAGIRLGMAF-ASPEIIGVLNKIKYPYN---VNQLTQEKALELLND--EA
HIS8_THEGJ       VLRTFSKAFGMAGIRAGYML-AGEEIVDALYRIKSPFS---VGIMTMTAIRVALRH--AD
HIS8_DESHD       VMKTFSKLFAMAALRLGYLL-GQPSIIGALNRARQPFN---VNSFSQKAGVIALNY--GE
HIS8_RUMCH       ILRTFSKAFGLAGIRCGYSI-ASEKLTRAVNLTRPPYN---ISSLSQFTAALILSY--KE
HIS81_CARHZ      ILRTFSKARALAGLRLGYLV-ASVDVVKEIIKVKNPYN---VNVFSQIAGEVVLAN--EE
HIS8_PELTS       ILRTFSKAFALAGLRVGYLL-AGRPVINELLKVKQPYN---LNAFSQAAARVVMEN--LP
HIS8_THEP3       VLRTLSKAFGLAGLRVGYAV-ANENILKYLNLVKSPYN---INSLSQVIALKVLR---TG
HIS8_CLOK5       VLRTCSKAMASAAIRLGFLI-TNSFMLNEIKKAKPPFN---VSSVTQAIGEAVLEE--TE
HIS8_CLONN       VLRTASKAIGSAALRLGFLI-TNDTLLREIKKVKPPFN---VNSVSQVIGEIILKD--KD
                    : **    .  * *                                           

HIS83_RHILO      AYADNHRHIRHERRRVTLAL-----S-QL---G-FSVIPSHANFLLAR------------
HIS8_STRGC       YYLETGRAIQETRDWFAEEL-----A-AL---D-FQVLPSQTNFVLAQ------------
HIS8_LACLA       YFQKNIQKIIKTREVFKDNL-----V-NL---G-FEVTDSKANFVFVH------------
HIS8_SYNAS       WFAEKIARIIEARDFFSEEL-----K-GQ---G-WQVLPSKANFVFVR------------
HIS81_OCEIH      YFLQTTTKIIESRSYLKEQL-----E-TR---H-FDILPSQANFLLVS------------
HIS8_BRAHW       YFKDTVNKVINTREKTKIKL-----K-EL---G-FNVLDSKSNFIFIS------------
HIS8_CLOB8       YFEEITKKIVKTREKVVKEL-----E-KL---D-FRVLKSESNFVFAS------------
HIS8_CLOB6       YFKECTSKVIKTRNWTINEL-----G-KI---G-FKVIPSKANFIFIT------------
HIS8_CHRSD       YFEACRERVITTRERTRQRL-----E-SL---G-FEVMPSQSNFLFVR------------
HIS8_ACEPA       WLATSVQKVMASRTVLTEGL-----Q-KL---G-FDVLPSKANFVYTR------------
HIS8_MARMS       YLKEICDKTIATREQSVKDL-----E-AL---G-FSIIPSATNFVFAT------------
HIS82_PSYA2      YFEQTCQQVIDLRTSLTAEL-----T-AL---G-YDVLPSHANFVFAR------------
HIS8_ACIB5       YFEEQCQKVITSREKLVRDL-----T-EL---G-FNVLPSKANFIFAT------------
HIS81_METCA      HFEWSRQAIMWTRQWLSRGL-----A-EL---G-FEVLPSAANFVFVR------------
HIS8_SYNY3       EFVPLWEKVRHTRTRLMEQL-----A-EL---D-FQVCPSDANFVFAA------------
HIS8_RHOBA       WLADVVAKMNVTRDRTTDRL-----R-AL---G-FDVTPSHANFVWCR------------
HIS8_GEOBB       YFQECVRKIKETRAWFTAEL-----Q-QL---G-YQVIPSSGNFVFAS------------
HIS81_NOSS1      YKNACVAKVKASRTRLAKDL-----K-QL---G-FCVWDSQANFLLTQ------------
HIS8_DEIRA       YMRERVAEAIAERGRIYAAV-----Q-GH---PTCTIFPSNTNFFLLK--T---------
HIS81_LEGPL      WFTKTIEQIKSSRAWVIKKF-----A-DN--PIIEKIYPTETNFILIQTRF---------
HIS8_SACS2       YIKDVVNIVNRNREILYQGL-----K-NL---N-LKVYKSITNFLLIK--D---------
HIS8_CHLCH       LVDEAVSAILSERDALYEQL-----R-MM---EGVSPFASDTNFLIVR--V---------
HIS8_BIFAA       EQLSRVAHLRETRNATSAWLKEQTYK-GQ---P-LEVAETQSNFILFGGHF---------
HIS8_CUTAK       EMLARVDELRETRANLEDWL-----Q-LH---G-LDVVSSQSNFVLFG-RF---------
HIS8_MYCA1       DTLGSVAALIAERERVSTAL-----T-GM---G-FRVIPSDANFVLFG------------
HIS83_BURL3      EMLSQVEAIKAERDSTVDWL-----R-GL---G-LTVADSDANFVMFG------------
HIS8_PAEAT       ALMADVEDIKVQRDRIVTEL-----L-RM---G-LKPAASDSNYVFFG----------GL
HIS8_FRACC       ELLGTVEAVKAQRDRIVREL-----P-AL---G-LRLAPSDANFVFFG-RF---------
HIS82_CAUVC      YLKRTVDLTIAERGRVEAVL-----D-DM---G-VEHTESHANFVFLR------------
HIS81_GLUOX      HMHKTVGATLAEGKALKAAL-----E-ER---G-YFVAQSFANFLFFN------------
HIS81_RHILO      HLAKVVALAKAERTQVESLL-----R-NM---G-FDVAPSRGNFLFFN--C--------R
HIS83_RHIME      HLNRSVELALVERERMKKEL-----A-TM---G-YRIAPSKCNFLFFD------------
HIS8_LEUMM       YLQKNVQRFQVERQKFQDFL-----T-KN---K-FKFYESQANFIWIK--V---------
HIS8_LACF3       FVKEAAAKNTVERAKWEDFF-----D-QQ---G-VKYFKSQANFIYFT--V---------
HIS8_LACPL       FVKQTVQKNATERAKWMAFF-----D-DQ---G-VTYDQSGANFIFFK--Y---------
HIS8_HALSA       HVEATTDSVAWGRDYIHDEL-----A--------ARTYESHGNFVLAN--V---------
HIS8_HALWD       HVEHSIETARWAREHYREEL-----D--------ARTWPSGGNFVLCE--V---------
HIS8_DESAG       FHAQTLRVTREGRTYLTGAL-----T-EA---G-CTVYPSAANFIMFA--L-----PE--
HIS8_LEPIN       YVESYLENNWNEMKRYEKFA-----A-EQ---S-IEFIDSYANFITFF--A-----RKRG
HIS8_HELHP       FVSECIKNNAIEMARYEAFA-----N-EM---G-FTFIPSYGNFITFL------------
HIS8_NITSB       FVQYSIEQNFLQMERFVNFA-----L-QN---G-FEFIDSYTNFITYL--L---------
HIS8_ARCB4       FVNDCISKNFEEMKRYEEYV-----T-KK---G-FEYIPSYTNFITIK--F---------
