CLUSTAL format seed alignment for MF_01025

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

LEU1_CROS5       ----------MSNQPDHIIIFDTTLRDGEQSPGASLTVEEKLTIARALARLGVDIIEAGF
LEU1_RIPO1       ----------MSNQPDRIIIFDTTLRDGEQSPGASLTVEEKLTIARSLARLGVDIIEAGF
LEU1_GLOC7       ----------MSNQPNRIIIFDTTLRDGEQSPGATLNGDEKLTVARALARLGVDVIEAGF
LEU1_NOSS1       ----------MTTKPEKIIIFDTTLRDGEQCPGATLNIDEKLAIAKQLARLGVDIIEAGF
LEU1_MICAE       ----------MNTSPDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGF
LEU1_MICAN       ----------MNTSPDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGF
LEU1_SYNY3       ----------MNSPVDRILIFDTTLRDGEQSPGATLTVEEKLSIARALARLGVDIIEAGF
LEU1_SYNP2       ----------MNNQDDRIIIFDTTLRDGEQSPGATLNGDEKLAIARALARLGVDVIEAGF
LEU1_TRIEI       ----------MITSQDRVIIFDTTLRDGEQSPGATLNIDEKLTIARQLSLLGVDVIEAGF
LEU1_THEEB       -----MRIKYPPQTVDRVLIFDTTLRDGEQSPGASLNVDEKLTIARQLARLGVDIIEAGF
LEU1_PROM0       ----------MSKNPGRILIFDTTLRDGEQSPGASLNLEEKLAIAHQLARLGVDVIEAGF
LEU1_PROMS       ----------MSKDPGRILIFDTTLRDGEQSPGASLNLEEKLAIAHQLARLGVDVIEAGF
LEU1_PROM9       ----------MSKDPGRILIFDTTLRDGEQSPGASLNLEEKLAIAHQLARLGVDVIEAGF
LEU1_PROM2       ----------MSKDPGRILIFDTTLRDGEQSPGASLNLEEKLAIAHQLARLGVDVIEAGF
LEU1_PROM5       ----------MSKDPGRILIFDTTLRDGEQSPGASLNLEEKLAIAHQLARLGVDVIEAGF
LEU1_PROMP       ----------MSKDPGRILIFDTTLRDGEQSPGASLNLEEKLAIAHQLARLGVDVIEAGF
LEU1_PROM4       ----------MAKDPGRVLIFDTTLRDGEQSPGASLNLEEKLAIAQQLARLGVDIIEAGF
LEU1_PROMA       ----------MAKDPGRVLIFDTTLRDGEQSPGASLNLEEKLAIAQQLARLGVDIIEAGF
LEU1_PROMT       ----------MAKDPGRVLIFDTTLRDGEQSPGASLNLEEKLAIAQQLARLGVDVIEAGF
LEU1_SYNS9       ----------MAKDPGRVLIFDTTLRDGEQSPGASLNLEEKLAIAQQLARLGVDVIEAGF
LEU1_SYNSC       ----------MAKDPGRVLIFDTTLRDGEQSPGASLNLEEKLAIAQQLARLGVDVIEAGF
LEU1_SYNPX       ----------MAKDPGRVLIFDTTLRDGEQSPGASLNLEEKLAIAQQLARLGVDVIEAGF
LEU1_PROMM       ----------MAKDPGRVLIFDTTLRDGEQSPGASLNLEEKLAIAQQLARLGVDVIEAGF
LEU1_SYNPW       ----------MAHDPGRVLIFDTTLRDGEQSPGASLNLEEKLAIAQQLARLGVDVIEAGF
LEU1_SYNS3       ----------MAKDPGRVLIFDTTLRDGEQSPGASLNLEEKLAIAQQLARLGVDVIEAGF
LEU1_SYNR3       ----------MARDPGRVLIFDTTLRDGEQSPGASLNLDEKLAIAQQLARLRVDIIEAGF
LEU1_GLOVI       ------------MFQDRLIIFDTTLRDGEQSPGATLNADEKVEIARQLARLGVDVIEAGF
LEU1_HUNT2       --------------MRRIRIFDTTLRDGEQTPGVNLNIQEKVDIAKQLARLGVDVIEPGF
LEU1_UNCTG       ------------MEKDIIIFFDTTLRDGEQSPGASMNLKEKLLVANQLAALGVDVIEAGF
LEU1_DESRM       -------------MNNRVHIFDTTLRDGEQSPGVSLNLNEKLQIARQLARLGVDIIEAGF
LEU1_PELTS       -------------MSQRVYIFDTTLRDGEQSPGVSLNVGEKVQIARQLAKLGVDIIEAGF
LEU1_DESAP       -------------MSERVYIFDTTLRDGEQSPGVSLNIREKLQIAHQLVKLNVDVIEAGF
LEU1_CARHZ       --------------MERVRIFDTTLRDGEQSPGVSLNAMEKLQIARQLQKLGVDVIEAGF
LEU1_HELMI       -------------MSKRVVIFDTTLRDGEQSPGVSLNLHEKLEIAQQLARLGVDVIEAGF
LEU1_CLOK5       -------------MTKKIYIFDTTLRDGEQTPKVSLNINDKITIAKQLQKLSVDVIEAGF
LEU1_RUMCH       -------------MARTIKIFDTTLRDGEQTPGVNLNLQEKLEIAKQLVRLGVDVIEGGF
LEU1_HALOH       --------------MGEVKIFDTTLRDGEQSPGVSLIPEEKLAIAKQLARMKVDVIEAGF
LEU1_DICT6       --------------MTKLYIFDTTLRDGEQTPGVNLNKEEKLEIAKQLAKLNVDIIEAGF
LEU1_DICTD       --------------MGKLYIFDTTLRDGEQTPGVNLNKEEKLEIAKQLAKLNVDIIEAGF
LEU1_PYRAB       --------------MRKVYIFDTTLRDGEQTPGVSLTVEEKVEIAKQLAKLNVDVIEAGF
LEU1_PYRFU       -------------MARKIKIFDTTLRDGEQTPGVSLTVEEKIEIAKQLARLNVDVIEAGF
LEU1_STRM5       ------MTTIERITTPRIRIFDTTLRDGEQSPGCSMSPPQKLVMARALDELGVDIIETGF
LEU1_STRMK       ------MTTIERITTPRIRIFDTTLRDGEQSPGCSMSPPQKLVMARALDELGVDIIETGF
LEU1_XANOR       ------MNTTISNQTPHIRIFDTTLRDGEQSPGCSMTPQQKLVMARALDALGVDIIETGF
LEU1_XANCP       ------MNTTVSNQTPHIRIFDTTLRDGEQSPGCSMTPQQKLVMARALDALGVDIIETGF
LEU1_XYLFA       ------MNTSISSQPPRIRIFDTTLRDGEQSPGCSMPAQQKLVMARALDALGVDIIETGF
LEU1_ACIFD       --------MDEVGTQERIRIFDTTLRDGEQAPGISLDPLEKLEIAEQLARLGVDIIEAGF
LEU1_SALRM       -------------MSDSITIFDTTLRDGEQAPGASMTVPEKVHIAHKLADLNVDVIEAGF
LEU1_LEPIN       -----------MDLKDYVRIFDTTLRDGEQCPGAAMTENEKLEIASQLATMKVDIIEAGF
LEU1_DEIRA       --MAMTQTENQTAPQQHIRIFDTTLRDGEQSPGVALNHAQKLEIAHTLARMGVDVIEAGF
LEU1_CUPNH       -------------MSDKLIIFDTTLRDGEQSPGASMTREEKIRIARQLERLKVDVIEAGF
LEU1_CUPPJ       -------------MSDKLIIFDTTLRDGEQSPGASMTREEKIRIAKQLERLKVDVIEAGF
LEU1_CUPMC       -------------MSDKLIIFDTTLRDGEQSPGASMTREEKIRIARQLERLKVDVIEAGF
LEU11_RALSO      -------------MSDKLIIFDTTLRDGEQSPGASMTKEEKIRIAKQLERLKVDVIEAGF
LEU1_BURCM       -------------MTDKLIIFDTTLRDGEQSPGASMTKEEKIRIAKHLERMKVDVIEAGF
LEU1_BURVG       -------------MTDKLIIFDTTLRDGEQSPGASMTKEEKIRIAKHLERMKVDVIEAGF
LEU1_BURL3       -------------MTDKLIIFDTTLRDGEQSPGASMTKEEKIRIAKHLERMKVDVIEAGF
LEU1_BURM1       -------------MTDKLIIFDTTLRDGEQSPGASMTKEEKIRIAKHLERMKVDVIEAGF
LEU1_BURP6       -------------MTDKLIIFDTTLRDGEQSPGASMTKEEKIRIAKQLERMKVDVIEAGF
LEU1_PARP8       -------------MADKLIIFDTTLRDGEQSPGASMTKEEKIRIAKQLERMKVDVIEAGF
LEU1_POLNS       -------------MSDKVIIFDTTLRDGEQSPGASMTKDEKVRIARQLERLKVDVIEAGF
LEU1_POLAQ       -------------MSDKVIIFDTTLRDGEQSPGASMTKDEKVRIARQLERLKVDVIEAGF
LEU1_ACISJ       -------------MTDKLIIFDTTLRDGEQSPGASMTRDEKLRIARQLERLRVDVIEAGF
LEU1_ACIAC       -------------MSDKLIIFDTTLRDGEQSPGASMTRDEKLRIARQLERLRVDVIEAGF
LEU1_POLNA       -------------MTDKLIIFDTTLRDGEQSPGASMTRDEKLRIARQLERLKVDVIEAGF
LEU1_POLSJ       -------------MTDKLIIFDTTLRDGEQSPGASMTKDEKLRIARQLERLKVDVIEAGF
LEU1_VARPS       -------------MTDQLIIFDTTLRDGEQSPGASMTRDEKMRIAKQLERLKVDVIEAGF
LEU1_RHOFT       -------------MADQLIIFDTTLRDGEQSPGASMNKDEKLRIARQLERLKVDVIEAGF
LEU1_VEREI       -------------MADKLIIFDTTLRDGEQSPGASMTKDEKLRIARQLERLKVDVIEAGF
LEU1_LEPCP       -------------MSDQLIIFDTTLRDGEQSPGASMTRDEKLRIARQLERLKVDVIEAGF
LEU1_METPP       -------------MADKLIIFDTTLRDGEQSPGASMTKDEKLRIARQLERLRVDVIEAGF
LEU1_CHRVO       -------------MGDRLYIFDTTLRDGEQSPGASMSKEEKIRIARQLERLGVDIIEAGF
LEU1_THIDA       -------------MNDRLFIFDTTLRDGEQSPGASMTKDEKLRIARQLEKLGVDVIEAGF
LEU1_NEIMB       -----------MTQTNRVIIFDTTLRDGEQSPGAAMTKEEKIRVARQLEKLGVDIIEAGF
LEU1_NEIG1       -----------MTQANRVIIFDTTLRDGEQSPGAAMTKEEKIRVARQLEKLGADIIEAGF
LEU1_AROAE       -------------MKDHLIVFDTTLRDGEQSPGASMTRDEKLRIARQLERMRVDVIEAGF
LEU1_DECAR       -------------MKQHLVIFDTTLRDGEQSPGASMTKEEKIRVARQLEKMRVDVIEAGF
LEU1_NITEC       -------------MKERLVIFDTTLRDGEQSPGASMTMEEKVRIARQLERMGVDVIEAGF
LEU1_NITEU       -------------MKEHLVIFDTTLRDGEQSPGASMTMEEKVRIARQLERMGVDVIEAGF
LEU1_NITMU       -------------MKDHLIIFDTTLRDGEQSPGASMTREEKVRIARQLERMRVDVIEAGF
LEU1_METCA       -------------MHDRLIIFDTTLRDGEQSPGASMTRDEKVRIARALERLKVDVIEAGF
LEU1_NITOC       -------------MKDKLIVFDTTLRDGEQSPGASMTREEKVRIAKALERMRVDVIEAGF
LEU1_RUTMC       -------------MPNKLIIFDTTLRDGEQSPGASMTRDEKVRIAKVLEKMQVDVIEAGF
LEU1_VESOH       -------------MTNKLIIFDTTLRDGEQSPGASMTKDEKIRIAKVLEKMKVDVIEAGF
LEU11_HYDCU      -------------MKEELVIFDTTLRDGEQSPGASMTKEEKVRIAKQLEKLRVNVIEAGF
LEU1_BRASB       ------MSSTTPSDKDRVVIFDTTLRDGEQCPGATMTFEEKLNIAAMLDGMGVDVIEAGF
LEU1_BRASO       ------MSNPVQSDKDRVVIFDTTLRDGEQCPGATMTFEEKLNIAAMLDDMGVDIIEAGF
LEU1_RHOP5       ------MTAPHTSANDRVIIFDTTLRDGEQCPGATMTFEEKLEVASLLDSMGVDVIEAGF
LEU1_RHOPB       ------MTATTPSDKDRVIIFDTTLRDGEQCPGATMTFEEKLEVASLLDAMGVDVIEAGF
LEU1_RHOPT       ------MTTTTQSEQDRVIIFDTTLRDGEQCPGATMTFEEKLNVARMLDDMGVDVIEAGY
LEU1_RHOP2       ------MTTTPKSEQDRVIIFDTTLRDGEQCPGATMTFEEKLNVARMLDDMGVDVIEAGY
LEU1_RHOPS       ------MTTTPKSEQDRVIIFDTTLRDGEQCPGATMTFEEKLNVAAMLDEMGVDVIEAGY
LEU1_BRADU       ------MAPVNKSDKDRVIIFDTTLRDGEQCPGATMTFEEKLEVAELLDDMGVDVIEAGF
LEU1_METNO       ------MTETAASSAERVLIFDTTLRDGEQCPGATMTFEEKLAVAEMLDGMGVDIIEAGF
LEU1_METPB       ------MANTTESAKDRVVIFDTTLRDGEQCPGATMTLDEKLAVAELLDAMGVDIIEAGF
LEU1_NITHX       ------MTSANKSDKDRVVIFDTTLRDGEQCPGATMTFEEKLEVAEMLDDMGIDIIEAGF
LEU1_NITWN       ------MTPANKSDKDRVVIFDTTLRDGEQCPGATMTFEEKIEVAEMLDGMGVDIIEAGF
LEU1_OLICO       ------MTSPSTSDKDRVVIFDTTLRDGEQCPGATMTHEEKLEVAEMLDTMGVDIIEAGF
LEU1_CAUVN       ---MTSVPAGAISKRDNVVVFDTTMRDGEQSPGASMSLEEKLELAKILEEMGVDVIEAGF
LEU1_CAUSK       ---MTPVTPAAFEKRDNVVIFDTTMRDGEQSPGASMSHDEKLELAKILEEMGVDVIEAGF
LEU1_DESMR       -----------MSDDNRVYIFDTTLRDGEQSPGATMTREEKVRMARQLETLGVDIIEAGF
LEU1_DESVM       ----------MTIESGRIRIFDTTLRDGEQSPGATMNLQEKIRLARQLETLGVDIMEAGF
LEU1_SYNAS       ----------MDSPEKRIYIFDTTLRDGEQSPGSSMNPAEKLRIARQLEKMGVDIIEAGF
LEU1_NITSB       -------------MAEIVKIFDTTLRDGEQSPGASMNTEEKIQIAKQLEKLGVDVIEAGF
LEU1_WOLSU       ------------MSAEMIKIFDTTLRDGEQSPGASMNTEEKIRIAKQLERLGVDVIEAGF
LEU1_ARCB4       ------------MDKNKIIVFDTTLRDGEQSPGCSMNTEEKIKVALQLEKLGVDVIEAGF
LEU1_CAMFF       ------------MDNNKIIVFDTTLRDGEQSPGASMNTEEKIQIALQLERLGVDVMEAGF
LEU1_CAMC1       ------------MDKNKIIIFDTTLRDGEQSPGASMNTAEKLQIALQLERLGVDVMEAGF
LEU1_CAMHC       ------------MNKNKIIVFDTTLRDGEQSPGASMNTAEKVELAIQLEKLGVDVIEAGF
LEU1_AQUAE       -------------MGEKVYIFDTTLRDGEQAPGFSMTTEEKLQMAHQLAKLNVDIIEAGF
LEU1_METI4       ----------MEMTANRLIVFDTTLRDGEQCPGASMTSRQKLEVAKQLARLGVDVIEAGF
LEU1_RHOBA       MNQSAEAPSSENVATRQIRIFDTTLRDGEQSPGASMNLAEKLEVASALVDLGVDIIEAGF
LEU1_BACVZ       --------------MRKINVFDTTLRDGEQSPGVNLNSREKLAIAKQLERLGVDIIEAGF
LEU1_BACSU       --------------MRKINFFDTTLRDGEQSPGVNLNTQEKLAIAKQLERLGADIIEAGF
LEU1_BACLD       --------------MRKINFFDTTLRDGEQSPGVNLNTQEKLAIAQQLEKLGVNIMEAGF
LEU11_BACP2      --------------MRKINFFDTTLRDGEQSPGVNLNAQEKLIIAKQLERLGVNIIEAGF
LEU1_GEOKA       --------------MRKIKFFDTTLRDGEQSAGVNLNLQEKLEIARQLERLRVDIIEAGF
LEU1_GEOSE       --------------MRNIKFFDTTLRDGEQSAGVNLNLQEKLEIARQLERLRVDIIEAGF
LEU1_GEOTN       --------------MRKIKFFDTTLRDGEQSAGVNLNLQEKLEIARQLERLQVDIIEAGF
LEU1_GEOSW       --------------MRKINIFDTTLRDGEQSAGINLNLQEKLEIARQLERLGVDIIEAGF
LEU1_ANOFW       --------------MRKINIFDTTLRDGEQSAGVNLNLHEKLEIARQLERLGVDIIEAGF
LEU1_BACHD       --------------MRKISVFDTTLRDGEQSAGVNLNFEEKMEIAKQLERLGVDIIEAGF
LEU1_BACSK       --------------MRKINVFDTSLRDGEQMPGIALTVKEKLEIARQLERLGVDIIEAGF
LEU1_LYSSC       --------------MRKIDIFDTTLRDGEQSAGINLNTAEKIEIAKQLERLGVTIIEAGF
LEU1_OCEIH       --------------MSRIKIFDTTLRDGEQSPGVNLNKAEKLEIAKQLEKYGVDRMEAGF
LEU1_BACCQ       --------------MKQILFMDTTLRDGEQSPGVNLNEQEKLQIARQLERLGIHVMEAGF
LEU1_BACMK       --------------MKQILFMDTTLRDGEQSPGVNLNEQEKLQIARQLERLGINVMEAGF
LEU1_BACCN       --------------MKQILFMDTTLRDGEQSPGVNLNEQEKLQIARQLEKLGIDVMEAGF
LEU1_LACLA       --------------MRKIEFFDTSLRDGEQTPGVSFSISEKVTIAKQLEKWRISVIEAGF
LEU1_LACLS       --------------MRKIEFFDTSLRDGEQTPGVIFSIAEKVTIAKQLEKWGISVIEAGF
LEU1_STRG3       --------------MRKVEFLDTTLRDGEQTPGVNFSIKEKVAIAKQLEKWGIASIEAGF
LEU1_STAAR       -------------MSSHIQIFDTTLRDGEQTPGVNFTFDERLRIALQLEKWGVDVIEAGF
LEU1_STAHJ       -------------MESHIQIFDTTLRDGEQTPGVNFSFDERLKIAKQLETWGVDILEAGF
LEU1_STAES       -------------MEEHIQIFDTTLRDGEQTPGVNFTFDERLKIAKQLEKWGVDVLEAGF
LEU1_STAS1       -------------MSSHIQIFDTTLRDGEQTPGVNFSFDERLKIAKQLEKWGVDIIEAGF
LEU1_STACT       --------------MSHIQVFDTTLRDGEQTPGVSFSFDERLTIAKQLEKWGVDVIEAGF
LEU1_LISMO       --------------MKKIQFFDTTLRDGEQTPGVNFDVKEKIQIALQLEKLGIDVIEAGF
LEU1_LISIN       --------------MKKIQFFDTTLRDGEQTPGVNFDVKEKIQIALQLEKLGIDVIEAGF
LEU1_LISMH       --------------MKKIQFFDTTLRDGEQTPGVNFDVKEKIQIALQLEKLGIDVIEAGF
LEU1_LISW6       --------------MKKIQFFDTTLRDGEQTPGVNFDVKEKIQIALQLEKLGIDVIEAGF
LEU1_BREBN       --------------MRTIEIFDTTLRDGEQSPGVNISTNEKVEIALQLEKLGVNRMEAGF
LEU1_THEP1       --------------MRRIKIFDTTLRDGEQSPGASMSVEEKVEMALMLEDLGVDLIEAGF
LEU1_THENN       --------------MRRIKIFDTTLRDGEQSPGASMSVEEKVEMALMLEDLGVDLIEAGF
LEU1_SEDSS       -------------MPRRIKIFDTTLRDGEQSPGASMSLEQKIKMASALERLGVDRIEAGF
LEU1_GEOS4       -------------MERNIIVLDTTLRDGEQVPGAKLNVQQKIEFAQQLKRLNVDIIEAGF
LEU1_KLEP3       -------------MSQQVIIFDTTLRDGEQALQASLSVKEKLQIALALERMGVDVMEVGF
LEU1_ENT38       -------------MSQQVVIFDTTLRDGEQALQASLSVKEKLQIALALERMGVDVMEVGF
LEU1_SALNS       -------------MSQQVIIFDTTLRDGEQALQASLSAKEKLQIALALERMGVDVMEVGF
LEU1_SALAR       -------------MSQQVIIFDTTLRDGEQALQASLSAKEKLQIALALERMGVDVMEVGF
LEU1_CITK8       -------------MSQQVIIFDTTLRDGEQALQASLSVKEKLQIALALERMGVDVMEVGF
LEU1_CROS8       -------------MSQQVIIFDTTLRDGEQALQASLSVKEKLQIALALERMGVDVMEVGF
LEU1_ECOLI       -------------MSQQVIIFDTTLRDGEQALQASLSVKEKLQIALALERMGVDVMEVGF
LEU1_ERWT9       -------------MSQQVIIFDTTLRDGEQALQASLSVKEKLQIALALERMGVDVMEVGF
LEU1_YERPS       -------------MSQQVIIFDTTLRDGEQALQASLSVKEKLQIALALERMGVDIMEVGF
LEU1_YERE8       -------------MSQQVIIFDTTLRDGEQALQASLSVKEKLQIALALERMGVDVMEVGF
LEU1_SERP5       -------------MSQQVIIFDTTLRDGEQALQASLSVKEKIQIAMALERMGVDVMEVGF
LEU1_PECCP       -------------MSEQVIIFDTTLRDGEQALQASLSVKEKLQIAFALERMGVDVMEVGF
LEU1_SODGM       -------------MSQQVIIFDTTLRDGEQALQASLSVKEKLQVAQALERMGVDVMEVGF
LEU1_EDWI9       -------------MKQQVIIFDTTLRDGEQALQASLSVKEKLQIALALERMGVDVMEVGF
LEU1_PHOLL       -------------MNQQVIIFDTTLRDGEQALQASLCVNEKLQIALALERMGVDIMEVGF
LEU1_PROMH       -------------MSNNVIIFDTTLRDGEQALQASLSVKEKLQIAYALERLGVDIIEAGF
LEU1_BLOPB       -------------MSQQVIIFDTTLRDGEQALQASLNVKEKLQIAFALERLGVDIMEVGF
LEU1_BLOFL       -------------MHQQVIIFDTTLRDGEQSLQTSLSVKEKLQIAFALEKLGVDVMEVGF
LEU1_BUCAI       -------------MKSKVVIFDTTLRDGEQALQASLSVKEKLQIALSLEKCGIDILEIGF
LEU1_BUCDN       -------------MSSKVIIFDTTLRDGEQALQASLSVKEKLQIALSLEKCGIDIIEVGF
LEU1_BUCAP       -------------MNSQVIIFDTTLRDGEQALQASLSVKQKLQIALSLENAGIDIIEVGF
LEU1_BUCRP       -------------MNSQVIIFDTTLRDGEQALQASLSVKQKLQIALSLENTGIDIIEVGF
LEU1_BUCUN       --------------------------DGEQALQASLSVKEKLQIALCLEKAGVDIMEVGF
LEU1_BUCUM       --------------------------DGEQALQASLSVKEKLQIALCLEKSGVDIMEVGF
LEU1_BUCUE       --------------------------DGEQALQASLSVEEKLXIALCLEKTGVDIMEVGF
LEU1_BUCML       --------------------------DGEQALQASLSVKEKLQIALCLEKIGVDIMEIGF
LEU1_BUCCC       -------------MNEKIIIFDTTLRDGEQALLTSLTSNEKIQIALALERLGVDVIEVGF
LEU1_AERHH       -------------MSDRVIIFDTTLRDGEQALAASLTVKEKLQIAQALERLGVDVMEVGF
LEU1_AERS4       -------------MSDRVIIFDTTLRDGEQALAASLTVKEKLQIAQALERLGVDIMEVGF
LEU1_TOLAT       -------------MSDRVIIFDTTLRDGEQALPASLTVREKLQIALALERLGVDVMEVGF
LEU1_SHESR       -------------MSNRVIIFDTTLRDGEQALAASLSVKEKLQIAMALERLGVDVMEVGF
LEU1_SHEON       -------------MSNRVIIFDTTLRDGEQALAASLSVKEKLQIAMALERLGVDVMEVGF
LEU1_SHEB8       -------------MSNRVIIFDTTLRDGEQALAASLSVKEKLQIAMALERLGVDVMEVGF
LEU1_SHEAM       -------------MSDRVIIFDTTLRDGEQALAASLSVKEKLQVALALERLGVDVMEVGF
LEU1_SHEFN       -------------MSNRVIIFDTTLRDGEQALAASLTVKEKLQIALALERLGVDVMEVGF
LEU1_SHEHH       -------------MSNRVIIFDTTLRDGEQALAASLTVKEKLQIALALERLGVDVMEVGF
LEU1_SHEPA       -------------MSNRVIIFDTTLRDGEQALAASLTVKEKLQIALALERLGVDVMEVGF
LEU1_SHEPW       -------------MSDRVIIFDTTLRDGEQALAASLTVKEKLQIALALERLGVDVMEVGF
LEU1_SHESH       -------------MSNRVIIFDTTLRDGEQALAASLTVKEKLQIALSLERLGVDVMEVGF
LEU1_SHEWM       -------------MSNRVIIFDTTLRDGEQALAASLTVKEKLQIALSLERLGVDVMEVGF
LEU1_SHELP       -------------MSNRVIIFDTTLRDGEQALAASLTVKEKLQIALSLERLGVDVMEVGF
LEU1_SHEDO       -------------MPNRVIIFDTTLRDGEQALAASLSVKEKLQIALALERLGVDVMEVGF
LEU1_PSYIN       -------------MSDQVIIFDTTLRDGEQALSASLTVKEKLQIAFALERLGVDVMEVGF
LEU1_ALIFM       -------------MSDQVIIFDTTLRDGEQALSASLTVKEKLQIAYALERLGVDVIEAGF
LEU1_ALISL       -------------MSDQVIIFDTTLRDGEQALSASLTVKEKLQIAFALERLGVDVIEAGF
LEU1_VIBCM       -------------MNNQVIIFDTTLRDGEQALSASLTVKEKLQIAYALERLGVDIIEAGF
LEU1_VIBVU       -------------MNDQVIIFDTTLRDGEQALSASLTVKEKLQIAYALERLGVDVIEAGF
LEU1_VIBPA       -------------MNDQVIIFDTTLRDGEQALSASLTVKEKLQIAYALERLGVDVIEAGF
LEU1_VIBTL       -------------MNDQVIIFDTTLRDGEQALAASLTVKEKLQIAYALERLGVDVIEAGF
LEU1_PHOPR       -------------MKDQVIIFDTTLRDGEQALSASLTVKEKLQIAYALERLGVDVIEAGF
LEU1_HISS2       -------------MQNNIIIFDTTLRDGEQALKASLTVKEKLQIALALERLGVDVMEVGF
LEU1_PASMU       -------------MADNIIIFDTTLRDGEQALKASLTVKEKLQIAFALERLGVDVMEVGF
LEU1_HAEIE       -------------MTDRVIIFDTTLRDGEQALKASLTVKEKLQIALALERLGVDVMEVGF
LEU1_PSEA6       -------------MSNQVKIFDTTLRDGEQALAASLSMKEKLQIALALERLGVDIIEAGF
LEU1_CAMJD       ------------MKNNKIIIFDTTLRDGEQALGSSLGINQKLQIALALENLGVDVIEAGF
LEU1_OLSUV       -------------MTRKIDIFDTTLRDGEQSPGASMNTEEKLIVAQQLLRMHVDVIEAGF
LEU1_PARD8       -------------MSDRLFIFDTTLRDGEQVPGCQLNTVEKIQVAKALEQLGVDVIEAGF
                                           ****     :   ::: .*  *       :* *:

LEU1_CROS5       PYASPGDFEAVQKIAKTVGNE-SGPRICGLARATKNDIKAAGEALKPAFKS--RIHTFIA
LEU1_RIPO1       PYASPGDFEAVQKIAQTVGTE-DGPRICGLARATQKDIQTAAEAVKPAAKG--RIHTFLA
LEU1_GLOC7       PYASPGDFEAVQQIAKVVGVE-GGPSICGLARATKADIAKAAEALKPAAKP--RIHTFLA
LEU1_NOSS1       AFASPGDFEAVHKIAQTVGTQ-SGPVICSLARARHDDIKAAAEAIKPAAKG--RIHTFIA
LEU1_MICAE       PHASPGDFEAVQKIAGSVGSEADSPIICGLARATQKDIKSAADALRPAAKP--RIHTFLA
LEU1_MICAN       PHASPGDFDAVQKIAASVGSEADSPIICGLARTTQKDIKSAADALRPAAKP--RIHTFLA
LEU1_SYNY3       PFASPGDFEAVQKIAQTVGTE-NGPVICGLARATQKDIKAAAEALKPAAKH--RIHTFLA
LEU1_SYNP2       PRASRGDFDAVQRIAAEVGTE-NGPTICGLARATKGDIEAAGNALKPAFSN--RIHTFIA
LEU1_TRIEI       PYASIGDFEAVQKIAEIVGVE-GGPTICGLARTTRADIEAAGKALKPAAKA--RIHTFIA
LEU1_THEEB       PFASPGDFEAVQRIAETVGTE-TGPVICGLARATRQDIEAAAKALKPAYYP--RIHTFIA
LEU1_PROM0       PFASPGDFKAVNKIASAVGKE-HGPTICGLARASKGDIKACYEAVSPAPKK--RIHTFIA
LEU1_PROMS       PFASPGDFKAVNKIANAVGKE-NGPIICGLARASKGDIKACYEAVSPAPKK--RIHTFIA
LEU1_PROM9       PFASPGDFKAVNKISNDVGKE-NGPIICGLARASKGDIKACYEAVSPAPKK--RIHTFIA
LEU1_PROM2       PFASPGDFKAVNKIANSVGKE-NGPIICGLARASKGDIKACYEAVSPAPKK--RIHTFIA
LEU1_PROM5       PFASPGDFKAVNKISEVVGGE-NGPIICGLARASTSDIKACYEAIIPAPKK--RIHTFIA
LEU1_PROMP       PFASPGDFKAVNKIAEVVGGE-NGPIICGLARASTNDIKACYEAISPAPKK--RIHTFIA
LEU1_PROM4       PYASQGDFTAVQRIAEQVGGE-EGPIICGLARASKADIKACGEAIAPAPKK--RIHTFIA
LEU1_PROMA       PYASQGDFKAVQRIADQVGGE-EGPIICGLARASKADIKACAEAIAPAPRK--RIHTFIA
LEU1_PROMT       PFASPGDFAAVQKIAENVGGE-EGPIICGLSRASKPDIKACANAIAPAPKK--RIHTFIA
LEU1_SYNS9       PFASAGDFAAVQRIAQQVGGD-NGPIICGLARASKADIKACADAVAPAPRG--RIHTFIA
LEU1_SYNSC       PFASPGDFAAVQRIAQQVGGD-NGPIICGLARASRADIKACADAVAPAPRR--RIHTFIA
LEU1_SYNPX       PFASAGDFAAVQRIAQQVGGE-NGPIICGLARASQRDIKACAEAVSPAPRR--RIHTFIA
LEU1_PROMM       PFASQGDFAAVQRIAQQVGGD-EGPIICGLARASRADIKACADAVAPAPRR--RIHTFIA
LEU1_SYNPW       PFASPGDFNAVQRIAQQVGGE-QGPIICGLARASRGDIKACADAVAPAPRR--RIHTFIA
LEU1_SYNS3       PFASPGDFAAVQRIAQQVGGE-NGPIICGLARASRGDIKACADAVAPAPKQ--RIHTFIA
LEU1_SYNR3       PFASPGDFDAVQTIARQVGRP-DGPVICGLARATRGDIKACADAVAPAANQ--RIHTFLA
LEU1_GLOVI       AYASPGDFEAVERVARTVGTE-DGPVICSLARAIRSDIQAAAEAIRPAARG--RIHTFIS
LEU1_HUNT2       PLTSPGDFEAVQRIAR----EVEGPYICGFSRAIIRDIDETWKAIKDAQKK--CFHIFIS
LEU1_UNCTG       PISSQGDFEAVKTISQQI----KTSSIAGLCRASEKDITTCWNAVKYAKKP--RIHIFLA
LEU1_DESRM       PITSPGDFAAVQAVAREV----RGVTVAGLARANFKDIDVAWDAIKEAEQA--RIHTFIA
LEU1_PELTS       PITSPGDFKAVSEIARQV----KGVTVAALARANFQDIDRAWEAVRHAEQP--RIHTFIA
LEU1_DESAP       PFASPGDFKGVQAVAREV----RGVSVAGLARANAADIDRAWEALCEAEQP--RIHTFIA
LEU1_CARHZ       PITSPGDKEAVSLIAREV----KGVVVAALARASALDIETAWDAIKDAESP--RIHTFIA
LEU1_HELMI       PIASPGDFEAVKAVAEQV----RGPVICALARANRKDIERAAEALRGAEEA--RIHTFIA
LEU1_CLOK5       PKASHGDFEAVKAIAESI----QGPVIVGLARASKEDIDCAWEALKGSLKP--RIHIFLA
LEU1_RUMCH       AIASPGDFESIMTLSRNL----KGVTIASLCRSVEKDIDRAWEAVQYAESP--RIHTFIA
LEU1_HALOH       PISSPGDFEAVQIISENI----RDVEVAALARSRKKDIDRAWEALRNGGDP--RIHVFIA
LEU1_DICT6       PIASPGEFEAVKTIAENV----KGPVIAALARAIPMDIDRAWEAIKYSESP--RIHTFIA
LEU1_DICTD       PIASPGEFEAVKNIAEKV----KGPIIAALARAIPMDIDRAWEAIKYSESP--RIHTFIA
LEU1_PYRAB       PIASEGEFKAVKKIATEV----EDPTIAALARAVEKDIDRAGEALRNAEKN--RIHTFIA
LEU1_PYRFU       PISSPGEFEAVKRIAREV----RGPTIAALARAVKKDIDAAGEALKDAESK--RIHTFIA
LEU1_STRM5       PASSQSDRDAMALIGR--ELRRPSLSLAVLSRCLQADIETSARALEAAANP--RLHVFLS
LEU1_STRMK       PASSQSDREAMALIGR--ELRRPSLSLAVLSRCLQADIETSARALEAAANP--RLHVFLS
LEU1_XANOR       PASSHSDREAVAMMGR--ELRRP--TLAVLSRCLQADIETSARALETVANP--RLHVFLS
LEU1_XANCP       PASSYSDREAVAMMGR--ELRRP--TLAVLSRCLQADIEISARALEAAANP--RLHVFLS
LEU1_XYLFA       PASSQSDYEAMTLIAR--ELRRP--TLAVLSRCLQADIETSARALESATKP--RLHVFLS
LEU1_ACIFD       PVASQGDFDAVRQIAR--QVHGP--VICGLSRTHVADIERCYEAVRDAEHH--RIHVFIS
LEU1_SALRM       PISSPAQTEAVTRIAT--EVDGP--VTCALARTKEDDIDAAGEALADGTDT--RLHTFIA
LEU1_LEPIN       PVSSPVQFQAVERIAR--ETEGP--MIAALARAMKADIEAASKALQPAKKR--RIHTFIA
LEU1_DEIRA       PIASPGDLEGVSRIAR--EVRGP--VITALARANRADIEAAAKGVEAAEKS--RIHTFIA
LEU1_CUPNH       AASSNGDFEAIRSIAQ--VVKDS--TICSLARANDKDIARAAEALKPANSF--RIHTFIA
LEU1_CUPPJ       AASSNGDYEAIRSIAQ--VVKDS--TICSLARANDKDIARAAEALKPANSF--RIHTFIA
LEU1_CUPMC       AASSNGDFEAIRSIAQ--VVKDS--TICSLARANDKDIARAAEALKPANSF--RIHTFIA
LEU11_RALSO      AASSNGDFEAIRAIAQ--SVKDS--RICSLARANDRDISRAAEALKPAGQF--RIHTFIA
LEU1_BURCM       AASSNGDFDAIHTIAG--LVKDS--TICSLARANDKDIQRAADALKPANSA--RIHTFIA
LEU1_BURVG       AASSNGDFDAIHTIAG--LVKDS--TICSLARANDKDIQRAADALKPASSA--RIHTFIA
LEU1_BURL3       AASSNGDFDAIHTIAG--LIKDS--TICSLARANDKDIQRAADALKPAESF--RIHTFIA
LEU1_BURM1       AASSNGDFDAIHTIAG--LVKDS--TVCSLARANDKDIQRAADALKPANSF--RIHTFIA
LEU1_BURP6       AASSNGDFDAIQTIAS--QVKDS--TICSLARANDKDIQRAADALKPANSF--RIHTFIA
LEU1_PARP8       AASSNGDFDAIHTIAG--MIKDS--TICSLARANDKDIQRAADALKPADHF--RIHTFIA
LEU1_POLNS       AASSEGDFQAISAVAA--AVKDS--IVCSLARANDKDITRAADALQATNAK--RIHAFLA
LEU1_POLAQ       AASSEGDFQAISAVAA--AVKDS--IVCSLARANDKDITRAADALQAANAK--RIHAFLA
LEU1_ACISJ       AASSNGDFESVQAIAR--AVKDS--TVCSLARANDRDIARAAEALKEANRA--RIHTFIA
LEU1_ACIAC       AASSNGDFEAVQAIAQ--AIKDS--TVCSLSRANDRDIARAAEALKDAQRA--RIHTFIA
LEU1_POLNA       AASSNGDFECVKAIAE--VVKDS--TICSLARANDRDISRAAEALKPANSG--RLHLFLA
LEU1_POLSJ       AASSNGDFEAVQAIAN--TIRDS--TICSLSRANDRDISRAAEALKGANNA--RIHTFIA
LEU1_VARPS       PASSNGDFEAVKAIAD--IIKES--TVCGLSRANDRDISRAAEALKGAARG--RIHTFIA
LEU1_RHOFT       AASSNGDFEAVQGIAR--AIKDS--TICSLSRANDRDISRAAEALKGANRS--RIHTFIA
LEU1_VEREI       AASSNGDFDAVRAIAS--TIREA--TICSLARANDRDIARAAQALEGAANA--RIHIFIA
LEU1_LEPCP       AASSNGDFEAVKAIAD--VIKDS--TICSLARANDRDISRAAEALRGANRA--RIHTFIA
LEU1_METPP       AASSNGDFEAVRAIAD--VIKES--TVCSLARANDRDIARAAEALKSAARS--RIHTFIA
LEU1_CHRVO       AAASPGDFDAIHAIAE--TIKDS--TVCSLARANERDVRAAGEAIKPAARG--RIHTFIA
LEU1_THIDA       AAASPGDADAIRAIAE--TVRNS--TVCSLARANERDIHAAGGAIKPAKSG--RIHTFIA
LEU1_NEIMB       AAASPGDFEAVNAIAK--TITKS--TVCSLSRAIERDIRQAGEAVAPAPKK--RIHTFIA
LEU1_NEIG1       AAASPGDFEAVNAIAK--TITKS--TVCSLSRAIERDIRQAGKAVAPAPKK--RIHTFIA
LEU1_AROAE       PAASNGDFESVRAIAE--AIRES--TVCGLARANEADIRRAGEAIAPAARG--RIHTFIA
LEU1_DECAR       AAASPGDFDAIHSIAQ--TIKDS--TVCSLARANENDIRRAGEAIKPAQSG--RIHTFIA
LEU1_NITEC       PAASKGDFEAVKAVAE--AVSNS--TVCGLSRAIEADINRAGEALQANQNM--RIHTFIA
LEU1_NITEU       PAASRGDFEAVRAVAE--AVSNS--TVCGLARAMEADIDRTGEALQVNQNV--RIHTFIA
LEU1_NITMU       PAASNGDFEAVKAVAA--AIKGS--TICGLARAIEGDIRRAGEALRGANSA--RIHTFIA
LEU1_METCA       PAASPGDFEAVQAVAR--TIKDS--RVCGLARALDRDIDRAGEALKDAQRA--RIHTFIA
LEU1_NITOC       PVASQGDFEAVQAVAR--SVRES--TVCGLARALGADIDRAGEALAEAESA--RIHTFIA
LEU1_RUTMC       AIASVGDFEAVQTVAN--VVQDS--IICSLSRALDKDIDCAGEALKGANAS--RIHTFIA
LEU1_VESOH       AIASEGDFEAVQAVAN--IVQNS--VICSLARALDKDIDRAGEALKGANAS--RIHTFIA
LEU11_HYDCU      PAASQGDFESVQAVAS--AVKDS--TVCGLARAVENDIVRAGEAIKLANSG--RIHTFIA
LEU1_BRASB       PIASDGDFEAVNEIAK--RTQNA--VVCGLSRAGAKDIDRCAEAIRPAKRG--RIHTFLS
LEU1_BRASO       PIASDGDFEAVNEIAK--RSKNA--VICGLSRAGAKDIDRCAEAIRPAKRG--RIHTFLS
LEU1_RHOP5       PIASDGDFEAVHEIAK--RAKNA--VICGLSRAGAKDIDRCAEAIKPAKQG--RIHTFLS
LEU1_RHOPB       PIASDGDFAAVHEIAK--RAKNA--VICGLSRAGAKDIDRCAEAIRPAKQG--RIHTFLS
LEU1_RHOPT       PFASDGDFEAVHEIAK--RSKNS--VICGLSRAAHKDIDRCAEAIKPAERG--RIHTFLS
LEU1_RHOP2       PFASDGDFEAVHEIAK--RSKNS--VICGLSRASHKDIDRCAEAIKPAERG--RIHTFLS
LEU1_RHOPS       PFASDGDFEAVHEIAK--RSKNS--VICGLSRAAHKDIDRCAEAIKPAERG--RIHTFLS
LEU1_BRADU       PITSEGDFQAVSEIAR--RSKNA--VIAGLSRAHPADIDRCAEAVKFAKRG--RVHTVIA
LEU1_METNO       PIASNGDFDAVAEIAR--RTKTS--VVAGLARAISADIARAGEAVRLAKRG--RIHTFVS
LEU1_METPB       PIASNGDFEAVSEIAR--RTKRA--TIAGLARAIPADIARAGEAVRHAKAG--RIHTFVS
LEU1_NITHX       PIASVGDFEAVAEIAK--NAKNA--VIAGLARAIPGDIARAGEAVRHARRG--RIHTFVS
LEU1_NITWN       PIASVGDFEAVAEIAR--NARNA--VIAGLARAIPGDIARAGEAVRHARRG--RIHTFVS
LEU1_OLICO       PIASVGDFEAVAEIAK--RANNA--VIAGLARAIPADIVRAGEAVRHAKRG--RIHTFVS
LEU1_CAUVN       PIASNGDFEAVRQIAE--LITES--TVCGLARAAAGDIDRCAEAVRRAKRG--RIHTFIS
LEU1_CAUSK       PIASNGDFEAVREIAK--IVKNS--TIAGLCRAHQVDIDRCAEALKGTQRG--RIHVVIA
LEU1_DESMR       PAASEGDFQAVSAIAA--AVKTP--VVAALCRALASDIDRGFEAIKGAQRR--RIHTFLA
LEU1_DESVM       PASSQGDFEAVQAIAR--AVKGV--EVAGLCRAMPADIDRAWEAVKVAENP--RIHTFLA
LEU1_SYNAS       PIASEGDFLSVQQIAQ--EIRGA--QIAGLARANNADIDRAWEAIRDAANP--RIHTFIS
LEU1_NITSB       AAASPGDFEAIRKISE--VVQKS--TVCSLARALEKDIKAAGEAIAPAKHK--RIHTFIA
LEU1_WOLSU       AAASPGDFDAISKIAS--AVSES--TICSLARAVEKDIKAAADSLAPAKLK--RIHTFIA
LEU1_ARCB4       AAASPGDFDAVSRIAQ--IIKNS--SICSLARAVDNDIKQAGLAVQSAAKS--RIHTFIA
LEU1_CAMFF       AAASPGDFDAINQIAK--QIHSI--RIASLARALEKDIKAAGEAISPAKNR--RIHTFIA
LEU1_CAMC1       AAASPGDFDAVNQIAK--QASNI--TVCSLARAVERDIKAAGEALAPAKNK--RIHTFIA
LEU1_CAMHC       AAASPGDFDAIERICG--AVSKI--RVCSLARAIEKDIKAAGESIKSAKFK--RIHTFIA
LEU1_AQUAE       AAASKGDFEAVNRIAK--EVKGP--VICSLARALESDIEIAAKALEPAERK--RIHTFIA
LEU1_METI4       PVISQGDFESVSEIAA--QVKGP--KICGLARCLPKDIEAAAEALKAAADAA-RIHVFLA
LEU1_RHOBA       PIASPGDFESVRQIAT--TIRGA--TICGLARCAEKDIDRAWEALKTAPQA--RIHVFLA
LEU1_BACVZ       PASSRGDFLAVQEIAR--TIKNC--SVTGLARSVKGDIDAAWEALKDGVSP--RIHIFIA
LEU1_BACSU       PASSRGDFLAVQEIAR--TIKNC--SVTGLARCVKGDIDAAWEALKDGAQP--RIHVFIA
LEU1_BACLD       PASSPGDFNAVKEIAR--TIKNC--SVTGLARSVKGDIDSAWEALKDGAEP--RLHIFIA
LEU11_BACP2      PASSRGDFLGVQEIAR--TIKNC--SVAGLARCVKGDIDAAWEALKDGVEP--RLHVFIA
LEU1_GEOKA       PASSKGDFEAVKQIAE--TVRTC--SVTGLSRSVRSDIDAAWEALKGGAEP--RLHLFIA
LEU1_GEOSE       PASSKGDFEAVKQIAE--TVRTC--SVTGLSRSVRSDIDAAWEALKGGAEP--RLHLFIA
LEU1_GEOTN       PASSKGDFEAVKQIAE--TVRTC--SVTGLSRSVRSDIDAAWEALKGGAEP--RLHLFIA
LEU1_GEOSW       PASSKGDFQAVKQIAE--TIKTC--SVTGLARSVQSDIDAAWEALKGGAEP--RLHLFIA
LEU1_ANOFW       PAASKGDFQAVQAIAQ--TVRNC--SVTGLSRSVQSDIDAAWEALKDGAEP--RLHVFIA