HIS8_CAMHC       FIEKTIKNNFKEMKKYEKFA-----N-AT---G-IKFIKSYTNFITFI--L---------
HIS8_CAMFF       FLKETLENNFKEMKVYEEFA-----K-EN---S-IEFIESYTNFITFI--F---------
HIS8_RUBXD       KIRARAEFVIRERERVERAF-----R-EA---G-LNYVHSQGNFVLVE--T---------
HIS82_LEGPL      FIQSSLKMNNEGMSQLQAGF-----N-EL---N-IKYLPSSCNFLTFD--C--------E
HIS8_PELUB       FINNSVKHNIREANKVRNAL-----Q-KL---K-ILSNEVTANFLLLN--F--------D
HIS8_HYPNA       FLKMSRDHNTHWRAIMTDAL-----N-AM---G-LPTPPSHANFIVTE--F-----GS--
HIS8_ZYMMO       FIQNSFKHNKKWRGWFENQM-----A-LLSNAG-IRVIPSSANFTLLL--F---------
HIS8_NOVAD       FVEASRRHNAHQRTRFVGKL-----E-ALGNHG-VRPLPSQANFVLIL--F---------
HIS8_JANSC       WVNECLRVNADERARLVGGL-----R-QL---G-LACDDSHANFVLAR--F---------
HIS8_PARDP       HIARCQAENARMRAWLAEAL-----A-EK---G-VPSDTSCANFILAR--F---------
HIS81_CAUVC      FQDRSRALVEQWRPWLAQQL-----G-GL---G-LEVTPSAANFVLAT--F-----PT--
HIS8_ACICJ       WVERCRNHNTRARTELAARI-----E-RA---G-FRVWPSEANFLLAD--L-----ET--
HIS8_GRABC       WVERSRAHNSAARAKLATAL-----F-DI---G-IPTLPSVTNFLLAD--F---------
HIS8_RHOCS       FQERSRALNEQSRTAFTGRV-----R-AL---G-LVVHPSVCNFVLVD--F-----AATG
HIS8_RHORT       FTDLSRAHNSLWREWTRAKL-----Q-AM---G-IRVGESSGNFVLAT--F-----DA--
HIS8_MAGSA       YAELCKSHNDYWLPWLSGQL-----A-EL---G-LTVVPSVCNFILVR--F-----PK--
HIS8_MARMM       FMKRSVEHNEEWVAFLRQQI-----G-GL---G-LEVTPSVCNFVLIH--F-------PE
HIS8_XANP2       HVEKAVAHNARWLPWLTEQI-----E-GL---G-LKVTPSVANFLLIH--F-------PD
HIS8_BDEBA       FIERSQQICWKGLDYFYKKL-----E-EL---G-LPYIPSQGNFVMFD--T------L--
HIS8_METI4       HRLLTLKITEEGKKRLEENF-----D-RL---G-LPFIPSSANFILVH--V---------
HIS8_DESPS       FYEQTLLKNRQGMKWLMKEI-----K-GL---G-CEPFASQTNFFLID--V--------Q
HIS8_ALKOO       HIEKTVKLNYESLGMMEKYC-----E-EN---D-LEYIKSNANFMFMN--I--------G
HIS81_PSYA2      FIEKTRLINDEQMHWLEKQF-----D-AL---G-LGFIKSHANFIMVE--I------AVE
HIS8_AKKM8       HVRRTVENNKEGMRFYEQAF-----R-EM---G-LEWIPSQGNFILVK--V---------
HIS82_HYDCU      FVKKTVDLNTQGMQTLTQFF-----E-EK---G-LSYIPSQGNFVCVD--L--------G
HIS82_HAEIN      FVEKVAENNRIEMRRYEDFC-----Q-KN---Q-LDYIPSKGNFITID--F--------K
HIS81_IDILO      YLQKAVELNAQGMQLLTEFC-----E-ES---G-LNYIPSYGNFLTIE--V--------G
HIS81_NITOC      HLQRSRKVNQAGMAQLTMAF-----T-AL---G-LDYIPSVANFVTVD--V--------K
HIS81_CUPPJ      FLQRSAELNRAGKAQLVEAF-----S-RL---G-LEFVASSGNFVLVR--V--------G
HIS82_METCA      FLEATVQANDAGRSQLEAGF-----R-ER---G-FDFIPSAGNFVSFD--L--------G
HIS82_PSEF5      YLAESRRLNEAGMQQLEAGF-----R-DL---G-LRWIPSKGNFIAVD--L--------G
HIS81_THIDA      FLARSYALNAAGMQQLLGGL-----A-AL---D-IETVPSKGNFVLAR--V---------
HIS82_NITMU      FVKRSYALNQAGMLQIVTGL-----R-QM---G-IEYIPSYGNFLSFR--V--------P
HIS8_ANADF       HVAKSRALVLEERPFLAKGL-----A-AL---G-AIVVPSQGNFVLAD--F-----PG--
HIS8_SYMTH       HVERTRALTREGKAYLYAAF-----Q-RL---G-LGYVPSEANFVLFD--A--------G
HIS82_CARHZ      YVREVVKNTDEGKKFLYQEI-----I-RM---G-LSYIPSAANFLMIK--T--------E
HIS8_CALS8       HIEKAKELNKKSLEFFYKSF-----E-EM---K-LPYIKSYGNFVMVD--V--------T
HIS8_MOOTA       HVGKSREVNSEGKDYLYSQF-----E-SL---G-LKYVPTEANFIFVD--I--------Q
HIS8_STACT       YLKEIQKRNAEERAKFFEIP-----E-SK---H---FFDSQTNFIFVN--T---------
HIS8_MACCJ       YLKDYVAHNDKERNKFFEAD-----Y-KE---H---LIDSVTNFIFVK--T---------
HIS82_OCEIH      FIQHTNQENYKNLTEFQHFL-----Q-RL---G-WGYYDSEANFLLVK--T------P--
HIS8_LISIN       FIGECRTSNANGIKQYEAFA-----K-RF---EKVKLYPANGNFVLID--L--------G
HIS8_LYSSC       YIEACREANEHGKKQYVEFC-----E-KH---N-LKYFPSDTNFIFFD--T------K--
HIS8_BACSK       FIAACKQKNSVEKAKLRAFF-----E-AR---G-MFVFPSETNFLLVE--T------G--
HIS82_BACAN      FIEEIVRVNTEGLRQYESFC-----K-EN---E-IPFYQSQTNFIFLP--V---------
HIS81_BACAN      FLQECVKKNEEGLHQYYAFC-----K-EY---N-VFYYPSQTNFIFLK--L--------G
HIS8_BACHD       FVQSSVEKNNEGMEQLTEWC-----S-RM---G-LDYFPSQTNFLLIH--V--------N
HIS8_ANOFW       FIQQCAQKNKQGLDQFYAFC-----D-EY---G-LRYYKSEGNFILID--F------G--
HIS8_BREBN       FVKSCRDRNREGMKQFTDSF-----D-EW---G-LSYYPSQTNFILVD--L--------K
HIS8_THEMA       IFEERTKFIVEERERMKSAL-----R-EM---G-YRITDSRGNFVFVF------------
HIS8_METLZ       YRESFIAHVQKWRDVFMQEI-----P--------FPVYPSGSNFILIN--V-----AP--
HIS8_METMJ       RVRETRDHVREWRRRFLEEV-----P--------FRVYPSDANFVMID--V-----DP--
HIS8_METJA       FFERCVRDGIKSREMLYNGL-----K-KF---KDIKVYPSEANYLLVE--L-----KT--
HIS8_METKA       YIEKSVRLMIESRKYLYREL-----R-KL---DRLTPFPSEANYLLVD--V-----SNTG
HIS8_METST       FIKESTEKAITEREYLYESV-----N-SI---DNIHIYKSKSNYLLMD--V--------R
HIS8_METTH       YIKKSTEYSIKSREYLYSGL-----K-KF---PELRVFRSYANYILID--V--------R
HIS8_METS3       YIETSIEKGIESREYLYNEL-----S-KI--DS-LNVFPSKSNFMLIG--I--------K
HIS81_ARCFU      WMRSCVGRIKAERERLYKEL-----K-KL-----VEVNLSQANFLFFE------------
HIS8_METMA       YLNKSINLAREGREYLKEKI-----P--------FKVYPSQANFVLVD--V-----SP--
HIS8_METAR       HYNRTVETVKAERQFLMENV-----P--------FKVYPSEANFVLID--T-----AP--
HIS8_FRAP2       NIASQIIEIKEQREHLYQAL-----S-QMKIVD--KLWSSDANFILVR--F---------
HIS8_XYLFA       VTAQRVAEIRAERERLGAAL-----A-CL--SGVRRVYPSQGNFLLVR--F---------
HIS8_COLP3       VMQARVISANSLREQLSEWL-----KQQK---WCSDVFDSNANFVLFR--C---------
HIS8_SHEAM       QMRADVVLLNKQGARLALAL-----T-EA---G-LSVLPSGGNYVLAF--S---------
HIS8_SHEON       RMKTQVKELNTQGERLAAAL-----N-LYCEQWGGAVLKPNGNYVLAE--F---------
HIS8_BUCCC       LMQKNILRILKNKKFLIDQL-----K-KI--SYIKNIFHSEANFILIK--F---------
HIS82_IDILO      RLQQQVATLLAERDRVQTAL-----E-QT---PLTLVSESDTNFLLYQ--C---------
HIS8_BUCAI       LMKNRVLDSNNNRIWLINQL-----K-NI--TCVETVFESNANYVLVKFSM---------
HIS8_BUCBP       IMNSRVLDLNKTRVWFVKQL-----RTMY---CINTIFDSVANYFLVK--F---------
HIS8_BUCMH       EMRNRIFDLTLNRFWLVNKL-----K-SMN-NCVEHVFNSFANYILVR--F---------
HIS8_PSEA6       TLEQQVAVINQEKALLKSAL-----A-EI--ADVELVGDDKANFILFR--T---------
HIS8_AERHH       LMQERVVELNKQKAAFKAAL-----A-TL--HCVKEVFEDKGNFVLVR--F---------
HIS8_BLOPB       YTQNRIATVNTNRNILITGL-----KKCS---CVQQVFNSHANYVLVK--F---------
HIS8_PHOPR       RTKFQVLDISANRAYLQAGL-----G-ML---SGVTVYDGYGNYLLVK--F---------
HIS81_HAEIN      TVQALTQELLSNRQWLAKAL-----LVLH---QVEKVYESEANYLLIK--C---------
HIS8_YERPE       QMRQRVSEVRANRAWLQSAL-----QDCA---CVEQVFTSESNYLLAR--F---------
HIS8_ECOLI       AMRERVAQIIAEREYLIAAL-----K-EI--PCVEQVFDSETNYILAR--F---------
HIS8_VESOH       TINANVSVILAQRQVLFDAL-----V-KI---NVLKVYPSQANFILFK--A---------
HIS8_HAHCH       EFVKQTEALREQRSWLSAQL-----D-GV---AGVTVYPSEANFILVR--V--------D
HIS8_NEIMA       IISANIDSLKNERERMFAEL-----G-KI---CRLNTFPSQANFITIR--V---------
HIS82_NITOC      GLDEQARLICKARAQLQRAL-----Q-QL---PGIQVYPSDANFILFR--T------P-P
HIS81_NITMU      VLLQQAAAIKLERSSMSRRL-----A-EL---EGIEVFPTDANFILFR--L------NQD
HIS82_BORBR      VLDAQADRLRADRQPLADGL-----A-AL---PGVTVFPSAGNFVLAR--F------CGK
HIS8_CHRVO       VFNRQAAELRAERAKLSAAL-----A-AL---PQLAAFPSEANFVTVR--A---------
HIS8_METPP       EFARQAAVLRAERARLLDAL-----R-AM---SGATPFPSEANMVLVR--V---------
HIS81_RALSO      VLDAQAATLRAERTRLIDAL-----S-AQ---PGVTVFPSAANFLLLR--V---------
HIS8_HYDS0       NIKNQIKVLIDERHRLKEAL-----S-DI---KGIKVYDSCANFFLIK--V---------
HIS8_AQUAE       FLMEKIQEVVKERERMYDEM-----K-KI---EGVEVFPSKANFLLFR--T--------P
HIS82_ARCFU      YYKKVRDRIVRERERLIEKL-----K-EI---EWLEVYPSDANFVLVK------------
HIS8_GLOVI       VLLAAIPEILAERRRIERFL-----A-DF---EQLELFPSDANFLFVR------------
HIS8_SYNJB       ELLADVTLICQEREALYQAL-----Q-EL--PG-VRVWPSQANFLYFR------------
HIS8_THEEB       ALLAEIPTVLAQRDRLYKWL-----Q-SC---PQLHVWPSVANFLFFR--L---------
HIS8_SYNE7       QLLSAIPRLITERDRLYRKL-----Q-VV---SQLQVWPSASNFLFLK--T---------
HIS82_NOSS1      ILLESIPQTLDERTKLINAF-----S-QH---PALAVAESAANFIFLR--LKADSDNSSD
HIS8_CYAP4       SLLAEIELIWQERNRLFQAL-----A-PI--PD-LRLWPSAANFIYVQ--M---------
HIS8_DEHM1       YMLETVKKIVDERKRLYTEL-----S-KF---SWLKPYPSAANFILCK------------
HIS8_ROSCS       ERLSTVARIVAERERLAAAL-----A-AL--PG-IHVYPSAANFLLCRMTS---------
HIS8_YEAST       KMEATSKIINEEKMRLLKEL-----T-ALDYVDDQYVGGLDANFLLIR---------ING
HIS8_CANMA       IMENYVSKITEQRDIVLQKL-----L-SLKYVG-RNIGGLDSNFVLVE--V---LDKQGN
HIS8_CYTH3       VKDEMVYKILKQRDWLREEL-----S-KL--PVCLELYPSDANFILMR--T---------
HIS8_GRAFK       SIKLQVAEIKNERTILSKQL-----L-EV--NFVSKIYRSDANFLLIE--V---------
HIS8_BACTN       EIERWIKTLKEERDYLEEEF-----A-KL--SCTVRMYPSDSNFFLAK--V---------