LEU1_BACHD       PASSQGDFQSVKAIAE--TVKGS--SVTGLARSVQKDIDAAWEALKSAEEP--RIHLFIA
LEU1_BACSK       PASSPGDFQAVKEIAE--TVKGS--SITGLARAKKSDIDSAWEALKSSAEP--RVHVFLA
LEU1_LYSSC       PASSPGDFDAVHRIAE--TVKNS--VVTGLARCIQKDIDTTWEAIKGAQQP--HIHIFLA
LEU1_OCEIH       PASSKGDFESVKQIAE--TIKSS--SVIALARAVKSDIDIAYEALKGAEKP--AIHIFLA
LEU1_BACCQ       AAASEGDFQSVKRIAN--TIQNA--TVMSLARAKESDIRRAYEAVKGAVSP--RLHVFLA
LEU1_BACMK       AAASEGDFQSVKRIAN--TIQNA--TVMSLARAKESDIRRAYEAVKGAVSP--RLHVFLA
LEU1_BACCN       AAASEGDFQSVKRIAE--SIQNA--SVMSLARAKESDIRKAYEAVKRAVSP--RLHVFLA
LEU1_LACLA       SAASPDSFEAVKQIAD--SLNDT--AVTALARCVISDIDKAVEAVKGAKYP--QIHVFIA
LEU1_LACLS       PAASPDSFEAVKQISK--ALKET--AVTALARCVITDIDKAVEAVREAQHP--QIHVFIA
LEU1_STRG3       PAASPDSFEAVRQISA--AMTTT--AVSGLARSVKSDIDACYEALKDAKYP--QCHVFIA
LEU1_STAAR       PASSTGSFKSVQAIAQ--TLTTT--AVCGLARCKKSDIDAVYEATKDAAKP--VVHVFIA
LEU1_STAHJ       PASSAGSFKSVQAISN--TLTKT--AVCGLARCKKSDIDAVYEATKDAVKP--VIHVFIA
LEU1_STAES       PASSTGSFKSVEAIAK--TLTTT--AVCGLARCKKSDIDAVYEATKEAVKP--QVHVFIA
LEU1_STAS1       PASSSGSFKSVEAIAK--TLTTT--AVCGLARCVKKDIDAVYESTKAAAKP--RIHVFIA
LEU1_STACT       PASSQGSFDSVKAISE--TLTKT--AVVGLARCKKSDIDAVYEATKDAKYP--QLHVFIA
LEU1_LISMO       PISSPGDFECVKAIAK--AIKHC--SVTGLARCVEGDIDRAEEALKDAVSP--QIHIFLA
LEU1_LISIN       PISSPGDFECVKAIAK--AIKHC--SVTGLARCVEADIDRAEEALKDAVSP--QIHIFLA
LEU1_LISMH       PISSPGDFECVKAIAK--AIKHC--SVTGLARCVEGDIDRAEEALKDAVSP--QIHIFLA
LEU1_LISW6       PISSPGDFECVRAIAK--AIKHC--SVTGLARCVEGDIDRAEEALKEAVSP--QIHIFLA
LEU1_BREBN       AAASPGDQKSVAEVAK--RVKNA--TVVSLARAVKDDMDKAYEALRNAQNA--SLHVFLA
LEU1_THEP1       PVSSPVQFEAVKRVASAVQKPI----VVGLARCVEKDIDAVYEALKDRPKDKRMIHVFIA
LEU1_THENN       PVSSPVQFEAVKRVAEAVQRPI----VVGLARCVEKDIDAAYEALKDRPKDKRMIHVFIA
LEU1_SEDSS       PVSSPVQFEAVQRVSATVKKAE----VVGLARCVQRDIDAAYDALRDAAHP--MLHIFIA
LEU1_GEOS4       PASSAGDFQAVQEIARTVGDSVS---ITALARAVKGDIDAVYESIKLAQNP--LIHIVLG
LEU1_KLEP3       PVSSPGDFESVQSIAR--TIKNS--RVCALARCVEKDIDVAAESLKVAEAF--RIHTFIA
LEU1_ENT38       PVSSPGDFESVQTIAR--TIKNS--RVCALARCVEKDIDVAAESLKVAEAF--RIHTFIA
LEU1_SALNS       PVSSPGDFESVQTIAR--TIKNS--RVCALARCVEKDIDVAAQALKVADAF--RIHTFIA
LEU1_SALAR       PVSSPGDFESVQTIAR--IIKNS--RVCALARCVEKDIDVAAQALKVADAF--RIHTFIA
LEU1_CITK8       PVSSPGDFESVQTIAR--QVKNS--RVCALARCVEKDIDVAAESLKVADAF--RIHTFIA
LEU1_CROS8       PVSSPGDFESVQTIAR--QVKNS--RVCALARCVEKDIDVAAESLKVAEAF--RIHTFIA
LEU1_ECOLI       PVSSPGDFESVQTIAR--QVKNS--RVCALARCVEKDIDVAAESLKVAEAF--RIHTFIA
LEU1_ERWT9       PVSSPGDFESVQTIAR--QIKNS--RVCGLARCVEKDIDAAYEALRVADAY--RIHTFLA
LEU1_YERPS       PVSSPGDFESVRTIAQ--QVKNS--RVCALARCVDKDIDVAAEALRIAEAF--RIHVFLA
LEU1_YERE8       PVSSPGDFESVRTIAQ--QMKNS--RVCALARCVDKDIDVAAEALRIAEAF--RIHVFLA
LEU1_SERP5       PVSSPGDFESVQTIAR--QIKNS--RVCGLARCVDKDIDVAAEALRVAEAF--RIHVFLA
LEU1_PECCP       PVSSPGDFESVQTIAR--NIKNS--RVCGLTRCVEKDIDVAAEALRVAEAF--RIHTFIA
LEU1_SODGM       PVSSPGDFESVQTIAR--QIKNS--RVCGLARCVDRDIDVAAEALRVAEAF--RIHLFLA
LEU1_EDWI9       PISSPGDFASVRAIAQ--RVKQS--RVCALARCVDADIDAAAEALRAADAF--RIHTFLA
LEU1_PHOLL       PVSSPGDFESVQTIAK--QIKNS--RVCALARCVEKDIDVAAEALKVADAF--RIHVFLA
LEU1_PROMH       PVSSPGDFESVQTIAR--EIKNS--RICALARCVDNDIDVAAESLNIAEAF--RIHVFLA
LEU1_BLOPB       PISSPGDFESVHTIAQ--KIKNS--LVCALARCIDNDIDVAAEALKVAKNF--RIHIFLP
LEU1_BLOFL       PISSPGDFESVHTIAQ--NIQNS--CVCGLARCLEKDIDIAAEALKSAKKF--RIHIFLP
LEU1_BUCAI       PVSSPGDFKSVQTISK--NIKNS--RICSLARCIEKDIDAAGEAMSSSDSF--RIHIFLA
LEU1_BUCDN       PISSPGDFKSVQTISK--KIKNS--RICSLARCVEKDIEVAGDAMSSSDFF--RIHIFLA
LEU1_BUCAP       PISSPGDFKSVQTISK--NIKNS--RICSLARCLNKDIDTAAEAMSSSNTF--RIHIFLA
LEU1_BUCRP       PISSPGDFKSVQTISK--NIKNS--RICSLARCLDKDIDAAAEAMHSSNAF--RIHIFLA
LEU1_BUCUN       PISSPGDFKSVQTISQ--NIKNS--RICSLARCIEKDIDTAGEAMSHCDFF--RIHVFLA
LEU1_BUCUM       PISSPGDFKSVQTISQ--KIKNS--RVCSLARCIEKDIDVAGEAMSASNSF--RIHIFLA
LEU1_BUCUE       PISSPGDFKSVQTISK--KIKNS--QICSLARCIEKDIDIAGEAMSVCDFF--RIHIFLA
LEU1_BUCML       PISSPGDFKSVQIISK--NIKNS--RICSLARCVEKDIDAAGEAMSASNSF--RIHIFLA
LEU1_BUCCC       PVSSPGDFKSVQMLSK--IIKNS--KICSLARCLPNDITIAADAMQFSKNF--RIHLFLG
LEU1_AERHH       PVSSPGDFQSVQTIAR--HIKQS--RVCALARALPKDIDAAGEALRVAEAF--RIHTFIS
LEU1_AERS4       PVSSPGDFQSVQTIAR--HIKNS--RVCALARALPQDIDAAGEALRVAEAF--RIHTFIS
LEU1_TOLAT       PVSSPGDFESVQTIAR--QIKNS--RVCALSRALQKDIDAAAEALKVADQF--RIHTFLA
LEU1_SHESR       PVSSPGDFESVQTIAR--TIKNS--RVCALSRALEKDIDAAAQALSVAEQF--RIHTFIS
LEU1_SHEON       PVSSPGDFESVQTIAR--TIKNS--RVCALSRALEKDIDAAAQALSVAEQF--RIHTFIS
LEU1_SHEB8       PVSSPGDFESVQTIAR--TIKNS--RVCALSRALEKDIDAAAQALSVAEQF--RIHTFIS
LEU1_SHEAM       PVSSPGDFESVQTIAR--HIKNS--RVCALSRALEKDIDAAAQALSVAEQF--RIHTFIS
LEU1_SHEFN       PVSSPGDFKSVQTIAK--TIKNS--RVCALSRALEKDIDAAAQALSVADQF--RIHTFIS
LEU1_SHEHH       PVSSPGDFESVQTIAK--TIKNS--RVCALSRALESDIDAAAQALSVAEQF--RIHTFIS
LEU1_SHEPA       PVSSPGDFESVQTIAK--TIKNS--RVCALSRALEKDIDAAAQALSVAEQF--RIHTFIS
LEU1_SHEPW       PVSSPGDFESVQTIAR--TVKNS--RVCALSRALEKDIDAAAQALSVADQF--RIHTFIS
LEU1_SHESH       PVSSPGDFNSVQTIAN--TVKNS--RVCALARALEKDIDAAAQSLSVADQF--RIHTFIS
LEU1_SHEWM       PVSSPGDFKSVETIAR--TVKNS--RVCALARALEKDIDAAAQSLSVADQF--RIHTFIS
LEU1_SHELP       PVSSPGDFESVQTIAR--TIKNS--RVCALARALEKDIDAAAQSLSVAEQF--RIHTFIS
LEU1_SHEDO       PVSSPGDFNSVQTIAK--TIKNS--RVCALARALPADIDAAAQALAVAEQF--RIHTFIS
LEU1_PSYIN       PISSPGDFESVKTIAR--EIKNS--RVCGLSRALPKDIDAAWNALKGADAF--RIHTFIS
LEU1_ALIFM       PVSSPGDFESVRTIAQ--HIKNS--RICGLSRAVAKDIDAAAEALKVAEAF--RIHTFIS
LEU1_ALISL       PISSPGDFESVRTIAK--HIKNS--RICALSRAVTKDIDVAADALKVAEAF--RIHTFIS
LEU1_VIBCM       PVSSPGDFESVQTIAK--NIKNS--RVCALSRAVAKDIDAAAEALKVAEAF--RIHTFIS
LEU1_VIBVU       PVSSPGDFESVQTIAR--NIKNS--RVCALSRAVEKDIDAAAEALKVAEAF--RIHTFIS
LEU1_VIBPA       PISSPGDFESVQTIAK--HIKNS--RVCALSRAVAKDIDAAAEALKVADQF--RIHTFLA
LEU1_VIBTL       PISSPGDFESVQTIAK--HIKDS--RICALSRAVAKDIDAAAEALKVADQF--RIHTFIS
LEU1_PHOPR       PISSPGDFESVQTIAK--HIKNS--RVCALSRAVAKDIDVAAESLKVAEAF--RIHTFIS
LEU1_HISS2       PVSSAGDFESVQTIAR--HIKNS--RVCALSRAVDKDIDIAADALKVAEAF--RIHTFIA
LEU1_PASMU       PISSAGDFESVQTIAR--HIKHS--RVCALSRAVDKDIDAAAEALKVAEAF--RIHTFIA
LEU1_HAEIE       PVSSQGDFESVQTIAR--HIKNA--RVTALSRAVDKDIDAAYEALKVAEAF--RIHTFIA
LEU1_PSEA6       PVSSPGDFRSVRSIAQ--EVKNA--TVCGLSRALEKDIDACGEALSVADNF--RIHTFIA
LEU1_CAMJD       PVSSQGDFKAVQKIAS--KVKNS--TICALSRALDKDIDMAYEALKVAKHF--RIHTFIA
LEU1_OLSUV       PISSPGDFRSVQEIGRL-AGDDA--VVVGLTRAVDKDIDRAAEALSCAKRP--RIHTGLG
LEU1_PARD8       PVSSPGDFKSVVEISK--AVTWP--TICALTRAVEKDIDVAAEALRFAKRG--RIHTGIG
                 .  *  .   :  :               : *    *:     .           *  : 

LEU1_CROS5       TSDIHLKHKLKKT-------RQEVLAIVPEMVAYAKTFTDDVEFSPEDAGRSDPEFMYQV
LEU1_RIPO1       TSDIHLQYKLKKT-------RQEVLAIVPDMVAYAKSLVDDVEFSPEDAGRSDPEFLYQV
LEU1_GLOC7       TSDIHLAYKLKKT-------RQEVLEIVPEMVAYAKSFVDDVEFSPEDAGRSDPEFLYQV
LEU1_NOSS1       TSDIHLQYKLKKT-------RPEVIAIAEEMVAYAKSFTDDVEFSPEDAGRSDPEFLYQV
LEU1_MICAE       TSDIHLQYKLKKT-------RQEVLEIVPEMVAYAKSFLNDVEFSPEDAGRSDPEFLYQV
LEU1_MICAN       TSDIHLQYKLKKT-------RQEVLEIVPEMVAYAKSFVDDVEFSPEDAGRSDPDFLYQV
LEU1_SYNY3       TSDIHLEHKLKKT-------RAEVLAIVPEMVAYAKSLVNDIEFSPEDAGRSDPEFLYQV
LEU1_SYNP2       TSDIHLEYKLRKS-------RKDVLAIAPEMVAYAKTFTNDVEFSPEDAGRSDPEFLYQI
LEU1_TRIEI       TSDIHLAYKLKKT-------RAEVLEIASEMVAYAKTFVDDVEFSPEDAGRSDPEFLYQV
LEU1_THEEB       TSDIHLEYKLRKT-------RAEVLEIAQEMVAYAKSFVDDVEFSPEDAGRSDPEFLYEV
LEU1_PROM0       TSDIHLKHKLKKS-------RKDVLQIVPEMVNYAKSLVDDIEFSCEDASRSDPDFLYEV
LEU1_PROMS       TSDIHLKHKLKKS-------RKDVLQIVPEMVNYAKSLVDDIEFSCEDASRSDPDFLYEV
LEU1_PROM9       TSDIHLKHKLKKS-------RKDVLQIVPEMVNYAKTLVEDIEFSCEDASRSDPDFLYEV
LEU1_PROM2       TSDIHLKHKLKKS-------RKDVLQIVPEMVNYAKSLVDDIEFSCEDASRSDPDFLYEV
LEU1_PROM5       TSDIHLKHKLRKS-------RKDVLSIVPEMVSYAKSLVDDIEFSCEDASRSDPEFLYEV
LEU1_PROMP       TSDIHLKHKLRKT-------RSDVLCIVPEMVSYAKSLVDDIEFSCEDASRSDPEFLYEV
LEU1_PROM4       TSDIHLEHKLRKT-------REEVIQIVPEMVHYAKSFSEDVEFSCEDAARSDPDFLYEL
LEU1_PROMA       TSDIHLKHKLRKS-------RADVLKIVPEMVGYARSLASDVEFSCEDAARSDPDFMYEV
LEU1_PROMT       TSDIHLEHKLRKS-------RKEVLDIVPDMVGYAKSFVDDVEFSCEDAARSDLDFLYEV
LEU1_SYNS9       TSDIHLEHKLRKS-------RKDVLAIVPEMVSYARSLIEDVEFSCEDAGRSDPEFLYEV
LEU1_SYNSC       TSDIHLEHKLRKS-------RGDVLGIVPEMVSYARSLVEDVEFSCEDAGRSDPEFLYEV
LEU1_SYNPX       TSDIHLEHKLRKS-------RADVLGIVPEMVSYARSLMDDIEFSCEDAGRSDPEFLYEV
LEU1_PROMM       TSDIHLEHKLRKS-------RAEVLAIVPEMVAYARSLVDDVEFSCEDAARSDPEFLYEV
LEU1_SYNPW       TSDIHLEHKLRKS-------RQEVLAIVPEMVAYARSLVDDVEFSCEDAGRSDPEFLYAV
LEU1_SYNS3       TSDIHLEHKLRKS-------RKDVLGIVPEMVAYARSFVDDVEFSCEDAGRSDPEFLYEV
LEU1_SYNR3       TSDIHLEHKLRKS-------RAEVLQIVPEMVAYARSLVDDVEFSCEDAGRSDPEFMYQV
LEU1_GLOVI       TSDIHLEHQLRKS-------RAEVLAIAAEMVAFAKGFVDDVEFSPMDAGRSAPEYLYRV
LEU1_HUNT2       SSDIQIKHQLGKT-------EKDVLEIVKSTVYHAKQYTDEVEYSPMDASRTRLEFLYEV
LEU1_UNCTG       TSDLHIEKKLQKT-------RAQILDMAVKTIKYGKSLCKDVEFSAEDAGRSDMDFLCKV
LEU1_DESRM       TSDIHLKYKLRKD-------REQVIEAAVAAVKHARKYTSDVEFSAEDASRSDIDYLCRI
LEU1_PELTS       TSDIHLKYKLRMS-------REEVLDAAVAAVKRARAYTGDVEFSAEDASRSDLDFLCRV
LEU1_DESAP       TSDIHLQHKLRMS-------REAVLETAVEAVRRAKGYTSDVEFSAEDAFRSDPDYLCRV
LEU1_CARHZ       TSDIHLKYKLKMD-------RETVVERAVAAVKLAKKFTADVEFSAEDASRSDLDFLCRV
LEU1_HELMI       TSPIHMQHKLRME-------PDKVLDTAVDAVKLAKSFTSNVEFSAEDAFRSDVGFLCRI
LEU1_CLOK5       TSDIHMEHKLKMK-------PEEVLKRAADMVRYAKGLCPSIEFSPEDATRTRPEFLYKV
LEU1_RUMCH       TSDIHMKYKLKMT-------EEEVLERAVSMVKRAKGYCSNVEFSAEDASRTREEFLYRV
LEU1_HALOH       TSPIHMKYKLKLS-------EEQVIEKAVEAVKYASKYTSNIEFSAEDASRSQPVFLYRL
LEU1_DICT6       TSDIHIEKKLKKT-------RDEVLEQAVSAVKYAKRYCSDVEFSAEDAVRSDFNFLVKI
LEU1_DICTD       TSDIHIEKKLKKT-------RDEVLEQAVSAVKYAKRYCSDVEFSAEDAVRSDFNFLVKI
LEU1_PYRAB       TSPIHMKYKLRKE-------PEEVKKLAVKAVEHATKYTEDVEFSAEDATRSDWDFLVEV
LEU1_PYRFU       TSLIHMKYKLRKT-------PEEVKKMAVEAVEYATKYTDDIEFSAEDATRSDWNFLVEV
LEU1_STRM5       TSPLHREHKLRMT-------REQVLESVRKHVSLARSYIDDVEFSAEDATRTELDYLIEV
LEU1_STRMK       TSPLHREHKLRMT-------REQVLESVRKHVSLARSYIDDVEFSAEDATRTELDYLIEV
LEU1_XANOR       TSPLHREHKLRMS-------REQVLESVHRHVTLARGYIDDVEFSAEDATRTEEDFLAEV
LEU1_XANCP       TSPLHREHKLRMS-------REQVLESVHKHVTLARGYIDDIEFSAEDATRTEEDFLAEV
LEU1_XYLFA       TSPLHREHKLRMS-------KEQVLESVHKHVSLSRTLIDDVEFSAEDATRTEEDFLIEV
LEU1_ACIFD       TSPSHLEHMLRMS-------EDQVVEAVRRAIARARELVDDVEFSPQDATRTPLPFLYRV
LEU1_SALRM       TSDVHIEAKFDKLGNTMAEKREAIIQRAVRAIEQALTYTDNVEFSAEDAGRTDPEFLCEV
LEU1_LEPIN       SSPIHMKYKLGKE-------PKEVLKMAVEAVTLCRQFVDDVEFSPEDATRSEPEFLREL
LEU1_DEIRA       TSPIHMQKKLNLE-------PDAVIERAVEAVRLARQYVDDVEFSAEDATRSEWDFLSRI
LEU1_CUPNH       TSALHMEKKLRMT-------PDEVYQQARLAVRFARQFTDDIEFSPEDGSRSDMDFLCRV
LEU1_CUPPJ       TSALHMEKKLRMT-------PDQVYEQARLAVRFARQFTDDIEFSPEDGSRSDMDFLCRV
LEU1_CUPMC       TSALHMEKKLRMT-------PDQVYEQARLAVRFARQFTDDIEFSPEDGSRSDMDFLCRV
LEU11_RALSO      TSALHMEKKLRMT-------PDQVYEQARLAVRFARQFTDDIEFSPEDGSRSDMDFLCRV
LEU1_BURCM       TSPLHMEKKLRMT-------PDQVFEQARLAVRFARKFTDNVEFSPEDGSRSDLDFLCRV
LEU1_BURVG       TSPLHMEKKLRMT-------PDQVFEQARLAVRFARKFTDNVEFSPEDGSRSDLDFLCRV
LEU1_BURL3       TSPLHMEKKLRMT-------PDQVFEQARLAVRFARKFTDNVEFSPEDGSRSDMDFLCRV
LEU1_BURM1       TSPLHMEKKLRMT-------PEQVYEQARLAVRFARKFTDNVEFSPEDGSRSDMDFLCRV
LEU1_BURP6       TSPLHMEKKLRMT-------PDQVFEQARLAVRFARKFTDNIEFSPEDGSRSDMDFLCRV
LEU1_PARP8       TSPLHMEKKLRMS-------PEQVLEQAKLAVRFARKFTNDVEFSPEDGSRSDMDFLCRV
LEU1_POLNS       TSPLHMAVKLRMS-------PEEVLEQAKRSIRFACNLASDIEFSAEDGYRSEMDFLCRV
LEU1_POLAQ       TSPLHMAVKLRMS-------PEEVLEQAKRSIRFARNLASDIEFSAEDGYRSEMDFLCRV
LEU1_ACISJ       TSALHMEKKLRMT-------PEQVLEQARQAVRFARNLVEDIEFSPEDGYRSDPDFLCRV
LEU1_ACIAC       TSPLHMEKKLRMT-------PEQVLEQAKQSVRFARNLVADIEFSPEDGYRSEPDFLCRV
LEU1_POLNA       TSALHMEKKLRMT-------PDQVFEQARLSVRFARNLMADIEFSPEDGYRSDPDFLCRV
LEU1_POLSJ       TSALHMEKKLRMT-------PEQVLEQARLSVRFARNLVADVEFSPEDGYRSDVDYLCRV
LEU1_VARPS       TSPLHMEKKLRMS-------PDEVHEQAKLAVRFARNLVSDVEFSPEDGYRSDPDFLCRV
LEU1_RHOFT       TSALHMEKKLRMT-------PDQVFEQAKLAVRFARNLVADVEFSPEDAYRSDEDFLCRV
LEU1_VEREI       TSALHMEKKLRMT-------PGQVLEQSLQSVRFARNLVADIEFSPEDGYRSDPDFLCRV
LEU1_LEPCP       TSALHMEKKLRMS-------PDEVLEQARLSVRFARNLCGDIEFSPEDGYRSDPDFLCRV
LEU1_METPP       TSELHMEKKLRMT-------REQVLEQARLSIRFARNLCEDIEFSPEDGYRSDPDFLCRV
LEU1_CHRVO       TSPIHMEKKLRMS-------PDEVVDAAVKAVKIAREYTDDVEFSAEDALRSDIDFLARI
LEU1_THIDA       TSPIHMEKKLRMQ-------PDQVVEAAVKAVKLAREYTDDVEFSAEDAVRSDMDFLVRI
LEU1_NEIMB       TSPIHMEYKLKMK-------PKQVIEAAVKAVKIAREYTDDVEFSCEDALRSEIDFLAEI
LEU1_NEIG1       TSPIHMEYKLKMK-------PKQVIEAAVKAVKIAREYTDDVEFSCEDALRSQIDFLAEI
LEU1_AROAE       TSPIHMEMKLRMS-------PDQVVEQAVRAIGWAKEYTDDIEFSAEDAGRSEIDFLCRI
LEU1_DECAR       TSPIHMEKKLRMT-------PDQVVEQAVKAIGWAREYTDDIEFSAEDAGRSDLDFLCRI
LEU1_NITEC       TSPIHMKNKLRMS-------PDRVIEQAIKAVKWARQYTDNVEFSPEDAGRSEIDFLCRI
LEU1_NITEU       TSPIHMKNKLRMS-------PDQVIDQAIKAVKWARQYTDNVEFSPEDAGRSEIDFLCRV
LEU1_NITMU       TSPIHMEKKLRMS-------PDQVVEQAVKAVKFARQYTDDVEFSPEDAGRSDITFLCRV
LEU1_METCA       TSPIHMRHKLQMS-------PDQVVEYAVKAVKRARQYTDDVEFSPEDAGRSEEDFLCRI
LEU1_NITOC       TSPIHMKRKLRME-------PDQVLEHAVKAVKRAREYTDDVEFSPEDAGRSEIEFLCRI
LEU1_RUTMC       TSDIHMKMKLQMT-------PDQVVEQAVRAVKRAKRYTNDVEFSPEDAGRSDEDFLCRI
LEU1_VESOH       TSNIHMKMKLQMT-------PDQVVGQAVRAVKRANRYTDNIEFSPEDAGRSDEDFLCYI
LEU11_HYDCU      TSPIHMEKKLKMS-------PDEVVERAVWAVKRARDFTDNVEFSPEDAGRSELDFLCRV
LEU1_BRASB       TSPVHMKYKLQME-------PQAVFELVVSSVTRARNHTDDVEWSSEDGTRTEFDFLCRC
LEU1_BRASO       TSPVHMKYKLQMD-------PQQVFELVISSVTRARNHTDDVEWSSEDGTRTEFDFLCRC
LEU1_RHOP5       TSPVHMKYKLQMD-------AAQVYELVISSVTRARNHTDNVEWSSEDGTRTEFDFLCKC
LEU1_RHOPB       TSPVHMKYKLQMD-------AEQVYQLVISAVTRARNHTDNVEWSSEDGTRTEFDFLCKC
LEU1_RHOPT       TSPVHMKYKLQME-------AAQVYEMVISSVTRARNHTDDVEWSAEDATRTEFDFLCRC
LEU1_RHOP2       TSPVHMKYKLQME-------AAQVYEMVISSVTRARNHTDDVEWSAEDATRTEFDFLCRC
LEU1_RHOPS       TSPVHMKYKLQME-------AAQVYEMVISSVTRARNHTDDVEWSAEDATRTEFDFLCRC
LEU1_BRADU       TSPLHMRVKLNKT-------PEQVIETSVAMVARARNQIDDVEWSAEDGTRSEMDYLCRI
LEU1_METNO       TSPIHLAHQMRKS-------EEEVLEIIQKTVAQARDLVEDVEWSAMDATRTPIDYLCRC
LEU1_METPB       TSAIHLAHQMRKT-------QDEVIEIILKTVTQARDLVEDVEWSAMDATRTDIDYLCRC
LEU1_NITHX       TSPIHLAHQMRKS-------EAEVLEIITATVTQARNLVEDVEWSAMDATRTPIDYLCKC
LEU1_NITWN       TSPIHLAHQMRKS-------EAEVLEIITATVKQARNLVEDVEWSAMDATRTPIDYLCKC
LEU1_OLICO       TSPIHLAHQMRKS-------EEDVLGIITATVAQARNLVDDVEWSAMDSTRTPIDYLCRC
LEU1_CAUVN       TSPVHMKYKLQME-------PDAVLEAITRSVSHARNLVGDVEWSAEDATRTERDFLKRC
LEU1_CAUSK       TSDLHMKHKLQME-------PDAVIDVIARSVTHARNLRDDVEWSAEDATRSDRQFLRRA
LEU1_DESMR       TSELHMQHKLNKT-------PTQVLDMIEAAVSHAASKGVEVQFSAEDASRSEPAFLVAA
LEU1_DESVM       TSPVHMQYKLRKE-------PDQVVEMAVAAVRHAAKYTSNVEFSAEDASRSNPDFLVRV
LEU1_SYNAS       SSDIHLKYQLRKS-------REQVLKEAVAAVERARSYTPNVEFSPMDATRTDRGYLCEM
LEU1_NITSB       TSPIHMKYKLRME-------PDEVIKRAVEAVQYAKTFVEDVEFSCEDAGRSEMSFLKEI
LEU1_WOLSU       TSPIHMEYKLRMT-------PSEVIKRAVEAIAYAKSFMEDVEFSCEDAGRSDVGFLKEI
LEU1_ARCB4       TSPIHMQYKLKMS-------GDEVIKRAIRAVEYAKTFVDDVEFSLEDAGRSEIPFMKEV
LEU1_CAMFF       TSPIHMEHKLKMT-------PDEVIKRAVEAVKYAKTFVDDVEFSCEDAGRSDIVFLKEI
LEU1_CAMC1       TSPIHMQYKLKMS-------PDEVIRCAVEAVQYSKTFCDDVEFSCEDACRSEMSFLKEI
LEU1_CAMHC       TSPIHMEYKLKLS-------PDDVIKKAINSIKYAKTFCDDVEFSCEDAGRSEISFIKEI
LEU1_AQUAE       TSPIHMEYKLRMT-------PDQVLERIKKAVSFARNFTDDVEFSCEDATRSEREFLYRA
LEU1_METI4       TSQIHRRFKLAKD-------EEEIVRIAVEGVRLAKRYVQDVEFSAEDASRTEPEFLAKI
LEU1_RHOBA       TSAIHREFKLRMT-------PDEIVERAVAGVRRAASHCDDVEFSPEDACRTEHDFLCRV
LEU1_BACVZ       TSDIHLKHKLKMT-------REEVKEKAVEMVKYAKERFPIVQWSAEDACRTELPFLAEI
LEU1_BACSU       TSDIHLKHKLKMT-------REQVIERAVGMVKYAKERFPIVQWSAEDACRTELPFLAEI
LEU1_BACLD       TSDIHLKYKLKKT-------REQVLEQAVAMVKYAKERFPIVQWSAEDACRTDLPFLAEI
LEU11_BACP2      TSDIHLKHKLKKT-------REEVVEQAVAMVKYAKERFPVVQWSAEDACRTDLDFLAEI
LEU1_GEOKA       TSPIHMVHKLRMT-------PEQVIEAAVEAVKYAKRFFPIVQWSAEDACRSELPFLAKI
LEU1_GEOSE       TSPIHMVHKLRMT-------PEQVIEAAVEAVKYAKRFFPIVQWSAEDACRSELPFLAKI
LEU1_GEOTN       TSPIHMVHKLRMT-------PEQVIEAAVEAVKYAKRFFPIVQWSAEDACRSELPFLAKI
LEU1_GEOSW       TSPIHMKYKLQMT-------PEQVIETAVESVKYAKRYFPIVQWSAEDACRSELPFLAKI
LEU1_ANOFW       TSPIHMQYKLRMT-------PEQVVETAVESVRYAKKYFPIVQWSAEDACRSDLPFLATI
LEU1_BACHD       TSPIHMEHKLRMT-------PEQVIEKAVESVKYAASRFKHVQWSAEDASRSDFPFLAQI
LEU1_BACSK       TSPIHMEHKLKLT-------PDQVVERAVESVRYAAEKFPHVQFSAEDANRSEWPFLKRI
LEU1_LYSSC       TSPIHMEYKLKKS-------PEQVIEQAVEAVKYAKKYFPLVQWSAEDAFRSDREFLVRI
LEU1_OCEIH       TSPIHMTYKLKKS-------PEQVIETAVNMVTYAKERFDEIEWSAEDATRSDWNFLAQI
LEU1_BACCQ       TSDIHMKYKLCMS-------KEDVLDSIHRSVTLGKSLFPTVQFSAEDATRTARDFLAEA
LEU1_BACMK       TSDIHMKYKLCMS-------KEDVLDSIHRSVTLGKSLFPTVQFSAEDATRTSRAFLAEA
LEU1_BACCN       TSDIHMKYKLCMS-------KEDVLDSIHRSVILGKSLFPTVQFSAEDATRTAQPFLAEA
LEU1_LACLA       TSPIHMKYKLKIS-------PEEVLKNIDKCVRYARERVEVVEFSPEDATRTELNFLLEA
LEU1_LACLS       TSPIHMKYKFKIS-------PDEVLKTIDKCVRHAHEQVEVVEFSPEDATRTEPEFLLKA
LEU1_STRG3       TSPIHREYKLKKT-------KEEILDIIKEHVTYARSKFDVVEFSPEDATRTELDYLLQV
LEU1_STAAR       TSPIHLEHKLKMS-------QEDVLASIKEHVTYAKQLFDVVQFSPEDATRTELPFLVKC
LEU1_STAHJ       TSPIHLTHKLKMT-------QQQVLESIKEHVSYAKQYFDVVQFSPEDATRTDTDFLIKC
LEU1_STAES       TSPIHLEHKLKMT-------QDEVLTSIKEHVSYAKQFFEVVQFSPEDATRTEIPFLIEC
LEU1_STAS1       TSPIHRDSKLMMS-------KEEVLASIKEHVSYAKQYFDVVQFSPEDATRTELPFLIEC
LEU1_STACT       SSPIHLEHKLKMT-------QEELLENITENVSYGKSLFDVVQFSPEDATRTDLDFLVKC
LEU1_LISMO       TSDVHMEYKLKMS-------RAEVLASIKHHISYARQKFEVVQFSPEDATRSDRAFLIEA
LEU1_LISIN       TSDVHMEYKLKMS-------RAEVLASIKHHISYARQKFDVVQFSPEDATRSDRAFLIEA
LEU1_LISMH       TSDVHMEYKLKMS-------RAEVLASIKHHISYARQKFEVVQFSPEDATRSDRAFLIEA
LEU1_LISW6       TSDVHMEYKLKMS-------RAEVLASIKHHIHYARQKFDIVQFSPEDATRSDRAFLIEA
LEU1_BREBN       TSPIHRQFKLNMS-------KEEVLARAVEAVTYAKKYFTEVQFSAEDAARTEIDFLAEV
LEU1_THEP1       TSPIHRKYKLRME-------KEEILERIRRYVGYAKQFFDLVEFSAEDASRTEVPFLIEA
LEU1_THENN       TSPIHRKYKLRME-------KEEILERVRKYVTYARQFFDLVEFSAEDASRTEVPFLIEV
LEU1_SEDSS       TSPLHREYKLKKS-------KEEILDTVRECLNYGGKGFSRMEFSPEDASRTEPDYLVEV
LEU1_GEOS4       TSNIHVEKKFNRS-------KDAVLQMGVDAVKYAKTLLPQVQYSTEDASRSDFEYLWKT
LEU1_KLEP3       TSPMHIATKLRST-------LDEVIERAIYMVKRARNYTDDVEFSCEDAGRTPIADLARV
LEU1_ENT38       TSPMHIATKLRST-------LDEVIERAVYMIKRARHYTDDVEFSCEDAGRTPIADLARV
LEU1_SALNS       TSPMHIATKLRST-------LDEVIERAVYMVKRARNYTDDVEFSCEDAGRTPVDDLARV
LEU1_SALAR       TSPMHIATKLRST-------LDEVIERAVYMVKRARNYTDDVEFSCEDAGRTPVNDLARV
LEU1_CITK8       TSPMHIATKLRST-------LDEVIERAIYMVKRARNYTDDVEFSCEDAGRTPIDDLARV
LEU1_CROS8       TSPMHIATKLRST-------LDEVIERAVYMVKRARNYTDDVEFSCEDAGRTPIADLARV
LEU1_ECOLI       TSPMHIATKLRST-------LDEVIERAIYMVKRARNYTDDVEFSCEDAGRTPIADLARV
LEU1_ERWT9       TSPMHIATKLRST-------LPEVIERAVKMIRRARNYTDDVEFSCEDGGRTPIDDLCRV
LEU1_YERPS       TSTLHIESKLKRS-------FDDVLAMAVHSVKRARNYTDDVEFSCEDAGRTPIDNLCRV
LEU1_YERE8       TSTLHIESKLKRS-------FDDVLAMAVHSVKRARNYTDDVEFSCEDAGRTPIDNLCRI
LEU1_SERP5       TSTLHIESKLKRS-------FDEVLEMAIRSVKRARNYTDDVEFSCEDAGRTPIDNLCRV
LEU1_PECCP       TSPMHIATKLRST-------LDEVIERAIYMIKRARNYTDDVEFSCEDAGRTPIPDLCRV
LEU1_SODGM       TSTLHVESKLKKS-------FDQVVEMAVHSVKRARNYTDDVEFSCEDAGRTPIDNLCRI
LEU1_EDWI9       TSTLHLESKLRRS-------FDDAIAMARHAILRARRYTDDVEFSCEDAGRTPIDNLCRI
LEU1_PHOLL       TSDLHIESKLKKT-------FENVMEMATQSIKRARRYTDDVEFSCEDAGRTPIDNLCRI
LEU1_PROMH       TSALHAEHKLKKS-------FDDIIEMGTRSIKRARRYTDDVEFSCEDAGRTHIDNLCRI
LEU1_BLOPB       TSNVHIQSKLKKN-------FDQIIDMTVHAIRYARKYTDDIEFSCEDAGRTNIDNLCRI
LEU1_BLOFL       TSAIHIQSKLRKN-------FDQIIDMTTHSIRYARKYTDDVEFSCEDAGRTSIDNLCRI
LEU1_BUCAI       TSTLHMESKLKKN-------FNEIIDMAVFSVKKALRYTDDIEFSCEDATRTTMDNLCRI
LEU1_BUCDN       TSTLHMESKLRKN-------FDEIIDMAVSSVKKALRYTDDVEFSCEDASRTTMDNLCRI
LEU1_BUCAP       TSTLHMESKLKKN-------FDQIIDMAISSVKRALRYTDDVEFSCEDASRTTMDNLCRI
LEU1_BUCRP       TSILHMESKLKKN-------FDQIIDMAITSVKRALRYTDDVEFSCEDASRTTMDNLCRI
LEU1_BUCUN       TSTLHMESKLRKN-------FDEIIDMAIFSVKRALRYTDDVEFSCEDASRTTMDNLCRI
LEU1_BUCUM       TSTLHMESKLRKN-------FNEIIDMAIFSVKRALRYTDDIEFSCEDASRTTIDNLCRI
LEU1_BUCUE       TSRLHMKSKLRKN-------FDEIIDMAIFSVKRALRYTDDVQFSCEDASRTTIDNLCRI
LEU1_BUCML       TSTLHMEYKLKKN-------FHEIIDMAIFAVKRALRYTDDIEFSCEDASRTTIDNLCRI
LEU1_BUCCC       TSDLHVSSKLKKN-------FNEIIEMAVASVKQAKKFTNDIEFSCEDAGRTTLQNLYCI
LEU1_AERHH       TSSIHVESKLKKS-------FEDVLEMGVSAIKHARRYTDDVEFSCEDAGRTPIDNLCRM
LEU1_AERS4       TSSIHVESKLKKS-------FEDVLEMGVSAIKHALRYTDDVEFSCEDAGRTPIDNLCRM
LEU1_TOLAT       TSTIHVESKLKKS-------FEDVLEMGINAVKYARRFTDDVEFSCEDAGRTPIDNLCRM
LEU1_SHESR       TSTIHVESKLKRS-------FEQVLEMAVGAVKYARRFTDDVEFSCEDAGRTPIDNLCRM
LEU1_SHEON       TSTIHVESKLKRS-------FEQVLEMAVGAVKYARRFTDDVEFSCEDAGRTPIDNLCRM
LEU1_SHEB8       TSTIHVESKLKRS-------FDQVLEMAVGAVKYARRFTDDVEFSCEDAGRTPIDNLCRM
LEU1_SHEAM       TSNIHVESKLKRS-------FDQVLDMAVGAVKYARRFTDDVEFSCEDAGRTPIDNLCRM
LEU1_SHEFN       TSTIHVESKLKRS-------FDDVLEMAVNAVKYARRFTDDVEFSCEDAGRTPIDNLCRM
LEU1_SHEHH       TSTIHVENKLKRS-------FDQVLDMAVGAVKYARRFTDDVEFSCEDAGRTPIDNLCRM
LEU1_SHEPA       TSTIHVESKLKRS-------FDQVLEMAVGAVKYARRFTDDVEFSCEDAGRTPIDNLCRM
LEU1_SHEPW       TSTIHVESKLKRS-------FDQVLEMAVGAVKYARRFTDDVEFSCEDAGRTPIDNLCRM
LEU1_SHESH       TSTIHVESKLKRS-------FDQVLEMAVGAVKYARRFTDDVEFSCEDAGRTPIDNLCRM
LEU1_SHEWM       TSTIHVESKLKRS-------FDQVLEMAVGAVKYARRFTDDVEFSCEDAGRTPIDNLCRM
LEU1_SHELP       TSTIHVESKLKRS-------FDQVLDMAVGAVKYARRFTDDVEFSCEDAGRTPIDNLCRM
LEU1_SHEDO       TSTIHVESKLKRS-------FDDVLAMAVNAVKYARRFTDDVEFSCEDAGRTPIDNLCRM
LEU1_PSYIN       TSTIHVENKLKRT-------FDAVLEMGINAVKHARNYTDDVEFSCEDAGRTPIDNLCRI
LEU1_ALIFM       TSTVHVQDKLRRS-------YDDVVEMGVKAVKHARKYTDDVEFSCEDAGRTPIDNLCRM
LEU1_ALISL       TSTVHVQDKLRRS-------YDDVVEMGVKAVQRARKYTDDVEFSCEDAGRTPIDNLCRM
LEU1_VIBCM       TSTIHVQDKLRRS-------YDDVVAMAVKAVKHARQYTDDVEFSCEDAGRTPIDNLCRM
LEU1_VIBVU       TSTIHVQDKLRRS-------YDDVVEMGVRAVKHARKYTDDVEFSCEDAGRTPIDNLCRM
LEU1_VIBPA       TSTIHVQDKLRRS-------YDDVLEMAVNAVKHARNYTDDVEFSCEDAGRTPIDNLCRM
LEU1_VIBTL       TSTVHVQDKLRRS-------YDDVVEMAVKAVKHARNYTDDVEFSCEDAGRTPIDNLCRM
LEU1_PHOPR       TSTIHVQDKLRRS-------YDDVIEMAIAAVKRARNYTDDVEFSCEDAGRTPIDNLCRM
LEU1_HISS2       TSALHVEAKLRRT-------FDDVVEMAIQAVKRARRYTDDVEFSCEDAGRTGVDNICRI
LEU1_PASMU       TSALHVEAKLRRT-------FEDVVDMAINAVKRARNYTDDVEFSCEDAGRTGVDNICRI
LEU1_HAEIE       SSALHVEAKLKRS-------FDDVVGMAVAAVKRARNYTDDVEFSCEDAGRTGIDNICRI
LEU1_PSEA6       TSDIHVANKLRKS-------QDEVVEMAVNAIKHAGRYTDDIEFSCEDAGRTPIDYLCRM
LEU1_CAMJD       TSTLHIQDKLKKD-------FDEILSMAKRAIIRARSYTDDVEFSCEDAGRTPIDNLCFM
LEU1_OLSUV       VSPQHLADKLRIS-------EDECVERAIRCVRYAKRYVEDVQFYAEDAGRADQGFLERV
LEU1_PARD8       TSDSHIKYKFNST-------REEIIERAIAATKYAKKYVEDVEFYCEDAGRTDNEYLARV
                  *  :    :                               :::   *. *:    :   

LEU1_CROS5       LETAIAAGATTVNIPDTVGYTTPSEFGALIKGIKDNVPN---IDQAIISVHGHDDLGLAV
LEU1_RIPO1       LERAIAAGATTINIPDTVGYTTPSEFGALIGGIKQNVPN---IDQAIISVHGHNDLGLAV
LEU1_GLOC7       LERAIAAGATTVNIPDTVGYLTPSEFGQLIRGIKENVPN---IDQAIISVHGHNDLGLAV
LEU1_NOSS1       LERAIAAGATTINIPDTVGYTTPSEFGAIIKGIKENVPN---IDQAIISVHGHNDLGLAV
LEU1_MICAE       LERAIAAGATTVNIPDTVGYTTPSEFGALIRGIKENVPN---IDQAIISVHGHDDLGLAV
LEU1_MICAN       LERAIAAGATTVNIPDTVGYTTPSEFGALIRGIKENVPN---IDQAIISVHGHDDLGLAV
LEU1_SYNY3       LEAAISAGATTINIPDTVGYTTPAEYGALIKGIADNVPN---IDQAIISVHGHNDLGLAV
LEU1_SYNP2       LEAVIDAGATTVNIPDTVGYTTPAEFGALIKGIKENVPN---IDRAIISVHGHNDLGLAV
LEU1_TRIEI       LEKAIAAGATTVNIPDTVGYTTPAEFGGLIRGIKENVPN---IDQAIISVHGHNDLGLAV
LEU1_THEEB       LERVIDAGATTVNIPDTVGYTTPAEFGALIKGIKENVPN---IDRAVISVHGHNDLGLAV
LEU1_PROM0       IQLAISAGATTINIPDTVGFTTPSEFGNLIADINKNVPN---IDEAVISVHGHNDLGLAV
LEU1_PROMS       IQLAISAGATTINIPDTVGFTTPSEFGNLIADINKNVPN---INEAVISVHGHNDLGLAV
LEU1_PROM9       IQLAISAGATTINIPDTVGFTTPSEFGKLISDINKNVPN---IDEAVISVHGHNDLGLAV
LEU1_PROM2       IQLAISAGATTINIPDTVGFTTPNEFGKLISDINKNVPN---IDEAVISVHGHNDLGLAV
LEU1_PROM5       IQLAITSGATTINIPDTVGFTTPSEFGKLIFDINKNVPN---IDEAVISVHGHNDLGLAV
LEU1_PROMP       IQLAITSGATTINIPDTVGFTTPSEFGKLIFDINKNVPN---IDEAIISVHGHNDLGLAV
LEU1_PROM4       IELAISAGAGTINIPDTVGYITPSEFGELIQGIDANVPN---IDEAILSVHGHNDLGLAV
LEU1_PROMA       IESAIAAGAGTINIPDTVGYITPAEFGDLIIGINKNVSN---IDESILSVHGHNDLGLAV
LEU1_PROMT       IELAISSGANTINIPDTVGYITPSEFGDLILNINKNVPN---INEAVLSVHGHNDLGLAV
LEU1_SYNS9       IEAAIAAGATTINIPDTVGYTTPSEFGGLIAGINQHVPN---IDEAVISVHGHNDLGLAV
LEU1_SYNSC       IEAAIAAGATTINIPDTVGYTTPSEFGALIAGINQHVPN---IGEAVISVHGHNDLGLAV
LEU1_SYNPX       IEAAIAAGATTINIPDTVGYTTPSEFGDLIAGINRYVPN---IGEAVLSVHGHNDLGLAV
LEU1_PROMM       IEAAIAAGAGTINIPDTVGFTTPSEFGALIAGIDCHVPN---MNEAVISVHGHNDLGLAV
LEU1_SYNPW       IEAAINAGASTINIPDTVGYTTPAEFGALIAGIDQHVPN---ISEAVLSVHGHNDLGLAV
LEU1_SYNS3       IEAAISAGASTVNIPDTVGYTTPTEFGRLIEGINRNVPN---IDEAVISVHGHNDLGLAV
LEU1_SYNR3       IEAAIEAGATTINIPDTVGYSTPAEFGALIAGIDAHVPN---IGQAVISVHGHNDLGLAV
LEU1_GLOVI       LEAAIAAGATTVNIPDTVGYLTPAEFGGLIRGITQNVRG---IERAVISVHCHNDLGLAV
LEU1_HUNT2       IEAAIDNGATVINIPDTVGYATPIEFGELIQKIRKNVRN---IDKAIISVHCHNDLGMAV
LEU1_UNCTG       VEAVIDAGATTVNIPDTVGYTTPIEFGNKIAEIKRRVPN---VNKAIISVHCHNDLGLAV
LEU1_DESRM       FQEVIKAGATVINVPDTVGYTTPGEYAQFIRDILEKTPG---MEKIVLSVHCHDDLGLAV
LEU1_PELTS       LAAAIEAGATVINIPDTVGYAVPEEWGKFINTIYHKVPG---IEKVIVSVHCHNDLGMAV
LEU1_DESAP       LAAVIAAGATTVNIPDTVGYAMPDEFGAFIAYIMDHTPG---IENVVVSVHCHNDLGLAV
LEU1_CARHZ       VEAAVKAGATTINIPDTVGYAEPEEFGEFICKILEKVPV---MDRAVLSVHCHDDLGLAV
LEU1_HELMI       FSAAIEAGATTINIPDTVGYATPQEFGAFIKAIINGTPN---IDKAIVSVHCHNDLGLAV
LEU1_CLOK5       LEAVIEAGADVVNIPDTVGYTTPVEYGAFIRGIKENVKN---IEDAIISVHCHNDLGLAV
LEU1_RUMCH       VEAVIKAGATTVNIPDTVGYSTPLEFGRLIRNIRNNVPN---IDKADISVHCHNDLGLAV
LEU1_HALOH       FERVINAGAKVINIPDTVGYAIPEEFGKLIRDIKENVSN---IDKVDISVHCHNDLGLAV
LEU1_DICT6       FEAVIDAGATVINIPDTVGYALPWEFGDLIRRLKENIKN---IDKAIVSVHCHNDLGLAT
LEU1_DICTD       FEAVIEAGATVINVPDTVGYALPWEFGELIRRLKENIRN---IDKARVSVHCHNDLGLAT
LEU1_PYRAB       YEAVIDAGATVINVPDTVGYATPEEFYELVRYLRRNISN---IKGVQISVHCHDDLGLAV