HIS8_PARD8       TMKHQVNEILTERNRLEKIL-----SEPP---FSYQVYPSDANFLLVN--V---------
HIS8_THEGJ       LMEKTVRKIVEERERMRRKL-----G-EL-------AYPSDANFLLVR--L---------
HIS8_DESHD       EYAEQGRILIAELARIAEAL-----T-AF---ASVKVFATRANFLLFQ------------
HIS8_RUMCH       EIQNNIQYLVEERERVLSKL-----K-EI---DGLKVYSSAANFILIK--V---------
HIS81_CARHZ      VFQGEIKEIVAERERLYNQL-----A-SL---G-LKPVKSHANFILVE--F--------G
HIS8_PELTS       PFKERIKKILEERERLFTEL-----S-AL--PG-VEAFPSQANFILFR--T--------P
HIS8_THEP3       VLKERVNFILKERERLIKEL-----S-KI---PGIKVYPSKTNFILVK--F---------
HIS8_CLOK5       YIKKSLENIKNERSFLIDKL-----S-AF---KEIKLYPTCANFILIK--F---------
HIS8_CLONN       FIRESIDKVLYERNYLLKEL-----K-KI--DG-LKVYETKSNFVLIY--N---------
                                                           *                 

HIS83_RHILO      VPTAQDGSWWQSAFARQKILVAVF--PDKGLENYIRVSIGTKEQMDAFLRAAS---RISR
HIS8_STRGC       PTRISAAELFQQLE-ERQIYVRYF-PKAERIKDFLRISIGRREEMETVLAAIK---EICS
HIS8_LACLA       HPKVKAEELFKALY-EAKIIVRHW--NQPRIDDWLRITIGTNKEMNKVIEFLK---GYLK
HIS8_SYNAS       KPGLTGQTIYETLK-ERGILVRYF--NVEGIRDFVRVTIGKREDMARLLEELK---RLF-
HIS81_OCEIH      HKEVNAEVLYQELK-KQGILVRYF--QKPGLENFLRISIGTPAQIEKLLKKID---HIIK
HIS8_BRAHW       HKNIFAEDLYLKLK-DKGILVRYF--KSDLINNYIRVTIGTDEEMDIFVEKIK---YIIK
HIS8_CLOB8       HNNASGKFIYENLK-CQGILVRYF--DKERIDNFLRITIGTNEEMDILIEKLR---FILS
HIS8_CLOB6       YDTYEAKNIFVKLK-DENVLVRYF--NKYRISNYLRVSIGSKEEMVIFIDKIK---EIIN
HIS8_CHRSD       HETYEGRAIFGELR-ERGILVRHF--DKEALSDFLRISIGTEDEMDSLIEALE---AVCR
HIS8_ACEPA       HPNRNAAELATQLR-ERAIIVRHL--RGERTAAWLRITVGTDQQCETLLSALR---DILC
HIS8_MARMS       HPEKNAEQIYLTLK-ERGILVRFFGSNKPRIGNYLRITIGTDEEMAALTAALK---TL--
HIS82_PSYA2      PHDGAASQVAEVLR-EQGIIVRHF--DKPRINEYLRITIGTPSQHERLINALK---ALQA
HIS8_ACIB5       HSQHDAGQLAQKLR-EQGIIVRYF--NKPRINQFLRITVGTDEQNARLVQTLK--QDIL-
HIS81_METCA      HPRHDGAELAAALR-DRHIIVRHF--KLPRIDQFLRITVGTEGECQILLDALS---ELVA
HIS8_SYNY3       PRWMAAADLYQALK-EKKILVRYF--NHPRITDYLRITVGTDGEIDQLLLAIA---SLKG
HIS8_RHOBA       HPEGKHAEIHQYLK-QSQILIRYM--DFPDWGDGLRISVGTDDQIDACMLMIE---RAMQ
HIS8_GEOBB       PPDRDGTRIYQGLY-DRKILVRHF--TDPKLAHGLRISIGSREEMEQTVKALR---ELGP
HIS81_NOSS1      PPQGNAEYLYQQLR-EKKILIRYF--KQPGLEDKLRITVGTDEQNQILLQALR---DLLE
HIS8_DEIRA       PD---ADAAYRHLL-EHGIVCRRQ-DKLRGLDGCLRIAVGTPAENDALIAAIL---ALR-
HIS81_LEGPL      -----SKQLATWLA-RYGIAVRDF-PSSSLLHDHLRITVGHDEQNQLLIDALS---SFNA
HIS8_SACS2       -----NRNLQEMLM-RHGIAIRKL------YDNFYRITIGTEDQCKMVIDKLG---EELE
HIS8_CHLCH       AD---ANATFKRLY-DKGILVRNV-SGYHLMEGCLRCNVGLPEENRRLAEAFA---ELSV
HIS8_BIFAA       DD---RDRIFDELL-KRGVLIRVV-----GPEGWMRVCMGTDEEMARFREALV---EVLR
HIS8_CUTAK       AD---RHAVFQALL-DRGVLIREV-----GPTGYLRVCAGTPCQTDAFRTALL---DVLP
HIS8_MYCA1       -EFTDAPASWQRYL-DAGVLIRDV-----GIPGYLRATTGLAEENDAFLRASA---QLAA
HIS83_BURL3      -EFADRHRIWSGLL-RRGVLIRES-----GPPPYLRVSIGTGAEMAAFRAALL---DVMA
HIS8_PAEAT       ED---PHTIWQGLL-DAGVLIRDV-----GIPGHLRVTAGTEPETTAFLEALE---ALLD
HIS8_FRACC       AD---QRAVWQSLL-DAGVLVRDV-----GLTGWLRVTAGLPNEVDAFLGALG---RTLT
HIS82_CAUVC      -SPAGPEATAAHLL-HQGLIIRPT----PVAGGWVRITIGRPADNDALIAALP---AALS
HIS81_GLUOX      -ARESASALAERLL-EQGVIVKPW--KEKGYETWIRVSIARPEDSQAFLAALD---RVRQ
HIS81_RHILO      QN---ASAFAEGLL-REGVIVKPW--KQEGFDSYVRVSIGSPAENDHFMAALS---QLL-
HIS83_RHIME      -ARTEATPVAEALL-RRGVIVKPW--KQPRFETYIRVSIGSPVENDHFIHALK---EVEA
HIS8_LEUMM       GE---TKKVGQKLL-EQGFQVNDR-----LNPEWIRIALGTPEDNAELKLAFL---KATN
HIS8_LACF3       KN---AADLAQTLL-EKGFQVRRH-----LQPDWLRLTIGPAEDTTVMQALVA---DWLK
HIS8_LACPL       PS---ATQLADYLV-HHGYLIRTG-----LRPGWLRLTVGTANDNQQLQQLIR---EFKA
HIS8_HALSA       GD---AGRVAEAAK-REGVLVRDC-TSFG-LPEHVRITIGTRSETERAVAVLN---EVCD
HIS8_HALWD       GD---GNAVAEAAK-QEGVIIRDT-TSFG-LPECVRISCGTREQTKRAVDIIS---AVIE
HIS8_DESAG       NCPHDARAVFEALL-RRGIIIRPL-SSYN-LPQCLRVSIGNRHENELFIAQFK---ELLR
HIS8_LEPIN       KS---SSEIAHSLL-KQGIILRDL-KNYD--LNALRITIGRPEQNDLVLEALE---KEFH
HIS8_HELHP       HSHIESSHLCDWLL-QNGLIVRNL-RSYG--LNAFRITIGRAEQNTRVFELIK---AYLQ
HIS8_NITSB       PENRKSKSLSEALL-KRGVIVRDL-TGYG--MNALRITVGTKEQNDRFFEIFK---EVLN