LEU1_PYRFU       YEAVIDAGATTINVPDTVGYTTPEEFYELIRYLKRNITN---LNGVTISVHCHNDLGLAV
LEU1_STRM5       SRAAISAGATTINLPDTVGFTTPEEIREMFQQVIAGVADVPNAANVIFSAHCHNDLGLAV
LEU1_STRMK       ARVAIAAGATTINLPDTVGFTTPEEIRAMFQQVIAGVADVPNAANVIFSAHCHNDLGLAV
LEU1_XANOR       TRVAVAAGATTINLPDTVGFTTPEEIRGMFSRLIASVE---GADKVIFSAHCHNDLGLAV
LEU1_XANCP       TRVAIAAGATTINLPDTVGFTTPEEIRGMFSRLIASVE---GAEKVIFSTHCHNDLGLAA
LEU1_XYLFA       TRVAIAAGATTINLPDTVGFSTPEEIRNMFTRIIANVE---GANKVIFSAHCHDDLGLAV
LEU1_ACIFD       LQVAVDEGASTLNIPDTVGYGIPWDFARMVESVRREVA-----GSYVISCHCHNDLGLAT
LEU1_SALRM       VQAAAEAGATTINIPDTTGYCAPSEYTDLLETVVDCLPD---PDAVTLSTHCHDDLGLAT
LEU1_LEPIN       CEAVIAAGATTINIPDTVGYTTPAEYGGLFKFLLSNVR---GAEKIIFSAHCHNDLGLAT
LEU1_DEIRA       FKAAVEAGATTINVPDTVGYTTPEEMRKLFAYLKAKL-----PAHVILSSHCHDDLGMAV
LEU1_CUPNH       LEGVIAEGATTINLPDTVGYAVPEGYAELIRSVRERIPN---SDKAIWSVHCHNDLGMAV
LEU1_CUPPJ       LEGVIAEGATTINLPDTVGYAVPEGYADLIRSVRERIPN---SDKAVWSVHCHNDLGMAV
LEU1_CUPMC       LEGVIAEGATTINLPDTVGYAVPEGYAELIRSVRERIPN---SDKAVWSVHCHNDLGMAV
LEU11_RALSO      LEGVIAEGATTINLPDTVGYAVPEGYAALIRSVRERIPN---SDKAIWSVHCHNDLGMAV
LEU1_BURCM       LEAVIAEGATTINIADTVGYGVPELYGNLVKTLRERIPN---SDKAIFSVHCHNDLGMAV
LEU1_BURVG       LEAVIAEGATTINIADTVGYGVPELYGNLVKTLRERIPN---SDKAIFSVHCHNDLGMAV
LEU1_BURL3       LEAVIAEGATTINIADTVGYGVPELYGNLVKTLRERIPN---SDKAIFSVHCHNDLGMAV
LEU1_BURM1       LEGVIAEGATTINITDTVGYGVPEMYGNLVKTLRERIPN---SDKAIFSVHCHNDLGMAV
LEU1_BURP6       LEAVIAEGATTINIADTVGYGVPELYGNLVKTLRERIPN---SDKAIFSVHCHNDLGMAV
LEU1_PARP8       LEAVIAEGATTINIADTVGYGVPELYGNLVKTLRERIPN---SDKAVFSVHCHNDLGMAV
LEU1_POLNS       VEAVINEGASTINIPDTVGYATPELYGEFIKTLRTRVPN---SDKAVWSVHCHNDLGMAV
LEU1_POLAQ       VEAVINEGASTINIPDTVGYATPELYGDFIKTLRTRVPN---SDKAVWSVHCHNDLGMAV
LEU1_ACISJ       IETVIAEGATTINVPDTVGYAIPELYGNFIKNLRERIPN---SDKAIWSVHCHNDLGMAV
LEU1_ACIAC       LEAVIAEGATTINVPDTVGYAIPELYGNFIRNLRERIPN---SDKAVWSVHCHNDLGMAV
LEU1_POLNA       IEAVINEGATTINVPDTVGYAIPELYGNFIRNLRERIPN---SDKAVWSVHCHNDLGMAV
LEU1_POLSJ       LEAVIDEGATTINVPDTVGYAVPELYGHFIKTLRERVPN---SDKAIWSVHCHNDLGMAV
LEU1_VARPS       LETVINEGATTINVPDTVGYAIPELYGNFIKMLRERVPN---SDKAIWSVHCHNDLGMAV
LEU1_RHOFT       IEAAINEGATTINVPDTVGYAIPELYGTFIKTLRERVPN---SDKAIWSVHCHNDLGMAV
LEU1_VEREI       IEAAIAEGATTINVPDTVGYAIPELYGNFIKMLRERVPN---SDKAIWSVHCHNDLGMAV
LEU1_LEPCP       LEAVIDEGATTLNIPDTVGYAIPELYGNFIRNLRERVPN---SDKAIWSVHCHNDLGMAV
LEU1_METPP       IEAVINEGATTINVPDTVGYGIPELYGNFIRTLRERVPN---SDKAVWSVHCHNDLGMAV
LEU1_CHRVO       FGEVIKAGATTLNVPDTVGYAVPRLTEAFFRELIARTPG---GDKVVWSAHCHNDLGMAV
LEU1_THIDA       FDEVIKAGAKTINVPDTVGYSIPALWGERMKALIERVPG---SDKVIWSTHCHNDLGMAV
LEU1_NEIMB       CGAVIEAGATTINIPDTVGYSIPYKTEEFFRELIAKTPN---GGKVVWSAHCHNDLGLAV
LEU1_NEIG1       CGAVIEAGATTINIPDTVGYSIPYKTEEFFRELIAKTPN---GGKVVWSAHCHNDLGLAV
LEU1_AROAE       FEAVIKAGAKTINVPDTVGYNVPEQYAHTIRTLIERVPG---ADKVVWSVHCHNDLGLAV
LEU1_DECAR       FEEVIKAGATTINVPDTVGYNIPSQYAETMRQLIERVPN---SDKVVWSVHCHNDLGLAV
LEU1_NITEC       LEAVIDAGARTLNIPDTVGYTMPDQFGGLIRTLRERIPN---SDKAVFSVHCHNDLGLAV
LEU1_NITEU       LEAVIDAGARTLNIPDTVGYTMPDQFGGLIRTLRERIPN---SDKAIFSVHCHNDLGLAV
LEU1_NITMU       LEAVIDAGAGTVNIPDTVGYTMPQQFGELIRTLRERIPN---SDKVIFSVHCHNDLGLAV
LEU1_METCA       LEAVIDAGATTLNIPDTVGYAFPEQFGHMIGRLIERIPN---SDKAVFSVHCHNDLGLAV
LEU1_NITOC       LEAVIAAGARTVNIPDTVGYNLPEQFAQLIRTLRERVSN---SDKAIFSVHCHNDLGMAV
LEU1_RUTMC       IEATINAGATTINIPDTVGYNIPHQFGVTIKSLIGRVPN---SDKAIFSAHCHNDLGLAV
LEU1_VESOH       IEAVIKAGATTINIPDTVGYNIPHQFGATIKSLIERIPN---SDKAIFSAHCHNDLGLAV
LEU11_HYDCU      IEAAIDAGATTINIPDTVGYNVPEQFGELFHQLLNRIPN---ADKAIFSAHCHNDLGLAV
LEU1_BRASB       VEAAIKAGATTINIPDTVGYAVPEEYYDLFKRVRETVPN---SDKAVFSVHCHNDLGMAV
LEU1_BRASO       VEAAIKAGASTINIPDTVGYAVPEEYYDLFKRVRETVPN---SDKAVFSVHCHNDLGMAV
LEU1_RHOP5       VEAAIKAGASTINIPDTVGYSVPEEYYDLFKRVRENVPN---SDKAIFSVHCHDDLGMAV
LEU1_RHOPB       VEAAIKAGATTINIPDTVGYSVPEEYFDLFKRVRENVPN---SDKAIFSVHCHDDLGMAV
LEU1_RHOPT       IEAAIKAGATTINLPDTVGYAVPEEYRELFRKVRETVPN---SDKARFSVHCHNDLGMAV
LEU1_RHOP2       IEAAIKAGATTINLPDTVGYAVPEEYREMFRKVRETVPN---SDKARFSVHCHNDLGMAV
LEU1_RHOPS       IEAAIKAGATTINLPDTVGYAVPEEYREMFRKVRETVPN---ADKARFSVHCHDDLGMAV
LEU1_BRADU       VEAVIKAGATTVNIPDTVGYTVPEEYTHFMKTLIERVPN---SDKAVFSVHCHNDLGMAV
LEU1_METNO       VEMAIKMGATTINLPDTVGYATPDEYRAMFRSVRERVPN---ADRAIFSVHCHNDLGLAI
LEU1_METPB       VEAAIRSGATTINLPDTVGYATPQEYGAMFRQVRERVPN---SDKAIFSVHCHNDLGLAV
LEU1_NITHX       VETAIAAGATTVNLPDTVGYAVPDEYRRMFRTIRERVPN---ADKAIFSVHCHDDLGLAV
LEU1_NITWN       VEAAIAAGATTINLPDTVGYAVPDEYRRMFKTIRERVPS---ADKAIFSVHCHDDLGLAV
LEU1_OLICO       VETAIAAGATTINLPDTVGYAVPEEYRRMFKVIRERVPN---ADKAVFSVHCHDDLGLAV
LEU1_CAUVN       VEAAIKAGATTINLPDTVGYSYPSEYGELFRDVITSVPG---ADKAIFSAHCHNDLGLAV
LEU1_CAUSK       IETAIKAGATTINLPDTVGYTYPSEYADLFSWMTQNVEG---ADKVIFSTHCHNDLGLAV
LEU1_DESMR       CERAINAGATILNIPDTVGYAQPAEFAELIRHLMTTVRG---AGGVTFAVHCHNDLGLAV
LEU1_DESVM       FEAVINAGATTINVPDTVGYAQPEEFGRLIRYVIENTPN---SHKAVFSVHCHNDLGMGV
LEU1_SYNAS       VEAVIAAGASTVNIPDTVGYAIPQEFGELIAYLRANVPN---ISQAIISVHCHNDLGLAV
LEU1_NITSB       ILAVIEAGAGTINIPDTVGYRFPHEMGEMIKELHETIQ-----DRAVISVHCHNDLGLAV
LEU1_WOLSU       LAAVIEAGAGTLNIPDTVGYRLPHEMGAIIKELHEFVG-----NRAILSVHCHNDLGLAV
LEU1_ARCB4       MDAVIGAGAKTINLPDTVGYRLPTELGAMVKELSAYAG-----DRAIISVHNHNDLGLAT
LEU1_CAMFF       CAAVVEAGARTLNLPDTVGFRMPDEIYNMVKSMVDFIG-----DRAIISVHNHNDLGLAV
LEU1_CAMC1       CEAAINAGAKTINIPDTVGYLYPEEITARISEIVKFIG-----DRAVVSVHNHNDLGMAT
LEU1_CAMHC       VEAAINAGATTINLPDTVGYRLPSEMSYMIGELVKFVG-----DRAVISSHCHDDLGMSV
LEU1_AQUAE       IETAIKHGATVINIPDTVGYAIPEEFGQLIEDIMNNVPN---IDKVILSVHCHDDLGLAT
LEU1_METI4       IQKVIEAGATTVNIPDTVGYAVPEEFASLIRYLFDHVQD---IDKVVVSVHCHNDLGLAV
LEU1_RHOBA       VEAAIDAGATTINVPDTVGYTTPGEIYDRFKMLRDRVPN---MDKAVLSTHCHDDLGMAV
LEU1_BACVZ       VEEVIDAGASVINLPDTVGYLTPDEYGNIFKYMKEHVPN---ISRVKLSAHCHDDLGMAV
LEU1_BACSU       VEKVIDAGASVINLPDTVGYLAPAEYGNIFKYMKENVPN---IHKAKLSAHCHDDLGMAV
LEU1_BACLD       VSEVIAAGADVVNLPDTVGYLAPAEYGNIFRYIKENARN---ADKVQLSAHCHDDLGMAV
LEU11_BACP2      VEKVIDAGASVINLPDTVGYLAPKEYGNIFKYMKEHVPN---IDRVNLSAHCHDDLGMAV
LEU1_GEOKA       VAEVIKAGASVINIPDTVGYITPKEYGEIFLYLQNNVPN---IENVSLSAHCHDDLGMAV
LEU1_GEOSE       VAEVIKAGASVINIPDTVGYITPKEYGEIFLYLQNNVQN---IENVSLSAHCHDDLGMAV
LEU1_GEOTN       VTEVIKAGASVINIPDTVGYITPKEYGEIFLYLRNNVPN---IENISLSAHCHDDLGMAV
LEU1_GEOSW       ITEVIKAGATVINIPDTVGYITPKEYGNIFTFLSNNVPN---IEKVSLSAHCHDDLGMAV
LEU1_ANOFW       VEKVIEAGANVINIPDTVGYITPKQYGDIFSFLKKNVRN---IEKISLSAHCHDDLGMAV
LEU1_BACHD       IEAVIQAGATVINLPDTVGYTTPQEIKRMFQYMKQNVPS---IDKVSLSTHNHDDLGMAV
LEU1_BACSK       IEAAIDAGASVINLPDTVGYRTPEEISKLFEFVTENVKN---IDRAILSTHNHDDLGMGV
LEU1_LYSSC       MNEVVTAGATTINVPDTVGYASPYEYGALFKYLLENVKG---ADKVKFSAHCHDDLGMAT
LEU1_OCEIH       IEKVIEAGATVINLPDTVGYTTPEEYGKLFRFIKETVPN---INQVALSCHCHNDLGMAV
LEU1_BACCQ       VEVAIRAGANVINIPDTVGYTNPEEYYSLFKYLQESVPS---YEKAIFSCHCHDDLGMAV
LEU1_BACMK       VEVAIRAGANVINIPDTVGYTNPEEYYSLFKYLQESVPS---YEKAIFSCHCHDDLGMAV
LEU1_BACCN       VEVAIRAGADVINIPDTVGYTHPEEYYSLFQYLQESVPS---YEKAIFSCHCHDDLGMAV
LEU1_LACLA       VQTAVDAGATYINIPDTVGYTTPEEYGKIFKFLIDNTKS---DREIIFSPHCHDDLGMAV
LEU1_LACLS       VQTAVDAGATYINIPDTVGYTTPEEYGKIFKMLIDNIKA---DREIIFSPHCHDDLGMAV
LEU1_STRG3       VQTAVDAGATYINIPDTVGFTTPEEYGNIFKYLIENTKS---DREIIFSPHCHDDLGMAT
LEU1_STAAR       VQTAVDAGATVINIPDTVGYSYHDEYAHIFKTLTESVTS---SNEIIYSAHCHDDLGMAV
LEU1_STAHJ       VQMAVDCGATIINIPDTVGYSYPNEYGRIFKTLIENINS---KQDITYSAHCHDDLGMAV
LEU1_STAES       VQTAINAGATIINIPDTVGFSYPTEYGEIFKQLTQAVKS---NSKIIFSAHCHDDLGMAV
LEU1_STAS1       VQTAVDAGASVINIPDTVGFSYPKEYGEIFKTLQESVHA---DHDVIYSAHCHDDLGLAV
LEU1_STACT       VQTAVDAGASIINIPDTVGFSYPSEFGNIFKVLIENVKS---DHEVTYSAHCHDDLGLAV
LEU1_LISMO       VQTAIDAGATVINIPDTVGYTNPTEFGQLFQDLRREIKQ---FDDITFASHCHDDLGMAT
LEU1_LISIN       VQTAIDAGATVINIPDTVGYTNPTEFGQLFQDLRREIKQ---FDDIIFASHCHDDLGMAT
LEU1_LISMH       VQTAIDAGATVINIPDTVGYTNPTEFGQLFQDLRREIKQ---FDDIIFASHCHDDLGMAT
LEU1_LISW6       VQTAIDAGATVINIPDTVGYTNPTEFGQLFQDLRREIKQ---FDDIIFASHCHDDLGMAT
LEU1_BREBN       VEAVIKAGATTVNIPDTVGYMTPYQYGNIFRELKKRVPS---TDLIRLSCHCHDDLGMAV
LEU1_THEP1       YKTAIEAGATTINVPDTVGYALPDEFGELIKTLREGVPG-IEN--VDLSVHCHNDLGLAV
LEU1_THENN       YRTAIESGATTINVPDTVGYALPDEFGELIRTLKEGVPG-IEN--VDLSVHCHNDLGLAV
LEU1_SEDSS       VKTAIECGATSINIPDTVGYAVPKEFGQLISFLVEQVPQ-FSDGSVDLSVHCHNDLGLAL
LEU1_GEOS4       IEAVVKAGATMINVPDTVGYAVPDEFGELIRKINERLKN-LND-QVILSVHCHNDLGLAT
LEU1_KLEP3       VEAAINAGATTINIPDTVGYTMPFEYANIISGLYDRVPN---IDKAIISVHTHDDLGIAV
LEU1_ENT38       VEAAINAGAKTINIPDTVGYTMPFEFSNIITGLYERVPN---IDQAIISVHTHDDLGLAV
LEU1_SALNS       VEAAINAGARTINIPDTVGYTMPFEFAGIISGLYERVPN---IDKAIISVHTHDDLGIAV
LEU1_SALAR       VEAAINAGARTINIPDTVGYTMPFEFARIISGLYERVPN---IDNAIISVHTHDDLGLAV
LEU1_CITK8       VEAAINAGAKTINIPDTVGYTMPFEFGGIISGLYERVPN---IDKAIISVHTHDDLGLGV
LEU1_CROS8       VEAAINAGATTINIPDTVGYTLPFEFSNIISGLYERVPN---IDKAVISVHTHDDLGMAV
LEU1_ECOLI       VEAAINAGATTINIPDTVGYTMPFEFAGIISGLYERVPN---IDKAIISVHTHDDLGLAV
LEU1_ERWT9       VEAAINAGATTINIPDTVGYTLPYEYANIFSALRARVPN---IDKAILSVHTHDDLGMAV
LEU1_YERPS       VEAAITAGATTINIPDTVGYTTPYQFGGIITDLYERVPN---IDKAIISVHCHDDLGMSV
LEU1_YERE8       VEAAINAGATTINIPDTVGYTTPYQFGGIITDLYQRVPN---IDKAIISVHCHDDLGMSV
LEU1_SERP5       VEAAINAGATTINIPDTVGYTTPNQFGGIITTLYDRVPN---IDKAIISVHCHDDLGMAV
LEU1_PECCP       VEAAINAGARTINIPDTVGYTMPHEFGNIISSLYQHVPN---IDKAIISVHTHDDLGLAV
LEU1_SODGM       VEATIKAGARTINIPDTVGYTTPNQFGGIISSLYQHVPN---IDKAIISVHCHDDLGMAV
LEU1_EDWI9       VEAAIDAGAKTVNIPDTVGYTTPYQFGGIIHTLFERVPN---IDKAVISVHCHDDLGMAC
LEU1_PHOLL       VENAIKAGATTINIPDTVGYTTPYQFGGIITNLIERVPN---IDKAIISVHCHDDLGMSV
LEU1_PROMH       VESAINAGATTINIPDTVGYTTPYQFGGIITNLFERVPN---IDKAVISVHCHDDLGMAV
LEU1_BLOPB       VEIAIQSGASTINIPDTVGYTTPYQFGQIITSLYNRVPI---IDKAIISVHCHDDLGMAV
LEU1_BLOFL       VEIAIKSGARTINIPDTVGYTIPNQFSEIIYSLYKKVPI---IDQAIISVHCHDDLGMAV
LEU1_BUCAI       VETLIKSGVKTINIPDTVGYTVPNELSCIIKNLFERVPN---IHKSIISVHCHDDLGMAV
LEU1_BUCDN       VEKLIKAGVKTINIPDTVGYTIPNELSNIIKNLFERVPN---IHKSIISVHCHNDLGMAV
LEU1_BUCAP       VEQLIKAGVKTINIPDTVGYTVPNELSTIIHNLFKRVPN---IDQSIISVHCHNDLGMAV
LEU1_BUCRP       VEKLINAGVKTINIPDTVGYTVPNELSSIIHNLFQRVPN---IDKSIISVHCHNDLGMAV
LEU1_BUCUN       VEKLISCGVKTINIPDTVGYTIPNELSLIIKNLFERVPN---IHKSTISVHCHNDLGMAV
LEU1_BUCUM       VEKLISCGVKTINIPDTVGYTIPNELSFIIKNLFEKVPN---IHKSTISVHCHDDLGMAV
LEU1_BUCUE       VEKLINSGVKTINIPDTVGYSIPNELSFIIKNLFQRVPN---IDKAVISVHCHDDLGMAV
LEU1_BUCML       VEKLIYHGVKTINIPDTVGYTVPNELSYIIKNLLERVPN---IHKSIISVHCHDDLGMAV
LEU1_BUCCC       IEAVIKAGATTVNIPDTVGYTTPTQFKKIITMLFNHVKN---IHQAIISVHCHNDLGMAV
LEU1_AERHH       VEAAIKAGARTINIPDTVGYTVPTEFSGIIQTLFNRVPN---IDQAIISVHCHDDLGLSV
LEU1_AERS4       VEAAIKAGARTINIPDTVGYTVPTEFSGIIQTLFNRVPN---IDKAIISVHCHDDLGLSV
LEU1_TOLAT       VEAAINAGARTINIPDTVGYTIPSEFGGIIHNLFNRVPN---IDKAVISVHCHDDLGLSV
LEU1_SHESR       VEAAIHAGARTINIPDTVGYTVPSEFGGIIQTLFNRVPN---IDQAIISVHCHDDLGMSV
LEU1_SHEON       VEAAIHAGARTINIPDTVGYTVPSEFGSIIQTLFNRVPN---IDQAIISVHCHDDLGLSV
LEU1_SHEB8       VEAAILAGARTINIPDTVGYTVPSEFGNIIQTLFNRVPN---IDQAVISVHCHDDLGLSV
LEU1_SHEAM       VEAAISAGARTINIPDTVGYTVPSEFGGIIQTLFNRVPN---IDQAVISVHCHDDLGLSV
LEU1_SHEFN       VEEAIKAGARTINIPDTVGYTVPSEFGGIIQTLFNRVPN---IDQAVISVHCHDDLGLSV
LEU1_SHEHH       VEEAIKAGARTINIPDTVGYTVPSEFGGIIQTLFNRVPN---IDQAVISVHCHDDLGLSV
LEU1_SHEPA       VEEAIKAGARTINIPDTVGYTVPSEFGGIIQTLFNRVPN---IDQAVISVHCHDDLGLSV
LEU1_SHEPW       VEEAIKAGARTINIPDTVGYTVPSEFGGIIQTLFNRVPN---IDQAVISVHCHDDLGLSV
LEU1_SHESH       VEEAIKAGARTINIPDTVGYTIPSEFGGIIETLFNRVPN---IDQAIISVHCHDDLGLSV
LEU1_SHEWM       VEEAIKAGAKTINIPDTVGYTVPSEFGGIIETLFNRVPN---IDQAVISVHCHDDLGLSV
LEU1_SHELP       VEAAIKAGAKTINIPDTVGYTVPSEFGGIIQNLFDRVPN---IDQAVISVHCHDDLGLSV
LEU1_SHEDO       VEAAITAGARTINIPDTVGYTIPSEFSTIIETLFNRVPN---IDQAIISVHCHDDLGLSV
LEU1_PSYIN       VEEAIKAGATTINIPDTVGYTYPSEFGGIIKTLFNRVPN---IDQAIISVHCHDDLGMSV
LEU1_ALIFM       VEAAINAGANTINIPDTVGYTVPGEFGGIVQTLFNRVPN---IDKAIISVHCHDDLGMSV
LEU1_ALISL       VEAAINAGANTINIPDTVGYTIPGEFGGIIQTLFNRVPN---IDKAIISVHCHDDLGMSV
LEU1_VIBCM       VEAAINAGARTINIPDTVGYTVPSEFGGIIQTLFNRVPN---IDKAIISVHCHDDLGMSV
LEU1_VIBVU       VEAAINAGARTINIPDTVGYTVPSEFGGIIQTLFNRVPN---IDKAIISVHCHDDLGMSV
LEU1_VIBPA       VEAAIDAGASTINIPDTVGYTVPSEFGGIIQTLFNRVPN---IDKAIISVHCHDDLGMSV
LEU1_VIBTL       VEAAINAGAKTINIPDTVGYTVPNEFGGIIKTLFDRVPN---IDQAIISVHCHDDLGMSV
LEU1_PHOPR       VEAAINAGARTINIPDTVGYTLPSEFGGIVAQLFNRVPN---IDKAIISVHCHDDLGMSV
LEU1_HISS2       VEAAIKAGATTVNIPDTVGFCLPTEYGNIIDQVMNRVPN---IDKAVISVHCHNDLGMAT
LEU1_PASMU       VEAAIKAGATTVNIPDTVGYCLPYQYGDIIANVMNRVPN---IDKAIISVHCHNDLGMAT
LEU1_HAEIE       VEAAINAGATTVNIPDTVGFCLPNEYGNIIAQVRNRVPN---IDKAVISVHCHNDLGMAT
LEU1_PSEA6       VESAINAGATTVNIPDTVGYTTPTEFGGIIQNLFNRVPN---IDKATISVHCHNDLGLAV
LEU1_CAMJD       VENAIKAGAKTINIPDTVGYTLPSEFANIIKILFNKVPN---IDKAIISVHCHNDLGMAT
LEU1_OLSUV       IQAVIEAGATVVNIPDTTGYQMPAAFGARIKGLCDNVRG---IENVTIAVHTHNDLGMAT
LEU1_PARD8       VEAVIKAGATVVNIPDTTGYCLPDEYGAKIKYLMEHVDG---VHNAILSTHCHNDLGMAT
                        *.  :*:.**.*:         .  :               : * *:***:. 

LEU1_CROS5       ANFLEAL-KNGARQLECTINGIGERAGNAALEELVMALHVRRQYFNPFLGRPVDSMEPLT
LEU1_RIPO1       ANFLEAV-KNGARQLECTINGIGERAGNAALEELVMALHVRRQYFNPFLGRPPESTEPLT
LEU1_GLOC7       ANFLEAV-KNGARQLECTINGIGERAGNAALEELVMALHVRRQYYNPFLGRPVDSTEPLT
LEU1_NOSS1       ANFLEAV-KNGARQLECTINGIGERAGNAALEELVMAMHVRRQYFNPFLGRHPDSEEALT
LEU1_MICAE       ANFLEAV-KNGARQLECTINGIGERAGNASLEELVMALHVRRSYFNPFLGRPAESTEPLT
LEU1_MICAN       ANFLEAV-KNGARQLECTINGIGERAGNASLEELVMALHVRRSYFNPFLGRPAESTEPLT
LEU1_SYNY3       ANFLEAV-KNGARQLECTINGIGERAGNAALEELVMALHVRRSYFNPFLGRPADSTAPLT
LEU1_SYNP2       ANFLEAV-KNGARQLECTINGIGERAGNAALEELVMALHVRRQYYNPFLGRPADSEAPLT
LEU1_TRIEI       ANFLEAV-KNGARQLECTINGIGERAGNAALEELVMAFHVRRQYFNPFFGRPPESETPLT
LEU1_THEEB       ANFLEAV-KNGARQLECTINGIGERAGNAALEELVMALYVRRQYFNPFLGRPPESEAPLT
LEU1_PROM0       ANFLEAV-KNGARQLECTINGIGERAGNASLEELVMALHVRKSFFNSFFKRNPDSPTPLT
LEU1_PROMS       ANFLEAV-KNGARQLECTINGIGERAGNASLEELVMALHVRKSFFNSFFKRNPDSPTPLT
LEU1_PROM9       ANFLEAV-KNGARQLECTINGIGERAGNASLEELVMALHVRKSFFNSFFKRNPDSPTPLT
LEU1_PROM2       ANFLEAV-KNGARQLECTINGIGERAGNASLEELVMALHVRKSFFNKFFNRNSDSPTPLT
LEU1_PROM5       ANFLEAA-KNGARQLECTINGIGERAGNASLEELVMALHVRKSFFNSFFGRSSDSPTPLT
LEU1_PROMP       ANFLEAA-KNGARQLECTINGIGERAGNASLEELVMALHVRKSFFNSFFGRSSDSPTPLT
LEU1_PROM4       ANFLEAI-KRGARQLECTINGIGERAGNAALEELVMALHVRRSFYNPFFGRDPESPTPLT
LEU1_PROMA       ANFLEAV-KNGARQLECTINGIGERAGNAALEELVMALHVRRRYFNPFFGKDSESPTPLT
LEU1_PROMT       ANFLEAV-KNGARQLECTINGIGERAGNAALEELIMALHVRRSYFNPFFGRPPESPTPLT
LEU1_SYNS9       ANFLEAV-KNGARQLECTINGIGERAGNASLEELVMAMHVRRRYFNPFLGRKEDSPTPLT
LEU1_SYNSC       ANFLEAV-KNGARQLECTINGIGERAGNASLEELVMALHVRRRYYNPFFGREEDSPTPLT
LEU1_SYNPX       ANFLEAV-KNGARQLECTINGIGERAGNASLEELVMALHVRRRYFNPFFGRDQDSPTPLS
LEU1_PROMM       ANFLEAV-KSGARQFECTINGIGERAGNAALEELVMALYVRRRYFNPFFGREPDSPTPLT
LEU1_SYNPW       ANFLEAV-KNGARQLECTINGIGERAGNAALEELVMALHVRRRYFNPFFGRAEDSPTPLT
LEU1_SYNS3       ANFLEAV-KSGARQLECTVNGIGERAGNAALEELVMAMHVRRRYFNPFFGRDEDSPTPLT
LEU1_SYNR3       ANFLEAV-KNGARQLECTINGIGERAGNASLEELVMALHVRRSYFNGYLGRAEDSSEPLT
LEU1_GLOVI       ANSLAAI-ENGARQIECTVNGIGERAGNCSLEEIVMALHVRRQFFNPIFGRPADSTVPLS
LEU1_HUNT2       ANSIVAA-MNGAQQIECTINGVGERAGNAALEEVVTHIAARKDYLGFETG----------
LEU1_UNCTG       ANSLSAI-ENGARQIECTINGIGERAGNTSLEEIAMTLKVRHHY-----------YNVKH
LEU1_DESRM       ANSLAAV-GAGARQVEGAINGIGERAGNAALEEVVMGLYTRKDY-----------YGLMT
LEU1_PELTS       ANSLAAV-MNGARQVEGAINGIGERAGNAAIEEMVMALYTRKDQ-----------YNLYT
LEU1_DESAP       ANSLAAV-RNGARQVECTVNGIGERAGNAALEEVVMGLFTRREK-----------YGLIT
LEU1_CARHZ       ANSLAAI-KNGARQVECTINGIGERAGNCSLEEIVMALYTRKDV-----------LPFYT
LEU1_HELMI       ANTLAAL-ENGALQVEGTINGIGERAGNASLEEVIMALYTRKPF-----------YNLET
LEU1_CLOK5       ANSLAAI-ESGAEQVECAINGLGERAGNAALEEIVMAISTRADS-----------FNCHT
LEU1_RUMCH       ANSLAAV-ENGAVQVECTINGLGERAGNAALEEIIMGINTRKDY-----------YDITH
LEU1_HALOH       ANSLAAV-ENGANQIEVAVNGIGERAGNTALEEIIMALYTRKDF-----------YNIGI
LEU1_DICT6       ANSLSAI-VNGAEQVECTINGLGERAGNAAMEEIVMAIKVRRLP-----------FEV--
LEU1_DICTD       ANSLSAI-VNGAEQVECTVNGLGERAGNAAMEEIVMAIKVRRLP-----------FEV--
LEU1_PYRAB       ANSLSAI-RAGADQVEVTVNGIGERAGNAALEEVIVALDVRRDF-----------YKVKT
LEU1_PYRFU       ANSLSAV-RAGADQVEVTVNGIGERAGNAALEEVVVALDVRKDF-----------YNVET
LEU1_STRM5       ANSLAAI-EGGARQVECTVNGIGERAGNCSLEEIAMVLKVRQAF----------YE-QDS
LEU1_STRMK       ANSLAAI-EGGARQVECTVNGIGERAGNCSLEEIAMVLKVRQAF----------YE-QDS
LEU1_XANOR       ANSLAAI-EGGARQVECTINGIGERAGNCALEEITMALKVRGAF----------YN-IDS
LEU1_XANCP       ANSLAAI-EGGARQVECTINGIGERAGNCALEEITMALKVRGAF----------YN-LDT
LEU1_XYLFA       ANSLAAI-EGGARQIECTINGIGERAGNCALEELTMVLKVRNAF----------YN-IDT
LEU1_ACIFD       ANSLAAV-AAGARQVECCINGIGERAGNAALEEVVMGLAIRSDV----------IGDVTT
LEU1_SALRM       ANTLAGI-RAGARQVECTINGIGERAGNAALEEIVMALTVRAD-----------AFDVTA
LEU1_LEPIN       ANSLAAV-QNGARQIECTINGIGERAGNTAMEEVVMAMRTRKDT----------FG-IQT
LEU1_DEIRA       ANSIAAA-EGGARQIECTINGIGERAGNASLEEIVMAFHTRRDV----------YG-YET
LEU1_CUPNH       ANSLAAVKMAGARQIECTINGLGERAGNTSLEEVVMAVKTRRD-----------YFDLDI
LEU1_CUPPJ       ANSLAAVKLGGARQIECTINGLGERAGNTSLEEVVMAVKTRRD-----------YFNLDV
LEU1_CUPMC       ANSLAAVKLGGARQIECTINGLGERAGNTSLEEVVMAVKTRRD-----------YFNMDV
LEU11_RALSO      ANSLAAVKLGGARQIECTINGLGERAGNTSLEEVVMAVKTRRD-----------YFNLDV
LEU1_BURCM       ANSLAGVKIGGARQVECTINGLGERAGNTSLEEIVMAVKTRKD-----------YFGLDV
LEU1_BURVG       ANSLAGVKIGGARQVECTINGLGERAGNTSLEEIVMAVKTRKD-----------YFGLDV
LEU1_BURL3       ANSLAGVKIGGARQIECTINGLGERAGNTSLEEIVMAVKTRKD-----------YFGLDV
LEU1_BURM1       ANSLAGVMIGGARQVECTINGLGERAGNTSLEEIVMAVKTRKD-----------YFGLDV
LEU1_BURP6       ANSLAGVKIGGARQVECTINGLGERAGNTSLEEIVMAVKTRKD-----------YFGLDL
LEU1_PARP8       ANSLAGVKIGGARQVECTINGLGERAGNTSLEEIVMAVRTRKD-----------YFGLDL
LEU1_POLNS       ANSLAGVKIGGARQIECTINGLGERAGNTALEEIVMSLRTRKD-----------YFDMVC
LEU1_POLAQ       ANSLAGVKIGGARQIECTINGLGERAGNTALEEIVMALRTRKD-----------YFDMVC
LEU1_ACISJ       ANSLAGVKIGGARQVECTINGLGERAGNCSLEEVVMAVKTRRD-----------YFGLDV
LEU1_ACIAC       ANSLAGVKIGGARQVECTINGLGERAGNCSLEEIVMAVKTRRD-----------YFGLEL
LEU1_POLNA       ANSLAGVKIGGARQVECTINGLGERAGNCSLEEVVMAVKTRKD-----------YFGLDI
LEU1_POLSJ       ANSLAGVMIGGARQVECTINGLGERAGNCSLEEIVMAVKTRKD-----------YFNLEM
LEU1_VARPS       ANSLAGVKIGGARQVECTINGLGERAGNCSLEEVVMAVKTRRD-----------YFGLDL
LEU1_RHOFT       ANSLAGVKIGGARQVECTINGLGERAGNCSLEEVVMAVKTRRD-----------YFGLDV
LEU1_VEREI       ANSLAGVKMGGARQVECTINGLGERAGNCSLEEVVMAVKTRRD-----------YFGLDL
LEU1_LEPCP       ANSLAGVKIGGARQVECTINGLGERAGNCSLEEVVMAVKTRRD-----------YFGLDL
LEU1_METPP       ANSLAGVKIGGARQIECTINGLGERAGNCSLEEVVMAVRTRRD-----------HFGLEV
LEU1_CHRVO       ANSLAAV-LGGARQVECTINGLGERAGNASLEEVVMAVKTRRD-----------VFGVDS
LEU1_THIDA       ANSLAAV-MNGARQVECTINGLGERAGNASLEEIVMAVRTRRD-----------VFGCDT
LEU1_NEIMB       ANSLAAL-KGGARQVECTVNGLGERAGNASVEEIVMALKVRHD-----------LFGLET
LEU1_NEIG1       ANSLAAL-KGGARQVECTVNGLGERAGNASVEEIVMALKVRHD-----------LFGLET
LEU1_AROAE       ANSLAAV-MAGARQVECTLNGLGERAGNAALEELVMAVRTRQD-----------VFPCDT
LEU1_DECAR       SNSLAAV-LCGARQVECTINGLGERAGNAALEEIVMAVRTRAD-----------VFPVET
LEU1_NITEC       ANSLSAV-MNGARQVECTINGLGERAGNAALEEVVMAVRTRQD-----------YFPCDT
LEU1_NITEU       ANSLSAV-MNGARQVECTINGLGERAGNAALEEIVMAVRTRQD-----------YFPCDT
LEU1_NITMU       ANSLSAV-MNGARQVECTVNGLGERAGNASLEEVVMAVRTRQD-----------FFPCDT
LEU1_METCA       ANSLAAV-LHGARQVECTINGLGERAGNAALEEIVMAVRTRKD-----------IFPCHT
LEU1_NITOC       ANSLAAV-MSGARQVECTINGLGERAGNAALEEVVMAVRTRQD-----------SFPCDT
LEU1_RUTMC       ANSLSAV-LNGARQVECTINGLGERAGNTSLEELVMAVRTRQD-----------IFDCDT
LEU1_VESOH       ANSLSAV-LNGARQVECTINGLGERAGNTSLEELVMAVRTRQD-----------IFDCDT
LEU11_HYDCU      ANSLAAV-KSGARQVECTINGLGERAGNTALEEVVMAVRTRQD-----------WFDVDT
LEU1_BRASB       ANSMAGI-RAGARQIECTINGIGERAGNAALEEVVMAMRVRND-----------KLPFWN
LEU1_BRASO       ANSMAGV-RAGARQIECTINGIGERAGNAALEEVVMAMRVRND-----------KLPFWN
LEU1_RHOP5       ANSLAGI-RGGARQIECTVNGIGERAGNTALEEVVMAMKVRND-----------KLPYWN
LEU1_RHOPB       ANSLAGI-RGGARQIECTVNGIGERAGNTALEEVVMAMRVRND-----------KLPFWN
LEU1_RHOPT       ANSMAGV-AGGARQIECTINGIGERAGNAALEEVVMAMRVRQD-----------KLPYWN
LEU1_RHOP2       ANSMAGV-AGGARQIECTINGIGERAGNAALEELVMAMRVRQD-----------KLPYWN
LEU1_RHOPS       ANSIAGV-QGGARQIECTINGIGERAGNAALEEVVMAMRVRQD-----------KVPYWN
LEU1_BRADU       ANSLAGV-VGGARQVECTINGIGERAGNAALEEIVMAINVRND-----------KFPYWN
LEU1_METNO       ANSLAGI-EGGARQVECTINGIGERAGNAALEEVVMALRTRAD-----------VLPYTT
LEU1_METPB       ANSLAGL-EGGARQIECTVNGIGERAGNAALEEIVMAIRTRAD-----------VMPYDT
LEU1_NITHX       ANSLAGV-EGGARQVESTINGIGERAGNAALEEVVMAIKTRGD-----------VMPYWC
LEU1_NITWN       ANSLAGV-EGGARQVESTINGIGERAGNAALEEVVMAIKTRAD-----------VMPYWC
LEU1_OLICO       ANSLAGV-EGGARQIECTINGIGERAGNAALEEVVMAIKTRGD-----------VMPYWC
LEU1_CAUVN       ANSIAAI-EGGARQVEVAINGIGERAGNAALEEIVMALRVRGD-----------HLPYGT
LEU1_CAUSK       ANSLAGV-QGGARQIECAINGLGERAGNAALEEVVMALKVRGD-----------KLPYET
LEU1_DESMR       ANTLAAL-HAGARQAEVTLSGIGERAGNASLEQVVMGLNTRPN-----------YYNLTT
LEU1_DESVM       ANTLAAL-KAGARQAEVTISGIGERAGNASLEEIVMALHTRRD-----------FYQLDC
LEU1_SYNAS       ANSLSAI-LNGARQVECTINGIGERAGNTAMEEVVMALRTRKD-----------LFGFYT
LEU1_NITSB       ANSLYSV-LNGARQVECTINGLGERAGNAALEEIVMAIKTRKDI----------FGDIDT
LEU1_WOLSU       ANSLYCI-QSGARQVECTVNGLGERAGNAALEEIVMAIKTRRDI----------FGGLDT
LEU1_ARCB4       ANTLAAV-LNGARQIEVTINGLGERAGNSALEEAVMAIKTRKDA----------FGDLYT
LEU1_CAMFF       ANTLASI-KAGARQVECTINGLGERAGNAALEEIVMTIRTRSDE----------FAPLYT
LEU1_CAMC1       ANSLAAI-KAGARQVEGTINGIGERAGNAALEEIVMAIKTRQDV----------FAPLYT
LEU1_CAMHC       ANTIACI-KAGARQIECTINGLGERAGNTALEEVVMAIKTRSDV----------FAPLYT
LEU1_AQUAE       ANSLTAV-KHGARQVECTINGIGERAGNAALEEVVMALKVRKDF----------FGDLYT
LEU1_METI4       SNSLAAI-KAGARQVEGTINGIGERAGNAALEEIIMALHTRPDA----------FGKIET
LEU1_RHOBA       ANSLAAV-DAGAGQIECTINGIGERAGNAALEELVMAMKTRQD-----------FYHCQT
LEU1_BACVZ       ANSLSAI-ENGADQIECAINGIGERAGNAALEEIAVALHVRND-----------AHQADS
LEU1_BACSU       ANSLAAI-ENGADQIECAVNGIGERAGNAALEEIAVALHTRKD-----------FYQVET
LEU1_BACLD       ANSLAAI-ENGADQVESVINGIGERAGNASLEEIAVALHIRKD-----------FYQAES
LEU11_BACP2      ANSLAAI-ENGADQIETAVNGIGERAGNAALEEIAVALHIRKD-----------FYQVES
LEU1_GEOKA       VNSLSAI-EHGATQVECTINGIGERAGNAALEEIAVALHIRKD-----------YYQVET
LEU1_GEOSE       VNSLSAI-EHGATQVECTINGIGERAGNAALEEIAVALHIRKD-----------YYQVET
LEU1_GEOTN       INSLSAI-EHGATQVECTINGIGERAGNAALEEIAVALHIRKD-----------YYQVET
LEU1_GEOSW       ANSLAAI-EHGATQIEGTINGIGERAGNAALEEIAVALYIRKD-----------YYQAET
LEU1_ANOFW       ANSLAAI-EAGATQIEGTINGIGERAGNAAIEEVAVALYIRKD-----------YYQAET
LEU1_BACHD       ANSLAAI-QGGADQVECTINGIGERAGNASLEEIAVALNIRKD-----------HYETET
LEU1_BACSK       ANSLAAI-SAGAGQVECTINGIGERAGNAALEEIAVALQIRSD-----------YYQAKT
LEU1_LYSSC       ANTLAAI-ENGAAQVEGTINGIGERAGNVALEEIAVALHIRKD-----------YYQVET
LEU1_OCEIH       ANSIAAV-ENGATQVEGTINGIGERAGNAALEEVAVALKIRSD-----------YYPFET
LEU1_BACCQ       ANSLAAV-EGGALQVEGTINGIGERAGNAALEEVAVALHIRKD-----------FYQAEP
LEU1_BACMK       ANSLAAV-EGGALQVEGTINGIGERAGNAALEEVAVALHIRKD-----------FYEAES
LEU1_BACCN       ANSLAAI-EGGALQVEGTINGIGERAGNAALEEVAVALHIRKD-----------HYKTQS
LEU1_LACLA       ANSLAAI-KAGAGRVEGTVNGIGERAGNAALEEIAVALHIRKD-----------FYQAQS
LEU1_LACLS       ANSLAAI-KAGAGRVEGTVNGIGERAGNAAIEEIAVALHIRKD-----------YYQAKS
LEU1_STRG3       ANTLAAI-KNGAGRVEGTVNGIGERAGNVALEEIAVALNIRED-----------YYQATS
LEU1_STAAR       SNSLAAI-EGGARRIEGTVNGIGERAGNAALEEVALALYIRND-----------HYGAQT
LEU1_STAHJ       ANSLAAI-ENGAKRIEGTVNGIGERAGNTAIEELALALYVRKD-----------HYGNET
LEU1_STAES       ANSLAAI-EGGARRIEGTVNGIGERAGNASLEEVALALYVRKD-----------HYGLES
LEU1_STAS1       ANSMAAI-ENGAKRIEGTLNGIGERAGNTALEEVALGLYVRQD-----------HYDNQT
LEU1_STACT       ANSMAAI-ENGATRIEGAVNGIGERAGNTALEEVALGLYVRRD-----------HYGIET
LEU1_LISMO       ANALAAI-ENGARRVEGTINGIGERAGNTALEEVAVALHIRKD-----------FYQAET
LEU1_LISIN       ANALAAI-ENGARRVEGTINGIGERAGNTALEEVAVALHIRKD-----------FYQAET
LEU1_LISMH       ANALAAI-ENGARRVEGTINGIGERAGNTALEEVAVALHIRKD-----------FYQAET
LEU1_LISW6       ANALAAI-ENGARRVEGTINGIGERAGNTALEEVAVALHIRKD-----------FYQAET
LEU1_BREBN       ANSLAAV-EGGATQVEGTINGIGERAGNAALEEVALALETRKD-----------YYQATT
LEU1_THEP1       ANSLAAV-QNGATQVEVTLNGIGERAGNCALEEFVMILKVRKD-----------KLPYET
LEU1_THENN       ANSIAAV-QNGATQVEVTLNGIGERAGNCALEEFVMALKVRKD-----------RLPYET
LEU1_SEDSS       ANSLAAV-RSGASQVEVTLNGIGERAGNCPMEELIMSLDVRKD-----------MFDVET
LEU1_GEOS4       ANTLSAV-RNGAEKVECTINGLGERAGNTSLEEVVMGLKVREN-----------HFKAST
LEU1_KLEP3       GNALAAV-HAGARQVEGAMNGIGERAGNCALEEVIMAIKVRKD-----------IMNVHT
LEU1_ENT38       GNAIAAV-HAGARQVEGAMNGIGERAGNCSLEEVIMAIKVRKD-----------IMNVQT
LEU1_SALNS       GNSLAAV-HAGARQVEGAMNGIGERAGNCALEEVIMAIKVRKD-----------IMNVHT
LEU1_SALAR       GNSLAAV-HAGARQVEGAMNGIGERAGNCALEEVIMAIKVRKD-----------IMNVHT
LEU1_CITK8       GNALAAV-HAGARQVEGAMNGIGERAGNCSLEEVIMAIKVRQD-----------ILNVHT
LEU1_CROS8       GNALAAV-QAGARQVEGTLNGIGERAGNCALEEVIMAIKLRQN-----------LMNVHT
LEU1_ECOLI       GNSLAAV-HAGARQVEGAMNGIGERAGNCSLEEVIMAIKVRKD-----------ILNVHT
LEU1_ERWT9       GNALAAV-NAGARQIEGAMNGLGERAGNCALEETIMAIKTRGQ-----------LMNVHT
LEU1_YERPS       ANSITAV-QAGARQVEGTINGLGERAGNCSLEEVIMAIKVRHE-----------MLGVHT
LEU1_YERE8       ANSITAV-QAGARQVEGTINGLGERAGNCSLEEVIMAIKVREN-----------MLGVHT
LEU1_SERP5       GNSIAAV-QAGARQVEGTLNGIGERAGNTSLEEVIMAIKVRQD-----------IMNVHT
LEU1_PECCP       GNAMAAV-HAGARQVEGTLNGIGERAGNCSLEEVIMAIKTRHN-----------ILNVHT
LEU1_SODGM       GNSIAAI-QSGARQVEGTLNGIGERAGNTALEEVIMAIKVRQD-----------LLNVHT
LEU1_EDWI9       ANSISAI-QSGARQVEGTLNGIGERAGNCALEEVIMAIRTRQD-----------LLRVHT
LEU1_PHOLL       ANSITAV-QSGARQIEGTINGLGERAGNCSLEEVIMAIKVRQQ-----------MLGVYT
LEU1_PROMH       ANSITAV-QAGARQVEGTINGLGERAGNCALEEVIMAIKVREQ-----------MMNVQT
LEU1_BLOPB       GNSISAI-QAGARQIEGTINGIGERAGNTALEEIIMAIKVRED-----------LLNVHT
LEU1_BLOFL       GNSISAI-QAGARQIEGTINGIGERAGNTALEEIIMAIKIRHD-----------LLHVYT
LEU1_BUCAI       GNSISAI-QAGARQIEGTINGIGERAGNTALEEIIMAIKVRED-----------ILSVST
LEU1_BUCDN       GNSISAI-QAGARQIEGTINGIGERAGNTALEEIIMAIKVRED-----------ILGVST