HIS8_ARCB4       GDKYVSKEVAQKLL-ERGMIVRDL-TSYK--QNAIRVTIGKPEQNTKLFQLLD---EVLQ
HIS8_CAMHC       DESKKSSEISQKLL-EKGLIVRDL-KGYG--LNAIRITVGLPKQNKRIFDELR---KLLG
HIS8_CAMFF       DQHQNATKICDNLL-KQGIILRNL-KSYS--MNAIRITIGKNEQNRRVLDMLK---KEI-
HIS8_RUBXD       -----SPALFE----RAGVLVREG-DPLG-YPGWSRVTIGNTQENDLVIGALG-------
HIS82_LEGPL      ED---SMALYNYLL-DNGIIVRPL-HAYK-MNNFIRVTIGTKEQNSRFLTALK---NFYL
HIS8_PELUB       RCKFSANYIFNKLQ-SKGIILRSTEDGYN-IKNKLRLTIGSTKENMRFITTIK---AIFN
HIS8_HYPNA       DE--RAAAANQHLK-DNDILVRAI-GGYG-LPTKLRISVGSADDNQRFLDALK---AFTA
HIS8_ZYMMO       EGSLTAETAYKALM-DHGYTTRWL--PGQRLPHALRITIGSEKHMQDVAGILT---SLVR
HIS8_NOVAD       EGKVTAEDVYLGLM-DYGYITRWL--PGQGLPQALRITIGTEAQMDEIADAIR---RMCE
HIS8_JANSC       ASEAAADAADAHLK-RDGIIVRAP-KSYG-LPDCLRITVGRPEDNSRVLASLT---ALVA
HIS8_PARDP       ADAETAGACDEYLK-TQGLIVRRV-AGYG-LPHCLRITIGDEASCRRVAHVIG---QYMA
HIS81_CAUVC      TPGKTAPEAEAFLA-SKGYLVRAV-GNYN-LPHAIRITIGLEEQNRAVVELLS---QFMG
HIS8_ACICJ       AD--RAAAADTHLR-SRGIIVRQV-AAYG-LPQCLRITIGTDEECSTVADALD---DFGQ
HIS8_GRABC       GSEARAGAADRWLR-TRGLIVRRV-ASYG-LPAYLRITIGTNEECDLVAEALR---AFMA
HIS8_RHOCS       RP---AEEARQFLK-ARGILVRQM-GAYG-LPDCLRITMGLPAEMEEVADALG---DWLK
HIS8_RHORT       EGPFTALAADAALR-QQGIICRRV-AGYG-LPNCLRITIGRDDEMQAVVEALG---AFMA
HIS8_MAGSA       DAGKDAGAADKFLR-SKGIIVRAM-GGYG-LGDCLRITIGTGEENQLVVAALK---EFVG
HIS8_MARMM       TPGKTAADADAYLT-SQGLIIRAV-DPYG-LPNALRATVGSETENRRLVDALS---TFMK
HIS8_XANP2       TPGRTAKEADAFLM-KRGLVLRQV-ASYG-LPHALRMTVGTEEANHLVVAALA---DFMS
HIS8_BDEBA       RD---AAKVNEALL-RRGIIMRPL-LNYG-FKTHLRLSVGRDHENEAAMVALA---EVLK
HIS8_METI4       GD---GDFIFRALL-KKGIIVRSM-KSYG-LAEWVRITIGTEDQLSRLLEELP---LALL
HIS8_DESPS       GN---ADKLYTEML-YKGVIIRSM-SAYG-YPHYIRVTVGTTVENKRFLKALS---DCLK
HIS8_ALKOO       TH---SKPVFEELM-KQGIIIRPG--FLWKWDNWIRVSTGTLEQTEKFIDKLD---GILN
HIS81_PSYA2      MEDTNAAVIYQALL-EQGVIVRQL-EVYG-LYNWLRISVGVAEDNMRLIDTLR---SILT
HIS8_AKKM8       GR---GKQVFQDML-ARGVIVRAQ-DGYG-LPEWIRISIGTPAENARCIEVLK---EVL-
HIS82_HYDCU      PD---SLKINQALL-KEGVIVRPV-APEGKFSEFLRISIGLPNENQHFMAALN---KILT
HIS82_HAEIN      QP---AAPIYDALL-REGVIVRPI-AGYG-MPNHLRISIGLPEENDKFFTALS---KVLK
HIS81_IDILO      PG---AEKLYDELL-HEGVIVRPV-GGYE-LPNHLRVSIGLPEENQAFIKAMK---KLRG
HIS81_NITOC      QS---GDKVYENLL-RHGVIVRPM-TGYG-LPRHVRVTVGREEENARFIQVLE---TVLE
HIS81_CUPPJ      DDDDAGARVNVALL-RQGVIVRPV-GNYG-MPRWLRVTIGLPDENAAFIAALE---RALK
HIS82_METCA      RP---ATPVFDALL-REGVIVRPL-GNYG-LPNHLRVSVGTAEEIDLFFAALD---RVLV
HIS82_PSEF5      RE---AAPIFQELL-REGVIVRPV-ANYG-MPNHLRITIGLPAENTRFLEALA---KVLA
HIS81_THIDA      GD---AARINTELL-KRGVIVRPV-AAYG-LPEFLRVSVGLAGQNARFLDALG---EVLA
HIS82_NITMU      GN---VKAINESLL-KQGVIVRPI-SIYE-MPEHLRVTVGLESENEKFLKSLA---IALE
HIS8_ANADF       RT---GKDLFEALL-REGVIARPV-AGYG-FPSALRITVGLRRENERCLAALG---RILG
HIS8_SYMTH       RP---AAEVFDALL-RRGVLVRPC-GSFG-LPDHLRVTVGTPEQNRRFVEALK---AALG
HIS82_CARHZ      KP---SALVFRELL-KRGVIVRSG-DIFG-MDDWIRVTVGTPVQNARFINELK---MVLE
HIS8_CALS8       KD---AVEVFKKLL-LKGIIVRPG-DIFD-MPTYIRVTTGLESDNMEFIKALK---EVL-
HIS8_MOOTA       RD---SREVFRQLL-QKGVIVRTG-DIFG-YDTFLRVTIGTRRQNETFIRALR---EILA
HIS8_STACT       KR---PKELYEALL-KVGCITREF-------PIGVRITIGFPEQNDKMIEVLK---NFDF
HIS8_MACCJ       NQ---PEALFEALI-KGGVIARPM-------PNGVRISIGTRDDNEKVHKVIN---SFFS
HIS82_OCEIH      IS---GMDVYEYLL-RFGFIVRPG-ELLG-IPKTVRVTIGKEQDMKELQKVLE---QFDH
HIS8_LISIN       IE---AGTIFSYLE-KNGYITRSG-AALG-FPTAVRITIGKEEDNSAVIALLE---KLL-
HIS8_LYSSC       AD---SDVIFQELM-KKGFIVRSG-NALG-LPGFIRVTIGTEAQNAALLVQLD---NVLK
HIS8_BACSK       IP---GDVVFQAFL-ENGFILRSG-EALG-YPTAIRISIGNEAENDAFIEKAP---EILD
HIS82_BACAN      EN---GGEIYEACA-HAGFIIRPF-------PNGVRITVGTREQNEGVISVLQ---QHFE
HIS81_BACAN      IP---GNEAFERLM-KKGYIVRSG-AAFG-IDDGIRITVGLKEENDEIIELLK---ELVN
HIS8_BACHD       RS---SDDVFNAML-KKGYIIRSG-RALG-YPAWIRITIGSKEQNDGCLAALA---DVLA
HIS8_ANOFW       FS---GDEVFTYLL-QRGIIVRSG-CALG-FPTAVRITVGSAEQNETIIRALT---NMLK
HIS8_BREBN       MD---SDEVFKKLL-SQGIIVRSG-NALG-FPGFQRITIGTKEQNDKILSVLK---EIVT
HIS8_THEMA       MEKEEKERLLEHLR-TKNVAVRSF-------REGVRITIGKREENDMILRELE---VFK-
HIS8_METLZ       QK---GDAAAESLA-KHGVLVRSCTSFPGLGDTFIRVSVGADWENERFLAAVK---KL--
HIS8_METMJ       HT---GDEAVARLA-AKGVLVRSCTSFPGLGNHYIRVCIGEDWENIRFLEAIK---NL--
HIS8_METJA       MK---AKEFCEELL-KRGVIVRDCTSFDGLGDNYVRVSIGTFEEVERFLKILE---EIIS
HIS8_METKA       MN---ASEFTEELL-KRGVIVRDCSSFEGIEPFYVRVSTGTLEEDRKFIEVVK---DVLE
HIS8_METST       KTGYTAAELTSKLM-SRGVIVRDCTSFVGLDEYYIRISVETHPKNEKFIEILK---EIVE
HIS8_METTH       GTGRTAAELSEELL-RKGIIVRDCTSFTGLDEYWIRVSVGTLEEDRRFLEVLG---ELVQ
HIS8_METS3       DTGFTASEFAFELM-KKGVIVRDCTSFKGLDEYWIRISICTLEEDKKFIDIVK---EVLS
HIS81_ARCFU      SP---VENLAEELL-KRGVIVRDC-SSFVGCGNHIRVTVGRPEENDMFLEALK---EVLG
HIS8_METMA       LK---AKKVTESLL-KKGIIVRPCDSFREAGDSFIRVTVGTPEQNEKVVRAFE---ISKS
HIS8_METAR       LT---SKHVVTEAM-KRGVILRDCASFREMGDRYVRITVGTREQNVRLVEVLA---EIKG
HIS8_FRAP2       -----RESIFNKLI-DNKIVVRSM-AHFFNDEKVLRISIGTVSENKRLIEVLQ---KLSS
HIS8_XYLFA       DD---AEAALQALY-AAGVVVRDQ-RAAPQLHDALRLTVGTPEQNTRLLAVLR---DIQA
HIS8_COLP3       NNIDEKNKVFNLLV-EHNILIRDQ-SKQQQLENCLRISIGSEDEIAQLKQLLE---TL--
HIS8_SHEAM       ND---VEVLARALT-KAGIVARRY--SHPRLKDAIRISYASEQQTDSIIEAIG---RIDS
HIS8_SHEON       DD---VAKVAKLLT-DNGIVARAY--KDPRLAKAIRFSFSSQVDTDRLVSLFE---SQKR
HIS8_BUCCC       AE---SKTIFKYLI-SKGIIVRDQSHNLG-LKNCLRISIGTIHECQELINVLS---IYKG
HIS82_IDILO      ED---AAGLVKSLT-DNDLLIRNQ-SAQRGLENVVRITIGSAAENDELIQQLK---DYFS
HIS8_BUCAI       -----FEKVFETLW-NKGIILRNQ-NEKTNLKKCIRISMGTRSESLRLIKELK---IFSK
HIS8_BUCBP       HD---SKLVFKELW-ENKVIVRDQ-NKKTNLKNCIRISVGTRLECFEVIRILE---RIDR
HIS8_BUCMH       YN---SRKVFDILS-KKGIIVRDQ-SNKLHLSRCLRISIGTSKECLEVVRVIQ---KINS
HIS8_PSEA6       PQ---KSALMSHLV-ASGILIRDQ-SKQINLDNCLRITVGSPEQNKQLLSEIS---RFFT
HIS8_AERHH       VD---GAAVFAAMK-AAGIILRDF-STKPGLDNSIRVTIGYQGEMDAVLAVLR---DLPS
HIS8_BLOPB       NP---KYQVFKTLL-HQGIVLRDQ-SNQPGLVNCLRITVGTYNECKHVVSVLK---KLHV
HIS8_PHOPR       TH---ADALFTALW-NHGIILRRS-----PIENCIRISVGNRDECEKTLAFIR---AHVT
HIS81_HAEIN      QN---GQAVFKALW-EQGIILRDQ-NKTLHLQNCIRITVGTRNECEKVVEAIK---EVK-
HIS8_YERPE       TA---SSSVFNALW-DQGIILRDQ-NKQPGLANCLRITIGTRQECERVIAALA---PLPG
HIS8_ECOLI       KA---SSAVFKSLW-DQGIILRDQ-NKQPSLSGCLRITVGTREESQRVIDALR---AEQV
HIS8_VESOH       PN---TNILFDFLK-ENGVLIKNL-SVKKKLINCLRVTIGTEEQNQKFINIVE---KFYI
HIS8_HAHCH       LP---AKSVFSEMK-RRGVLIKLLDGGHPKLAGCLRLTVGSHEENEAMLKALS---GALA
HIS8_NEIMA       PD---ADLLFDTLK-QNRILVKKLHGAHPLLEHCLRITVGSPAQNDAVLNIIR---QLYC
HIS82_NITOC      HQ---AEAIFTAIK-ERGVLIKNLSGQGGLLTDCLRVTVGTADENHAFLKALK---AGRK
HIS81_NITMU      HK---ATQVFQELK-QRGILVKNLDGAHPLLKNCLRVTVGMPDENAQFLEVLQ---TLLV
HIS82_BORBR      LD---GNAVHLALK-TRKILVRNFSNAHPLLADCLRISVGTPTENAAVLSALQ---DILS
HIS8_CHRVO       PD---APALFQHLK-ASGILIKQLHGSHPLLENCLRLTVGSPDENAALLSAIQ---RFFV
HIS8_METPP       PD---AKAAFEGLK-ARGVLVKNVSGLHPLLANCLRLTVGLPEENDQMIAALK---GILS
HIS81_RALSO      PD---AAGLFERLL-KRRVLVKNVSKMHPLLANCLRVTVSNPEENAQFLDAFA---ASLQ
HIS8_HYDS0       ND---ADFIHKSLI-QKGILTRNI-SYLPNLENHIRISIGKKEENDALINALK---EIAQ
HIS8_AQUAE       YP---AHEVYQELL-KRDVLVRNV-SYMEGLQKCLRVSVGKPEENNKFLEALE---ESIK
HIS82_ARCFU      AN---KEGVVEKLA-EKGFIVRDA-SVMGLEGLYIRITVGKREDNDRLIEALR---EI--
HIS8_GLOVI       PRIADPEAVRVALA-GRGSLVRGA-------AGGLRVTVGTPEQNDRLIANVA---ALFT
HIS8_SYNJB       VAGWDPQELQRAWQ-ELGTGVRYT-------GGGLRLTVGTPEENRRALERLR---QILQ
HIS8_THEEB       REPQHTPSLWDALR-DQGTLVRAI-------AGGIRVTIGTPAQMERFWQRLQ---ASLN
HIS8_SYNE7       QSSSQTAALAAQLK-AQGTLVRHT-------ADGLRITIGSPAENERTLAHLQ---TAIT
HIS82_NOSS1      TT---LLNLHQQLK-NSGTLVRQI-------SGGLRITIGTPEENIRTLNHIQ---TALI
HIS8_CYAP4       STEAATAQLGRDLK-ALGTSIRYT-------GGGLRISVGTVAENDRTLERIH---RLLA
HIS8_DEHM1       LLKGKAKDVQQALE-SQGILVRCF--DAPMMENCLRFSVGKPEDTDALLKALG---EMGE
HIS8_ROSCS       GGAARARAIRDTLA-QRGILIRYF--NRPGIDDCIRISVGRPEQNDALLDVLK---EVA-
HIS8_YEAST       GDNVLAKKLYYQLATQSGVVVRFR-GNELGCSGCLRITVGTHEENTHLIKYFK---ETLY
HIS8_CANMA       PSNEVAKQLYNTLATGKSIVVRFR-GSELNCVGGLRISIGTEEENKQLLEQFE---AVLN
HIS8_CYTH3       AD---GKKVYDYLV-EHIVITRDR-SKIILCEGCVRITVGTEAENKRLLDVLK---TY--
HIS8_GRAFK       DH---ANKRYDQFL-EKGIVIRNR-SNQPLCENCLRITIGTKEENKKLIKAFK---ELEN
HIS8_BACTN       TD---AVKIYNYLV-GEGIIVRNR-HSISLCCNCLRVTVGTRVENNTLLAALK---KYQG