LEU1_BUCAP       GNSISAI-QAGARQIEGTINGIGERAGNTALEEVIMAIKVRED-----------ILGVST
LEU1_BUCRP       GNSISAI-QAGARQIEGTINGIGERAGNTALEEVIIAIKVRED-----------VLGVST
LEU1_BUCUN       GNSISAI-QAGARQIEGTINGIGERAGNTALEEVIMAIKVRED-----------ILGLST
LEU1_BUCUM       GNSISAI-QAGARQIEGTINGIGERAGNTALEEVIMAIKVRED-----------ILGVST
LEU1_BUCUE       GNSISAI-QAGARQIEGTINGIGERAGNTALEEVIMAIKVREK-----------NLGVYT
LEU1_BUCML       GNSISAI-QAGARQIEGTINGIGERAGNTALEEVIMAIKVRED-----------ILGVST
LEU1_BUCCC       ANSISAV-EAGVRQIEGTMNGLGERAGNAALEEVIMTLNVHKN-----------SLKVST
LEU1_AERHH       ANSIGAV-QMGARQIECTINGIGERAGNCSLEEVAMILKTRAD-----------LLGVHT
LEU1_AERS4       ANSIGAV-QMGARQIECTINGIGERAGNCSLEEVAMILKTRAD-----------LLGVHT
LEU1_TOLAT       ANSISAV-QMGARQVECTINGIGERAGNTSLEEVAMILRTRQD-----------LIGVHT
LEU1_SHESR       ANSITAV-QHGARQIECTMNGIGERAGNCSLEEIAMILATRKN-----------LLGVET
LEU1_SHEON       ANSITAV-QHGARQIECTMNGIGERAGNCSLEEIAMILATRKN-----------LLGFET
LEU1_SHEB8       ANSITAV-QHGARQIECTINGIGERAGNCSLEEIAMILATRKG-----------MLGLET
LEU1_SHEAM       ANSIAAV-QAGARQIECTVNGIGERAGNCSLEEIAMILATRKD-----------MLGLYT
LEU1_SHEFN       ANSIAAV-EMGARQVECTINGIGERAGNCSLEEIAMILATRKG-----------LLDLDC
LEU1_SHEHH       ANSITAV-QHGARQIECTVNGIGERAGNCSLEEIAMILSTRKG-----------ELGLET
LEU1_SHEPA       ANSITAV-QHGARQIECTVNGIGERAGNCSLEEIAMILSTRKG-----------ELGLET
LEU1_SHEPW       ANSITAV-QHGARQIECTVNGIGERAGNCSLEEIAMILSTRKG-----------ELGLET
LEU1_SHESH       ANSITAV-QQGARQIECTVNGIGERAGNCSLEEIAMILSTRKD-----------SLGLET
LEU1_SHEWM       ANSITAV-QQGARQIECTVNGIGERAGNCSLEEIAMILSTRKA-----------ALGLET
LEU1_SHELP       ANSITAV-QHGARQIECTVNGIGERAGNCSLEEIAMIIATRKA-----------SLGLET
LEU1_SHEDO       ANSIGAI-EKGARQVECTVNGIGERAGNCSLEEIAMILATRKD-----------KLGLET
LEU1_PSYIN       ANSITAV-ENGARQIECTMNGLGERAGNCSLEEVAMILQTRKD-----------KLGFTT
LEU1_ALIFM       ANSIAAV-QAGARQVEGTINGIGERAGNCSLEEIAMILKTRSE-----------YLGVHT
LEU1_ALISL       ANSIAAV-QAGARQVEGTINGIGERAGNCSLEEIAMILQTRSE-----------YLGVHT
LEU1_VIBCM       ANSIAAI-QAGARQVEGTINGIGERAGNCALEEIAMIIKTRQE-----------LLGVTT
LEU1_VIBVU       ANSIAAV-QAGARQVEGTINGIGERAGNCSLEEIAMIIKTRQE-----------LLGVRT
LEU1_VIBPA       ANSIAAV-QAGARQIEGTINGIGERAGNCSLEEIAMIIKTRQE-----------LLGVST
LEU1_VIBTL       ANSIAAV-QAGARQIEGTINGIGERAGNCSLEEIAMIIKTRQE-----------LLGVHT
LEU1_PHOPR       ANSMAAV-QAGARQVEGTINGLGERAGNCSLEEIAMIIKTRSD-----------FLGVET
LEU1_HISS2       ANSLTAV-QNGARQIECTINGIGERAGNTALEEVVMAIKTRQDI----------FKGLDT
LEU1_PASMU       ANSLTAV-QNGARQIECTINGIGERAGNTALEEVVMAIKTRQDM----------FNGLDT
LEU1_HAEIE       ANSLTAV-QNGARQIECTINGIGERAGNTSLEEVVMAMKVRQD-----------FMGVDT
LEU1_PSEA6       ANSLVAV-EYGARQIECTINGIGERAGNCSLEEIAMILQTRQA-----------MLGLNT
LEU1_CAMJD       GNSLSAI-LQGARQIECTINGLGERAGNCALEEVVMAIKTRKDY----------LQGFYT
LEU1_OLSUV       ALALAGV-ENGATQIECTINGLGERAGNTALEEVVMALRMHGD-----------ELDGHT
LEU1_PARD8       ANTVQGV-LNGARQVEVTINGIGERAGNTSLEEVAMVFKSHK------------ERDIIT
                    :      *. : *  :.*:****** .:*:    .  :                   

LEU1_CROS5       NINTKEIYKTSRLVSNLTGMIVQPNKAIVGANAFAHESGIHQDGVLKNKLTYEIMDAESI
LEU1_RIPO1       NINTKEIYRTSRLVSQLTGMMVQPNKAIVGKNAFAHESGIHQDGVLKNKLTYEIMDAESI
LEU1_GLOC7       NINTKEIYKTSRLVSNLTGMAVQPNKAIVGANAFAHESGIHQDGVLKNKLTYEIMDAESI
LEU1_NOSS1       NIDTKQIYKTSRLVSNLTGMLVQPNKAIVGANAFAHESGIHQDGVLKNKLTYEIMDAQLI
LEU1_MICAE       KINTKEIYRTSRLVSNLTGMIVQPNKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESI
LEU1_MICAN       KINTKEIYRTSRLVSNLTGMIVQPNKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESI
LEU1_SYNY3       NIDTKHIYATSRLVSELTGMMVQPNKAIVGANAFAHESGIHQDGVLKNKLTYEIMDAESI
LEU1_SYNP2       SINTKEIYKTSRLVSNLTGLSVQANKAIVGLNAFAHESGIHQDGVLKNKLTYEIMDAQSI
LEU1_TRIEI       NINTRHIYKTSRLVSSLTGMFVQPNKAIVGANAFAHESGIHQDGVLKNKLTYEIMDAQSI
LEU1_THEEB       NINTREIYKTSRLVSNLTGMLIQPNKAIVGANAFAHQSGIHQDGVLKHKQTYEIMDAQLI
LEU1_PROM0       AIRTEEITKTSRLVSNLTGMTVQPNKAIVGANAFAHESGIHQDGVLKNRLTYEIIDAKTV
LEU1_PROMS       AIRTEEITKTSRLVSNLTGMTVQPNKAIVGANAFAHESGIHQDGVLKNRLTYEIIDAKTV
LEU1_PROM9       AIRTEEITKTSRLVSNLTGMTVQPNKAIVGANAFAHESGIHQDGVLKNRLTYEIIDAKTV
LEU1_PROM2       AIRTEEITKTSRLVSNLTGMIVQPNKAIVGANAFAHESGIHQDGVLKNRLTYEIIDAKTV
LEU1_PROM5       AIRTEEITKTSRLVSNLTGMNVQPNKAIVGANAFAHESGIHQDGVLKNRLTYEIIDAKTV
LEU1_PROMP       AIRTEEITKTSRLVSNLTGMNVQPNKAIVGANAFAHESGIHQDGVLKNRLTYEIIDAKTV
LEU1_PROM4       AIRTEEITKTSRLVSNLTGMVVQPNKAIVGANAFAHESGIHQDGVLKNRLTYEIVDAKTV
LEU1_PROMA       AIRTEEITKTSRLVSNLTGMVVQPNKAIVGANAFAHESGIHQDGVLKNPLTYEIVDAKTV
LEU1_PROMT       AVRTEEITKSSRLVSNLTGMVVQPNKAIVGANAFAHESGIHQDGVLKNRLTYEIIDAKTV
LEU1_SYNS9       AVRTEELTKTSRLVSNLTGMVVQPNKAIVGANAFAHESGIHQDGVLKNRLTYEIIDARTV
LEU1_SYNSC       AVRTEEITKTSRLVSNLTGMVVQPNKAIVGANAFAHESGIHQDGVLKNRLTYEIIDAQTV
LEU1_SYNPX       AVRTEELTKTSRLVSNLTGMVVQPNKAIVGANAFAHESGIHQDGVLKNRLTYEIIDAKTV
LEU1_PROMM       AVRTEEITKTSRLVSNLTGMVVQPNKAIVGSNAFAHESGIHQDGVLKNRLTYEIVDARTV
LEU1_SYNPW       GVRTEEITKTSRLVSNLTGMVVQPNKAIVGANAFAHESGIHQDGVLKNRLTYEIVDARTV
LEU1_SYNS3       AVRTEEITKTSRLVSNLTGMVVQPNKAIVGANAFAHESGIHQDGVLKNRLTYEIVDARTV
LEU1_SYNR3       GIQTEEIYKTSRLVSNLTGMAVQPNKAIVGANAFAHESGIHQDGVLKNRLTYEIIDARTI
LEU1_GLOVI       TIDTRQIYKSSRLVSHLTGMLVQPNKAIVGANAFAHESGIHQDGVLKNRLTYEIMDAETV
LEU1_HUNT2       -IDLSQLYKTSKIVSRYMGIPIPVNKPIVGKNVFTHESGIHQDGVLKERSTYEVIDPRLV
LEU1_UNCTG       TLKTNELYNTSKLVSRLTGILVQVNKAVVGANAFAHESGIHQDGVLKARETYEIMSPADV
LEU1_DESRM       GINTPEIYRTSRLVSSLTGMPVQPNKSVVGKNAFAHESGIHQDGVLKERTTYEIMNPEQV
LEU1_PELTS       NIKTEEIYRTSKLVSALTGMKVQPNKAVVGKNAFAHEAGIHQDGVLKERTTYEIMNPAMV
LEU1_DESAP       GIQCEEIYRTSKLVSTLTGMPVQFNKAIVGKNAFLHESGIHQDGVLKERATYEIICPTMV
LEU1_CARHZ       GIKTEEIYRTSKLVSNLTGMPVQPNKAIVGKNAFSHESGIHQDGVLKERTTYEIMNPRLV
LEU1_HELMI       SINKSEIYRTSRLVSNLTGMLVQPNKAIVGKNAFAHESGIHQDGVLKERTTYEIMNPEMI
LEU1_CLOK5       DIVTEEITKTSSIVSHVTGMQVQGNKAIVGANAFAHESGIHQHGVLNCRETYEIMTPESV
LEU1_RUMCH       RIDTTQIYRASRLVSSLTGVNVQPNKAIVGANAFAHESGIHQHGVLSEKTTYEIMTPESV
LEU1_HALOH       NQDTTQIARLSKLVSNLTGMTIQPNKAIVGANAFAHESGIHQDGVIKERTTYEIMDARTI
LEU1_DICT6       GIKTEEIYKTSKLVSNLTGIVIQPNKAIVGENAFAHESGIHQHGVIQDPSTYEIIDPKMI
LEU1_DICTD       SIKTEEIYKTSKLVSNLTGIPIQPNKAIVGENAFAHESGIHQHGVIQDPSTYEIIDPKTI
LEU1_PYRAB       DVNLKEIARTSKLVSHLTGIEVPPNKAIVGGNAFAHESGIHQDGVLKERTTYEIIDPKKL
LEU1_PYRFU       GINLGEIARTSKLVARLTGIEVPPNKAVVGANAFAHESGIHQDGVLKERTTYEIIDPRKL
LEU1_STRM5       SINTPRIVGTSQLLQRLVGMPVQRNKAIVGANAFAHESGIHQHGMLRHRGTYEIMRPEDV
LEU1_STRMK       SINTPRIVGTSQLLQRLVGMPVQRNKAIVGANAFAHESGIHQHGMLRHRGTYEIMRPEDV
LEU1_XANOR       AINTPRIVSTSQLLQRLVGMPVQRNKAVVGGNAFAHESGIHQHGMLRHRGTYEIMRPEDV
LEU1_XANCP       AINTPRIVSTSQLLQRLVGMPVQRNKAVVGGNAFAHESGIHQHGMLRHRGTYEIMRPEDV
LEU1_XYLFA       SIHTSRIVSTSQLLQRLVGMPVQRNKAVVGANAFAHESGIHQHGMLRHRGTYEIMRPQEV
LEU1_ACIFD       GIDTRELARTSRLVSRLTGYPVQYNKAVVGRNAFAHESGIHQHGVLTDRSTYEVIDAASV
LEU1_SALRM       DVHTEHLTPTSQTVSAATGFPVQPNKAIVGSNAFSHEAGIHQHGVLEERTTYEIMSATDV
LEU1_LEPIN       QIKTEEIARASYLVKTITGMLVQPNKAIVGANAFAHESGIHQDGVIKHRETYEIMKPETV
LEU1_DEIRA       GIRTRELYRASRLVSRLSGMPVQPNKAIVGDNAFAHESGIHQDGVIKARETYEIMNAELV
LEU1_CUPNH       GVDTTQIVPASKLVSQITGFVVQPNKAVVGANAFAHASGIHQDGVLKARDTYEIMRAEDV
LEU1_CUPPJ       GVDTSQIVPASKLVSQITGFVVQPNKAVVGANAFAHASGIHQDGVLKARDTYEIMRAEDV
LEU1_CUPMC       GIDTTQIVPASKLVSQITGFVVQPNKAVVGANAFAHASGIHQDGVLKARDTYEIMRAEDV
LEU11_RALSO      GVDTTQIVPASKLVSQITGFVVQPNKAVVGANAFAHASGIHQDGVLKARDTYEIMRAEDV
LEU1_BURCM       GLDTTQIVPTSKLVSQITGFVVQPNKAVVGANAFAHASGIHQDGVLKARDTYEIMRAEDV
LEU1_BURVG       GIDTTQIVPTSKLVSQITGFVVQPNKAVVGANAFAHASGIHQDGVLKARDTYEIMRAEDV
LEU1_BURL3       GIDTSQIVPTSKLVSQITGFVVQPNKAVVGANAFAHASGIHQDGVLKARDTYEIMRAEDV
LEU1_BURM1       GIDTTQIVPTSKLVSQITGFVVQPNKAVVGANAFAHASGIHQDGVLKARDTYEIMRAEDV
LEU1_BURP6       GIDTTQIVPASKLVSQITGFVVQPNKAVVGANAFAHASGIHQDGVLKARDTYEIMRAEDV
LEU1_PARP8       GIDTTQIVPASKLVSQITGFVVQPNKAVVGANAFAHASGIHQDGVLKARDTYEIMRAEDV
LEU1_POLNS       GIDATQIVPASKLVSQITGFIVQPNKAVVGANAFAHTSGIHQDGILKNRDTYEIMRAEDV
LEU1_POLAQ       GIDASQIVPASKLVSQITGFVVQPNKAVVGANAFAHTSGIHQDGILKNRDTYEIMRAEDV
LEU1_ACISJ       GIDTQHIVAASRMVSQTTGFVVQPNKAVVGANAFAHASGIHQDGVLKARDTYEIMRAEDV
LEU1_ACIAC       GIDTQHIVAASRMVSQTTGFVVQPNKAVVGANAFAHASGIHQDGVLKARDTYEIMRAEDV
LEU1_POLNA       GIDTQQILAASRLVSQTTGFVVQPNKAVVGANAFAHASGIHQDGVLKARDTYEIMRAEDV
LEU1_POLSJ       NIDPLHIVAASRMVSQTTGFVVQPNKAVVGANAFAHASGIHQDGMLKARETYEIMRAEDV
LEU1_VARPS       NIDTTHIVAASRMVSQTTGFVVQPNKAVVGANAFAHASGIHQDGVLKARDTYEIMRAEDV
LEU1_RHOFT       DIETQHILAASRMVSQITGFVVQPNKAIVGANAFAHAAGIHQDGVLKARDTYEIMRAEDV
LEU1_VEREI       GIATQHILAASRMVSQTTGFAVQLNKAIVGANAFAHASGIHQDGVLKARDTYEIMRAQDV
LEU1_LEPCP       RVDTSQIVPASRMVAQTTGFVVQPNKAVVGANAFAHASGIHQDGVLKARDTYEIMRAEDV
LEU1_METPP       GIDTTQIVPASRLVSQTTGFIVQPNKAVVGANAFAHASGIHQDGVLKARDTYEIMRAEDV
LEU1_CHRVO       RVDATQIVPASKLVSTVTGYPVQPNKAIVGANAFAHESGIHQDGVLKHRETYEIMSAESV
LEU1_THIDA       RIDATQIVPSSKLVSTITGYPVQPNKAIVGANAFAHESGIHQDGVLKHRETYEIMRAEDV
LEU1_NEIMB       GIDTTQIVPSSKLVSTITGYPVQPNKAIVGANAFSHESGIHQDGVLKHRETYEIMSAESV
LEU1_NEIG1       GIDTTQIVPSSKLVSTITGYPVQPNKAIVGANAFSHESGIHQDGVLKHRETYEIMSAESV
LEU1_AROAE       RIDATQIVPASKLVSGVTGFPVQPNKAIVGANAFAHESGIHQDGVLKHRETYEIMRAEDV
LEU1_DECAR       RIDTTQIVPASKLVSQITGYPVQPNKAVVGANAFAHESGIHQDGVLKHRETYEIMRAQDV
LEU1_NITEC       RIDTTQIVSTSKLVSGITGFPVQPNKAIVGANAFAHESGIHQDGVLKHRETYEIMRAEDV
LEU1_NITEU       RIDTTQIVPASKLVSGITGFPVQPNKAIVGANAFAHESGIHQDGVLKHRETYEIMRAEDV
LEU1_NITMU       RIDSVHIVPASKLVSGITGFPVQPNKAIVGANAFAHESGIHQDGVLKHRETYEIMRAEDV
LEU1_METCA       DIETREIVACSKLVSSITGFPIQPNKAIVGANAFAHESGIHQDGVLKSRETYEIMSAEDV
LEU1_NITOC       NVDISQIVPTSRLVSGITGFSVQPNKAIVGANAFAHASGIHQDGVLKERQTYEIMSAEDV
LEU1_RUTMC       DINATHILSASRLVSSVTGFIVQPNKAIVGANAFAHEAGIHQDGVIKYRETYEIMRAEDV
LEU1_VESOH       NIDTMHILSASRLASSVTGFIIQPNKAIVGANAFAHEAGIHQDGVLKHRETYEIMRAEDV
LEU11_HYDCU      RIHTPEILAASRLVAGITGFAVQPNKAIVGTNAFSHESGIHQDGVLKHRETYEIMRAEDV
LEU1_BRASB       KIDTTQLTHASKVVSAATSFPVQYNKAIVGRNAFAHESGIHQDGMLKNAQTYEIMLPETV
LEU1_BRASO       KIDTTQLTHASKVVSAATSFPVQYNKAIVGRNAFAHESGIHQDGMLKNAQTYEIMLPETV
LEU1_RHOP5       KIDTTMLTRASKVVSAATSFPVQYNKAIVGRNAFAHESGIHQDGMLKNAETYEIMLPESV
LEU1_RHOPB       KIDTTMLTRASKVVSAATSFPVQYNKAIVGRNAFAHESGIHQDGMLKNAETYEIMRPESV
LEU1_RHOPT       RIETTMLTHASKTVSAATSFPVQYNKAIVGRNAFAHESGIHQDGMIKNAQTYEIMTPETV
LEU1_RHOP2       NIETTMLTHASKTVSAATSFPVQYNKAIVGRNAFAHESGIHQDGMIKNAQTYEIMTPETV
LEU1_RHOPS       RIESKMLTHASKTVSAATSFPVQYNKAIVGRNAFAHESGIHQDGMIKNAQTYEIMTPETV
LEU1_BRADU       KIDTTQLTRASKVVSAATSFPVQYNKAIVGRNAFAHESGIHQDGVLKDASTYEIMRPEMV
LEU1_METNO       GIDTTQIMRASKLVAAATHFPVQYNKAVVGRNAFAHESGIHQDGMLKNQSTYEIMTPESV
LEU1_METPB       GIDTTMLTRASKLVSHAANFPVQYNKAIVGRNAFAHESGIHQDGMLKHSETYEIMTPASV
LEU1_NITHX       NVESTMLTRASKLVSAATSFPVQYNKAIVGRNAFAHESGIHQDGMLKNAQTYEIMTPESV
LEU1_NITWN       NVESTMLTRASKMVSAATSFPVQYNKAIVGRNAFAHESGIHQDGMLKNAQTYEIMTPESV
LEU1_OLICO       NVESTTLTRASKVVSAATSFPVQYNKAIVGRNAFAHESGIHQDGVLKNAQTYEIMTPESV
LEU1_CAUVN       SVDPVHITRASRYVSAITGFPVQFNKAIVGKNAFAHESGIHQDGMLKNAETYEIMKPEDV
LEU1_CAUSK       KIDTTHITRASRYVSAITGFPVQYNKAIVGKNAFAHESGIHQDGMLKNRETYEIMTPESV
LEU1_DESMR       GIVTEELFPSCRRLSGIIGQPIPPYAPIMGRNAFAHESGIHQHGVLKDRRTYEIMTAESI
LEU1_DESVM       GVVTEQLFPTCRLLSMIIGQPIPPNKAIVGANAFAHESGIHQDGMLKNRETYEIMTPESI
LEU1_SYNAS       GIKTESIYQSSRLLTQITGVAVQPNKAIVGANAFAHESGIHQDGLIKEKITYEIMTPQSV
LEU1_NITSB       NINTKEIYPTSRLVAAITGIEPQPNKAIVGKNAFAHESGIHQDGVLKHQETYEIMRAEDI
LEU1_WOLSU       RINTKEIYASSQLVANITGIRPQPNKAIVGKNAFAHESGIHQDGVLKHKETYEIMHASDI
LEU1_ARCB4       TINTPEIYATSRLVATITGVEPQQNKAIVGKNAFAHESGIHQDGVLKHQETYEIMKPEDV
LEU1_CAMFF       DIVTKEIYATSRLVASITGIEPQPNKAIVGKNAFAHESGIHQDGMLKCAQTYEIIKAEDI
LEU1_CAMC1       GIISKEIYPTSRLIASITGIEPQPNKAIVGKNAFAHESGIHQDGVLKHKETYEIISAESI
LEU1_CAMHC       DINFKEIYHSSRLVATITGIEPQPNKAIVGKNAFAHESGIHQDGVLKHKETYEIMRAEDI
LEU1_AQUAE       DVNTKEIYKTSRLLCRITGNFVQPNKAIVGDNAFAHESGIHQHGVLSHRMTYEIMNPEDV
LEU1_METI4       GIQLKEILRTSRLVSRMSGLAVQRNKAVVGENAFAHAAGIHQDGILKKRETYEIIDPKII
LEU1_RHOBA       NINSKRLVPVSRLVSKTTGINVQRNKAIVGRNAFAHESGIHQDGMLKERTTYEIMSPEEV
LEU1_BACVZ       SLNLHELKRTSDLVSKLTGMAVPRNKAIVGDNAFAHESGIHQDGFLKEKSTYEIISPELV
LEU1_BACSU       GITLNEIKRTSDLVSKLTGMAVPRNKAVVGDNAFAHESGIHQDGFLKEKSTYEIISPELV
LEU1_BACLD       TIQLNEIKRTSDLVSKLTGMAVPRNKAVVGDNAFAHESGIHQDGFLKEKTTYEIISPELV
LEU11_BACP2      TIQLNEIKRTSDVVSKYSGMIVPRNKAVVGNNAFAHESGIHQDGFLKEKTTYEIISPELV
LEU1_GEOKA       RLNLQEIKRTSNLVSKLTGVVVPPNKAVVGKNAFAHESGIHQDGVLKEKTTYEIISPELV
LEU1_GEOSE       RLNLQEIKRTSNLVSKLTGVVVPPNKAVVGKNAFAHESGIHQDGVLKEKTTYEIISPELV
LEU1_GEOTN       RLNLQEIKRTSNLVSKLTGMVVPPNKAVVGKNAFAHESGIHQDGVLKEKTTYEIISPELV
LEU1_GEOSW       RLNLQEIKRTSNLVSKLTGVVIPPNKAVIGKNAFAHESGIHQDGVLKEKTTYEIISPELV
LEU1_ANOFW       RLNLQEIKRTSSLVSKLTGMIVPANKAIVGKNAFAHESGIHQDGVLKEKTTYEIISPQLV
LEU1_BACHD       GLILKEIKRTSSLVSKLTGMVVPNNKAVVGANAFAHESGIHQDGVLKNKQTYEIITPEMV
LEU1_BACSK       GLKLSELKRTSALVSRLTSMNVPGNKAVVGANAFAHESGIHQDGMLKNKETYEIITPELV
LEU1_LYSSC       GIQLQEIKRTSQLVSKLTNVVIQPNKAIVGRNAFAHESGIHQDGVLKNPETYEIISPALI
LEU1_OCEIH       GLILKETKRTSDLVAKLTGMYVQANKAVIGRNAFSHESGIHQDGVLKNTETYEIITPEMV
LEU1_BACCQ       SMTLKEIKATSTLVSRLTGMVVPKNKAIVGANAFAHESGIHQDGVLKEVTTYEIIEPELV