HIS8_PARD8       AK---ADAMYNGLV-KKGIVVRNR-SNVQKCRGCLRITIGTPKENDSLLNAMK---NMKL
HIS8_THEGJ       -------NAYEELL-KRGIVVRKL---SGRLEGHIRVTVGRRWENDAFLEAVE---EIAG
HIS8_DESHD       PE--DPDRVYQELI-GKGFLIRTM-GNLPLVGKALRLSTGLPEENERLIKALG---EILK
HIS8_RUMCH       QN---SKDIYRKLC-EKGIFVRAF-SSSPLLSDCMRITIGTQEQNSILLDELY---AICY
HIS81_CARHZ      EK---AKKIHQELI-NHGILVRYL---GGALANYLRITVGTPEENRQLLKKLG---EIL-
HIS8_PELTS       MP---AGEVYGGLL-ERGVLVRNV-DG-PGLSRCLRVAVGTAEENRLFIEKLG---EVLG
HIS8_THEP3       KD---ADYVYQGLL-ERGILVRDF-SKVEGLEGALRITVSSCEANDYLINGLK---ELLL
HIS8_CLOK5       KD---AEFVYKYLL-ENKIVVRNY--KQGRLKDFLRITVGSREENEAVINNLS---KILK
HIS8_CLONN       EN---ANEINESLI-KIGIKVRSF--TDENLKNFIRITVGSREQNIEVINCIKGDNYDYK
                                                    *                        

HIS83_RHILO      ILNMSTPPR--------------------
HIS8_STRGC       S----------------------------
HIS8_LACLA       KNEEIDEWKK-------------------
HIS8_SYNAS       -----------------------------
HIS81_OCEIH      PSP--------------------------
HIS8_BRAHW       N----------------------------
HIS8_CLOB8       NNQKEL-----------------------
HIS8_CLOB6       KL---------------------------
HIS8_CHRSD       -----------------------------
HIS8_ACEPA       SNSL-------------------------
HIS8_MARMS       -----------------------------
HIS82_PSYA2      VADVEAS----------------------
HIS8_ACIB5       -----------------------------
HIS81_METCA      GQAAA------------------------
HIS8_SYNY3       SLG--------------------------
HIS8_RHOBA       SLNISLPARADST----------------
HIS8_GEOBB       GR---------------------------
HIS81_NOSS1      SRD--------------------------
HIS8_DEIRA       -----------------------------
HIS81_LEGPL      DVAGLNYEKDFIY----------------
HIS8_SACS2       NSNSK------------------------
HIS8_CHLCH       EVKG-------------------------
HIS8_BIFAA       IVEQG------------------------
HIS8_CUTAK       TAPRLVPEEDQ------------------
HIS8_MYCA1       TELAPVNVGAIASAAEPRAAGRDHVLGAP
HIS83_BURL3      LE---------------------------
HIS8_PAEAT       GTAPHRA----------------------
HIS8_FRACC       GSVIGADGVISLATA--------------
HIS82_CAUVC      L----------------------------
HIS81_GLUOX      PSHSSAA----------------------
HIS81_RHILO      -----------------------------
HIS83_RHIME      VG---------------------------
HIS8_LEUMM       K----------------------------
HIS8_LACF3       QQA--------------------------
HIS8_LACPL       -----------------------------
HIS8_HALSA       T----------------------------
HIS8_HALWD       DVETATTTTESGVETEVGRP---------
HIS8_DESAG       G----------------------------
HIS8_LEPIN       -----------------------------
HIS8_HELHP       IHN--------------------------
HIS8_NITSB       EY---------------------------
HIS8_ARCB4       NL---------------------------
HIS8_CAMHC       -----------------------------
HIS8_CAMFF       -----------------------------
HIS8_RUBXD       -----------------------------
HIS82_LEGPL      -----------------------------
HIS8_PELUB       -----------------------------
HIS8_HYPNA       SR---------------------------
HIS8_ZYMMO       QAL--------------------------
HIS8_NOVAD       AAR--------------------------
HIS8_JANSC       A----------------------------
HIS8_PARDP       ERAESR-----------------------
HIS81_CAUVC      R----------------------------
HIS8_ACICJ       NHG--------------------------
HIS8_GRABC       QAPADSDAAS-------------------
HIS8_RHOCS       G----------------------------
HIS8_RHORT       GEGR-------------------------
HIS8_MAGSA       A----------------------------
HIS8_MARMM       A----------------------------
HIS8_XANP2       GNSSAGQEAGGKDK---------------
HIS8_BDEBA       EITPL------------------------
HIS8_METI4       SFKNNRPQ---------------------
HIS8_DESPS       ELNYV------------------------
HIS8_ALKOO       KGTCCCG----------------------
HIS81_PSYA2      DD---------------------------
HIS8_AKKM8       -----------------------------
HIS82_HYDCU      SSNFK------------------------
HIS82_HAEIN      FA---------------------------
HIS81_IDILO      -----------------------------
HIS81_NITOC      EFR--------------------------
HIS81_CUPPJ      -----------------------------
HIS82_METCA      P----------------------------
HIS82_PSEF5      RA---------------------------
HIS81_THIDA      AAPGRHPDSRKALP---------------
HIS82_NITMU      TTEGAAADTIPEMAVSFPKVASGGTA---
HIS8_ANADF       A----------------------------
HIS8_SYMTH       EG---------------------------
HIS82_CARHZ      IL---------------------------
HIS8_CALS8       -----------------------------
HIS8_MOOTA       -----------------------------
HIS8_STACT       EA---------------------------
HIS8_MACCJ       -----------------------------
HIS82_OCEIH      ELG--------------------------
HIS8_LISIN       -----------------------------
HIS8_LYSSC       EQGVFA-----------------------
HIS8_BACSK       QLRASLGA---------------------
HIS82_BACAN      NKKRKSRDEANA-----------------
HIS81_BACAN      EQVQKEETYS-------------------
HIS8_BACHD       EELTTQHLS--------------------
HIS8_ANOFW       ERRDSFCKETF------------------
HIS8_BREBN       GALK-------------------------
HIS8_THEMA       -----------------------------
HIS8_METLZ       -----------------------------
HIS8_METMJ       -----------------------------
HIS8_METJA       -----------------------------
HIS8_METKA       V----------------------------
HIS8_METST       N----------------------------
HIS8_METTH       -----------------------------
HIS8_METS3       -----------------------------
HIS81_ARCFU      C----------------------------
HIS8_METMA       EV---------------------------
HIS8_METAR       SR---------------------------
HIS8_FRAP2       EYETK------------------------
HIS8_XYLFA       VPA--------------------------
HIS8_COLP3       -----------------------------
HIS8_SHEAM       K----------------------------
HIS8_SHEON       -----------------------------
HIS8_BUCCC       KI---------------------------
HIS82_IDILO      -----------------------------
HIS8_BUCAI       KNMCQGEMSEK------------------
HIS8_BUCBP       --LYKNVRR--------------------
HIS8_BUCMH       LCVY-------------------------
HIS8_PSEA6       LQTSTQEA---------------------
HIS8_AERHH       PSF--------------------------
HIS8_BLOPB       ASLSI------------------------
HIS8_PHOPR       SQGNSSQDSASKSNSSANNDELNASN---
HIS81_HAEIN      -----------------------------
HIS8_YERPE       IDNSNNIDNQNKTYSQTSSIRKGTI----
HIS8_ECOLI       -----------------------------
HIS8_VESOH       L----------------------------
HIS8_HAHCH       AVRG-------------------------
HIS8_NEIMA       QPTDFL-----------------------
HIS82_NITOC      N----------------------------
HIS81_NITMU      KVEAKA-----------------------
HIS82_BORBR      A----------------------------
HIS8_CHRVO       -----------------------------
HIS8_METPP       -----------------------------
HIS81_RALSO      DTP--------------------------
HIS8_HYDS0       QVYL-------------------------
HIS8_AQUAE       SLSSSL-----------------------
HIS82_ARCFU      -----------------------------
HIS8_GLOVI       PEMR-------------------------
HIS8_SYNJB       -----------------------------
HIS8_THEEB       QQKSTDN----------------------
HIS8_SYNE7       QSLPATV----------------------
HIS82_NOSS1      KPELVG-----------------------
HIS8_CYAP4       K----------------------------
HIS8_DEHM1       -----------------------------
HIS8_ROSCS       -----------------------------
HIS8_YEAST       KLANE------------------------
HIS8_CANMA       DINQ-------------------------
HIS8_CYTH3       -----------------------------
HIS8_GRAFK       E----------------------------
HIS8_BACTN       -----------------------------
HIS8_PARD8       -----------------------------
HIS8_THEGJ       GESVGGL----------------------
HIS8_DESHD       -----------------------------
HIS8_RUMCH       NK---------------------------
HIS81_CARHZ      -----------------------------
HIS8_PELTS       RPA--------------------------
HIS8_THEP3       -----------------------------
HIS8_CLOK5       -----------------------------
HIS8_CLONN       EM---------------------------