LEU1_BACMK       SMTLKEIKATSTLVSRLTGMVVPKNKAIVGANAFAHESGIHQDGVLKEVTTYEIIEPSLI
LEU1_BACCN       SIILKEIKATSTLVSRLTGMMIPKNKAIVGANAFAHESGIHQDGVLKEVTTYEIIAPELI
LEU1_LACLA       PLKLSETAATAELISQFSGIAIPKNKAIVGANAFAHESGIHQDGVLKNAETYEIITPELV
LEU1_LACLS       PLVLAETMATAELISQFSGIAIPKNKAVVGANAFAHESGIHQDGVLKNAETYEIISPELV
LEU1_STRG3       DIVLNETVNTSELISRFSGISIPKNKAVVGGNAFSHESGIHQDGVLKNPLTYEIITPELV
LEU1_STAAR       ALNLEETKKTSDLISRYAGIRVPRNKAIVGQNAFSHESGIHQDGVLKHRETYEIMTPQLV
LEU1_STAHJ       RLKLSETKNTSDIISRYAGIRVPRNKAIVGQNAFSHESGIHQDGVLKNPETYEIMTPQLV
LEU1_STAES       QINLEETKKTSDLISRYAGIRVPRNKAIVGQNAFSHESGIHQDGVLKHRETYEIMTPQLV
LEU1_STAS1       QINLEETKQTSDLIARFAGIRVPRNKAIVGQNAFSHESGIHQDGVLKNPETYEIMTPQLV
LEU1_STACT       NLKLDETKATSDLVASFAGIRVPRNKAIVGQNAFSHESGIHQDGFLKHPETYEIMTPQLV
LEU1_LISMO       NIVLNQFKNSSDLISRLSGMPVPRNKAVIGGNAYAHESGIHQDGVLKNPDTYEIITPALV
LEU1_LISIN       NIVLNQFKNSSDLISRLSGMPVPRNKAVIGGNAYAHESGIHQDGVLKNPDTYEIITPALV
LEU1_LISMH       NIVLNQFKNSSDLISRLSGMPVPRNKAVIGGNAYAHESGIHQDGVLKNPDTYEIITPALV
LEU1_LISW6       NIVLNQFKNSSDLISRLSGMPVPRNKAVIGGNAYAHESGIHQDGVLKNPDTYEIITPALV
LEU1_BREBN       KLNLKEIARTSQLVSRLTGMIVPGNKAVVGANAFAHESGIHQDGVLKEVTTYEIIRPESV
LEU1_THEP1       GIKTELIYPASRLLTHITGLIPSRNKPIVGENVFLHESGIHQDGVLKHRETYEIMKPSDI
LEU1_THENN       GIRTELIYPASRLLTHITGLIPARNKPIVGENVFLHESGIHQDGVLKHRETYEIMKPSDI
LEU1_SEDSS       GIHTEYLYPTGKLLQSITGLLIPRNKPIFGDNVFVHESGIHQHGVLNKRETYEIMKPERI
LEU1_GEOS4       NVRLKELIRTSRLLTHLTGLDVQVNKAITGENAFAHSSGIHQDGLLKDKQVYEIMSPEEV
LEU1_KLEP3       NINHHEIWRTSQTVSQICNMPIPANKAIVGTGAFAHSSGIHQDGVLKNRENYEIMTPESI
LEU1_ENT38       RINHNEIWRTSQTVSQICNMPIPANKAIVGTGAFAHSSGIHQDGVLKNRENYEIMTPESI
LEU1_SALNS       NINHHEIWRTSQTVSQICNMPIPANKAIVGSGAFAHSSGIHQDGVLKNRENYEIMTPESI
LEU1_SALAR       NINHHEIWRTSQTVSQICNMPIPTNKAIVGSGAFAHSSGIHQDGVLKNRENYEIMTPESI
LEU1_CITK8       RINHQEIWRTSQLVSQICNMPIPANKAIVGSGAFAHSSGIHQDGVLKNRENYEIMTPESI
LEU1_CROS8       RINHQEIWRTSQTVSQICNMPIPANKAVVGSGAFAHSSGIHQDGVLKNRENYEIMTPESI
LEU1_ECOLI       AINHQEIWRTSQLVSQICNMPIPANKAIVGSGAFAHSSGIHQDGVLKNRENYEIMTPESI
LEU1_ERWT9       RINHQEIYRTCQTVSKICNMPIPAHKAIIGSNAFAHSSGIHQDGVLKNRENYEILTPESI
LEU1_YERPS       NINHQEIYRTSQLVSKICNMPIPGNKAIVGSNAFAHSSGIHQDGVLKNRENYEIMTPESI
LEU1_YERE8       NINHQEIYRTSQLVSKLCNMPIPANKAIVGSNAFAHSSGIHQDGVLKNRENYEIMTPQSI
LEU1_SERP5       NINHQEIFRTSQIVSQLCNMPIPANKAIVGSNAFAHSSGIHQDGVLKNRENYEIMSPQTI
LEU1_PECCP       NINHQEIYRTSQLVSQICNMPIPANKAVVGANAFAHSSGIHQDGVLKNRENYEIMTPESI
LEU1_SODGM       GIHHQEIYRTSQVVSQLCNMPIPANKAVVGANAFAHSSGIHQDGVLKNRQNYEIMTPEII
LEU1_EDWI9       GIRHQEIYRTSQLVSQLCNMPIPANKAVVGANAFAHSSGIHQDGVLKNRENYEIMTPESI
LEU1_PHOLL       NINHQEIYRTSQLVSQLCNMPIPANKAIVGSNAFSHSSGIHQDGVLKNRETYEIMTPESI
LEU1_PROMH       RINHKEIYRTSQLVSQLCNTPIHANKSIVGSNAFAHSSGIHQDGVLKNRETYEIMTPESI
LEU1_BLOPB       NVRCQEIYRASQVVSQLCNIPIPANKAIVGSNAFSHSAGIHQDGILKNRKNYEIMTPETI
LEU1_BLOFL       NIHHHEIYQTSQVVSQLCNMPIPANKAIVGSNAFSHSSGIHQDGVLKNKKNYEIMNPKNI
LEU1_BUCAI       NINYKEIYRTSKIVSQICNMPIPSNKAIVGSNAFAHSSGIHQDGVLKNRKNYEIMEPSSI
LEU1_BUCDN       NIVHKEIYRTSQIISQICNMPIPANKAIVGSNAFAHSSGIHQDGVLKNRKNYEIMEPNTI
LEU1_BUCAP       NIKHKEIYRTSQIISQICNLPIPPNKAIVGSNAFAHSSGIHQDGVLKNRKNYEIMEPSSI
LEU1_BUCRP       KIKHKEIYRTSQIISQICNLPIPPNKAIVGSNAFAHSSGIHQDGVLKNRKNYEIMEPSSI
LEU1_BUCUN       NINHKEIYRTSQVISRICNMPIPSNKAIVGSNAFSHSSGIHQDGVLKNRENYEIMDPSSI
LEU1_BUCUM       NINHKEIYRTSQIVSSICNMPIPSNKAIVGSNAFAHSSGIHQDGVLKNRENYEIIDPISI
LEU1_BUCUE       NINHKEIYRTSQMISRICNMPIPSNKAIVGSNAFSHSSGIHQDGVLKNRENYEIIDPVSI
LEU1_BUCML       NINYKEIYHTSKIISRICNMPIPPNKAIVGSNAFSHSSGIHQDGVLKNRKNYEIIDPSSI
LEU1_BUCCC       DINIKEIHRTSKIVSQFCNTPIPLNKAIIGKNVFSHSSGIHQDGVLKNRKNYEIIDPNSI
LEU1_AERHH       NIRHSEIHRTSALVSQLCNMPVQPNKAIVGANAFSHSSGIHQDGVLKAKNTYEIITPESI
LEU1_AERS4       NIRHSEIHRTSALVSQLCNMPVQPNKAIVGANAFSHSSGIHQDGVLKAKNTYEIITPESI
LEU1_TOLAT       NIKHQEIHRTSQLVSQLCNMPVQPNKAIVGANAFSHSSGIHQDGVLKAKNTYEIITPESV
LEU1_SHESR       GINAKEIHRTSNLVSQLCNMPIQSNKAIVGANAFTHSSGIHQDGMLKAQNTYEIMTPESI
LEU1_SHEON       GINAKEIHRTSNLVSQLCNMPIQSNKAIVGANAFTHSSGIHQDGMLKAQNTYEIMTPESI
LEU1_SHEB8       GINAKEIHRTSNLVSQLCNMPVQANKAIVGANAFTHSSGIHQDGMLKAQNTYEIMTPESI
LEU1_SHEAM       NINAREIHRTSSLVSQLCNMPIQPNKAIVGSNAFTHSSGIHQDGMLKAQNTYEIMTPESI
LEU1_SHEFN       GINAKEIHRTSSLVSQLCNMPIQANKAIVGTNAFSHSSGIHQDGMLKAKNTYEIMTPESI
LEU1_SHEHH       GINAKEIHRTSSLVSQLCNMPVQANKAIVGANAFTHSSGIHQDGMLKAQNTYEIMTPESI
LEU1_SHEPA       GINAKEIHRTSSLVSQLCNMPVQANKAIVGANAFTHSSGIHQDGMLKAQNTYEIMTPESI
LEU1_SHEPW       GINAKEIHRTSSLVSQLCNMPVQANKAIVGANAFTHSSGIHQDGMLKAQNTYEIMTPESI
LEU1_SHESH       GINAKEIHRTSNLVSQLCNMPVQANKAIVGANAFTHSSGIHQDGMLKSQNTYEIMTPESI
LEU1_SHEWM       GINAKEIHRTSSLVSQLCNMPVQANKAIVGANAFTHSSGIHQDGMLKSQNTYEIMTPESI
LEU1_SHELP       GINAKEIHRTSNLVSQLCNMPVQANKAIVGANAFTHSSGIHQDGVLKSQNTYEIMTPESI
LEU1_SHEDO       GIVAKEIHRTSNLVSQLCNMPVQANKAIVGSNAFSHSSGIHQDGMLKAKNTYEIMTPESI
LEU1_PSYIN       NVNPMEISRTSQLVSQLCNMPIQANKAIVGANAFSHSSGIHQDGVLKSQNTYEIMTPESV
LEU1_ALIFM       NLKHDEIHRTSKLVSQLCNMPIQSNKAIVGANAFSHSSGIHQDGMLKNKNTYEIMTPESI
LEU1_ALISL       SLKNDEIHRTSKLVSQLCNMPIQSNKAIVGANAFSHSSGIHQDGMLKNKNTYEIMTPESI
LEU1_VIBCM       GIKHDEISRTSKLVSQLCNMPIQSNKAIVGANAFSHSSGIHQDGMLKNKNTYEIMTPESI
LEU1_VIBVU       GINHEEIHRTSKLVSQLCNMPIQANKAIVGANAFSHSSGIHQDGMLKNKNTYEIMTPESI
LEU1_VIBPA       GIKHEEIHRTSKLVSQLCNMPIQSNKAVVGANAFSHSSGIHQDGMLKNKNTYEIMTPESI
LEU1_VIBTL       GLDHKEIHRTSKLVSQLCHMPIQDNKAIVGANAFSHSSGIHQDGMLKNKNTYEIMTPESI
LEU1_PHOPR       NIKHEEIHRTSKMVSQLCNMPIQANKAIVGANAFNHSSGIHQDGMIKNKNTYEIMTPESI
LEU1_HISS2       RINTQEIHRVSQMVSQLCNMPIQPNKAIVGSNAFAHSSGIHQDGMVKNKNTYEIMSPETI
LEU1_PASMU       RINTQEIHRVSQMVSQLCNMPIQPNKAIVGSNAFAHSSGIHQDGMVKHKNTYEIMSPESI
LEU1_HAEIE       RINTQEIHRVSQMVSQLCNMPIQPNKAIVGSNAFAHSSGIHQDGMLKNKNTYEIMSPETI
LEU1_PSEA6       NIRSHEISRTSKLVSQLCNMPVQSNKAIVGANAFSHSSGIHQDGVLKAQNTYEIMTPESV
LEU1_CAMJD       DIKCENISKTSKLVSAITNESIPSHKAIVGSNAFSHSSGIHQDGVLKNRQTYEIISPSAI
LEU1_OLSUV       DVVTQELTRASRLVSRITGMQVQANKAIVGANAFAHSSGIHQDGVLKSRGTYEIIDPADV
LEU1_PARD8       NITTNKIYSTSRMVSSLMNMPVQPNKAIVGRNAFAHSSGIHQDGVLKNAQTYEIIDPKDV
                                           .: * ..: * :****.*.:     **:: .  :

LEU1_CROS5       GLTN-NQIVLGKLSGRNAFRTRLDELGF-ELSERDLNNAFLRFKEVADKKKEITDWDLEA
LEU1_RIPO1       GLTH-NQIVLGKLSGRNAFRTRLKELGF-ELSDTEINNAFLRFKEVADKKKEITDWDLAA
LEU1_GLOC7       GLTN-NQIVLGKLSGRHAFSTRLKELGF-ELSETDLNKAFLRFKEVADKKKEITDWDLEA
LEU1_NOSS1       GLTD-NQIVLGKHSGRNAFRTRLKELGF-ELSETELNKAFVKFKEVADKKKEISDWDLEA
LEU1_MICAE       GLTN-NQIVLGKLSGRNAFRSRLQELGF-ELSETELNNAFIQFKEMADRKKEITDRDLEA
LEU1_MICAN       GLTH-NQIVLGKLSGRNAFRSRLQELGF-ELSETELNNAFIQFKEMADRKKEITDRDLEA
LEU1_SYNY3       GLTN-NQIVLGKLSGRNAFGTRLKELGF-DLSDTELNNAFIRFKEVADKRKEITDWDLEA
LEU1_SYNP2       GLTD-NQIILGKHSGRNAFRTRLAELGF-DLSDNDLNKAFLRFKDLADKKKEITDWDLEA
LEU1_TRIEI       GLTD-NQIVLGKLSGRHAFQSRLQELGF-KLSDEEINKAFIKFKDLADKKKEITDWDLES
LEU1_THEEB       GLAD-NQIVLGKLSGRNAFATRLRELGF-ELSETELNKAFLRFKDLADKKKEITDWDLEA
LEU1_PROM0       GLSD-NKISLGKLSGRSAVRARLEEMGY-DLSREDLNDAFARFKDLADRKREITDRDLEA
LEU1_PROMS       GLSD-NKISLGKLSGRSAVRARLEEMGY-DLSREDLNDAFARFKDLADRKREITDRDLEA
LEU1_PROM9       GLSD-NKISLGKLSGRSAVRARLEEMGY-DLSREDLNDAFARFKDLADRKREITDRDLEA
LEU1_PROM2       GLSD-NKISLGKLSGRSAVRARLEEMGY-DLSREDLNDAFARFKDLADRKREITDRDLEA
LEU1_PROM5       GLND-NKISLGKLSGRSAVRARLEEMGY-DLSREDLNDAFARFKDLADRKREITDRDLEA
LEU1_PROMP       GLND-NKISLGKLSGRSAVRARLEEMGY-DLSREDLNDAFARFKELADRKREITDRDLEA
LEU1_PROM4       GLTD-NRISLGKLSGRSAVRARLEELGY-DLTRDDLNEAFAKFKDLADRKREITDRDLEA
LEU1_PROMA       GLAE-NRISLGKLSGRSAVRARLEELGY-DLTREDLNDAFARFKDLADRKREISDRDLEA
LEU1_PROMT       GLSD-NKISLGKLSGRSAVRARLEDLGY-DLNREDLNDAFARFKDLADRKREITDRDLEA
LEU1_SYNS9       GLSD-NRISLGKLSGRSAVRARLEELGY-NLTREDLDEAFARFKDLADRKREITDRDLEA
LEU1_SYNSC       GLSD-NRISLGKLSGRSAVRARLEELGY-DLTREDLDEAFARFKELADRKREITDRDLEA
LEU1_SYNPX       GLSD-NRISLGKLSGRSAVRARLEELGY-DLTREDLDEAFARFKDLADRKREITDRDLEA
LEU1_PROMM       GLSD-NRISLGKLSGRSAVRARLEELGY-DLTREDLDEAFARFKDLADRKRDITDRDLEA
LEU1_SYNPW       GLTD-NRISLGKLSGRSAVRARLEELGY-DLSREDLDDAFARFKELADRKRDITDRDLEA
LEU1_SYNS3       GLTD-NRISLGKLSGRSAVRARLEELGY-DLSREDLDDAFARFKDLADRKREITDRDLES
LEU1_SYNR3       GLTD-NRISLGKLSGRSAVRARLEELGY-QLDGDDLNDAFARFKELADRKREITDRDLEA
LEU1_GLOVI       GVNE-NRIVLGKHSGRNAFRTRLVELGY-ELGDADLNRAFLRFKELADKKKTVSDWDIEA
LEU1_HUNT2       GRDD-SVILLGKHSGRHALKVEAEKLGY-DLDEERLNKLFNDFKKLTDVKKNVTTADLES
LEU1_UNCTG       GVPE-SLLVLGKHSGRHAFFKRIKDLGY-KLDEKTLEHLFEKFKILADKKKTVFDDDIIA
LEU1_DESRM       GITA-NNLVLGKHSGRHAFRDRLEELGY-HLNEEELNLAFSRFKVLADKKKEITDHDLQA
LEU1_PELTS       GISK-SNLVLGKHSGRHAFRHRLEEMGY-NLSDEELNSAFERFKKLADKKMEITDEDLEA
LEU1_DESAP       GITR-TNLVLGKHSGRHAFRQRLTELGF-ELHEEELNRAFVRFKELADSKKQITDEDLEA
LEU1_CARHZ       GIPE-SRLVLGKHSGRHALKERLLELGY-ELTEEQLNEAFVKFKALADKKKEVTDQDLEA
LEU1_HELMI       GIFT-NNIVLGKHSGRHAFRERLKELGY-SLDDEKLTKAFARFKALADRKREITDEDLVV
LEU1_CLOK5       GLKK-NFIVLGKHSGRHAFVEHLHEMGYKDLSVEKTDEIFKKFKELADKKKHISDEDIES
LEU1_RUMCH       GMGT-NRMVLGKLSGRHAFEDRLKEMGY-SLSDEEVKTAFAKFKDLADKKKVVTDKDIEA
LEU1_HALOH       GLKD-NKLVLGKHSGRHAFREFIQKLGY-DIDDETFEEIFIEFKKLADKKKNITHVEIEA
LEU1_DICT6       GIPE-SKIVLGKHSGKHAFEKRLQELGY-SLPPEQLEEAFKKFKELADKKKEITDKDIEA
LEU1_DICTD       GIPE-SKIVLGKHSGKHAFEKRLQELGY-SLPPDQLEEAFRRFKELADKKKEITDKDIEA
LEU1_PYRAB       GFSG-SKIVLGKHSGRHAFRKKLEELGY-SLTEEHLERAFKKFKDIADRKRWITDTDIEA
LEU1_PYRFU       GFSG-SKIVLGKHSGRHAFRKKLEEMGY-RLSEEEINRLFAKFKEIADRKKGLTELDIEA
LEU1_STRM5       GW-EDSQMVLGRHSGRAAVEARLRALGFWLEEDE-LKLVFEQFKGLCEQQRVVTDADLQT
LEU1_STRMK       GW-EDSQMVLGRHSGRAAVEARLRALGFWLDEDE-LKLVFEQFKGLCEQQRVVTDADLQT
LEU1_XANOR       GW-ESSQMVLGRHSGRAAVERRLRALGYLLEEEE-VKLMFEQFKALCEKQRLVTDADLQA
LEU1_XANCP       GW-ESSQMVLGRHSGRAAVEQRLRALGYLLEEDE-AKLVFEQFKALCEKQRVVTDADLQA
LEU1_XYLFA       GW-VCSHMVLGRHSGRAAVEQRLRALGYLLEEED-LKLVFEEFKQLCEKQRLVTDVDLQV
LEU1_ACIFD       GQ-EAAQIVLGKHSGRHAFQEALARMGIALEGDA-LNATFQRFKELADRKVELSEADLEA
LEU1_SALRM       GQDA-EQIRLGRHSGRHGLFNRLEAMGYAV-PEGHRDALYDRFLDLADRKKEVFEEDLEQ
LEU1_LEPIN       GL-SSNRMVLGRHSGRAGFKDRIVKLGFSPQVEE-LEAAYQRFLEIADRKKEIYDEDIRA
LEU1_DEIRA       GR-EAAVLVMGKHSGRAAFRKALTDLGYGDIPDDKVQHLFGRFKDLADRKGQIYAEDLRA
LEU1_CUPNH       GW-SANKIVLGKLSGRNAFKQRLQELGIELESETEVNAAFTRFKELADQKAEIFDEDIVA
LEU1_CUPPJ       GW-TANKIVLGKLSGRNAFKQRLQELGVELESEAEVNAAFGRFKELADQKAEIFDEDIMA
LEU1_CUPMC       GW-TANKIVLGKLSGRNAFKQRLQELGVQLESEAEINAAFARFKELADQKAEIFDEDIMA
LEU11_RALSO      GW-TANKIVLGKLSGRNAFKQRLQELGIELDSEAELNAAFTRFKELADQKAEIFDEDIVA
LEU1_BURCM       GW-TANKIVLGKLSGRNAFKQRLQELGVSLDSETELNAAFMRFKDLADRKSDIFDEDIIA
LEU1_BURVG       GW-TANKIVLGKLSGRNAFKQRLQELGVSLDSEAELNAAFMRFKDLADRKAEIFDEDIIA
LEU1_BURL3       GW-TANKIVLGKLSGRNAFKQRLQELGVSLDSESELNAAFMRFKDLADRKAEIFDEDIIA
LEU1_BURM1       GW-TANKIVLGKLSGRNAFKQRLQELGVSLDSEAELNAAFMRFKDLADRKSEIFDEDIIA
LEU1_BURP6       GW-TANKIVLGKLSGRNAFKQRLQELGVSLDSEAELNAAFARFKDLADRKAEIFDEDIIA
LEU1_PARP8       GW-TANKIVLGKLSGRNAFKQRLQELGISLDSESELNLAFQRFKELADRKAEIFDEDIIA
LEU1_POLNS       GW-SANKIVLGKLSGRNAFKQRLQELGITVEAEADLNVAFTRFKALADQKSEIFDEDIIA
LEU1_POLAQ       GW-SANKIVLGKLSGRNAFKQRLQELGITVEAEADLNEAFTRFKALADQKSEIFDEDIIA
LEU1_ACISJ       GW-SANKIVLGKLSGRNAFKQRLQELGVQLESEGEINVAFAKFKELADRKSEIFDEDILA
LEU1_ACIAC       GW-TANKIVLGKLSGRNAFKQRLQDLGVQLESEADVNAAFLRFKELADRKSEIFDEDILA
LEU1_POLNA       GW-SANKIVLGKLSGRNAFKQRLQELGVAMESETDINNAFIKFKDLADRKSEIFDEDILA
LEU1_POLSJ       GW-SASKMVLGKLSGRNAFKQRLQDLGVALESEADINTAFARFKELADRKSEIFDEDILA
LEU1_VARPS       GW-AANKIVLGKLSGRNAFKQRLQELGVTMASEADINAAFLRFKELADRKSEIFDEDILA
LEU1_RHOFT       GW-SANKIVLSKVSGRNAFKQRLQDLGAQMESESDVNAAFARFKELADRKSEIFDEDILA
LEU1_VEREI       GW-SANKMVLGKLSGRSAFKQRLQELGVSLDSEAEINLAFARFKELADRKSEIFDEDILA
LEU1_LEPCP       GW-SANKIVLGKLSGRNAFKQRLQDLGIALESEAEVNAAFMKFKDLADRKSEIFDEDILA
LEU1_METPP       GW-SANKIVLGKLSGRNAFKQRLQELGIELESETDVNAAFARFKDLADRKSDIFDEDIIA
LEU1_CHRVO       GW-SANRLTLGKLSGRNAFKTKLSELGIVLDSEEALNAAFARFKELADKKREIFDEDLHA
LEU1_THIDA       GW-NANRLTLGKLSGRNAFKTKLAELGIVLDSEEALNAAFARFKDLADKKREIFDEDLQA
LEU1_NEIMB       GW-ATNRLSLGKLSGRNAFKTKLADLGIELESEEALNAAFARFKELADKKREIFDEDLHA
LEU1_NEIG1       GW-SANRLSLGKLSGRNAFKTKLADLGIELESEEALNAAFARFKELADKKREIFDEDLHA
LEU1_AROAE       GW-GANKLVLGKHSGRNAFRSRLQEIGIVVASEEHLNHAFARFKELADKKHEIFDEDIQA
LEU1_DECAR       GW-TQNKLVLGKHSGRNAFKNRLQELGIELESDEALNAAFARFKELADKKHEIFDEDLHA
LEU1_NITEC       GW-GANKLLLGKHSGRNAFRSRLKELGIELESEEKLNTIFIRFKDLADKKHEIFDEDLHA
LEU1_NITEU       GW-GANKLLLGKHSGRNAFRSRLKELGIGLESEEKLNAIFLRFKDLADKKHEIFDEDLHA
LEU1_NITMU       GW-GANKLLLGKHSGRNAFRSRLAELGIELESEETLNATFMRFKELADKKHDIFDEDLHA
LEU1_METCA       GW-STNRMVLGKHSGRNAFRTRMQELGIEFASEEELNSVFQRFKVLADKKHEIFDEDLQA
LEU1_NITOC       GW-HANQMILGKHSGRNAFRARLRELGIELETEEELNAAFQRFKELADKKHVIYDEDLQA
LEU1_RUTMC       GW-NANQLVLGKHSGRNAFKVRLAELGVEFNNEEGLNDAFRRFKELADKKHEIFDEDLQA
LEU1_VESOH       GW-NANQLVLGKHSGRNAFKVRLAKLGVEFNDDGSLNDAFRRFKELADKKHEIFDEDLQA
LEU11_HYDCU      GW-STNKMVLGKHSGRSAFRSRLKELGIEFETEQELSDAFISFKELADRKHEIYDEDIQA
LEU1_BRASB       GV-KQTSLVMGKHSGRHAFIHKLEEMGHKLA-GNQVEDAFVRFKALADRKKHIYDEDIEA
LEU1_BRASO       GV-KQTSLVMGKHSGRHAFIHKLEEMGHKLS-SNQVEDAFVRFKALADRKKQIYDEDIEA
LEU1_RHOP5       GV-KQTSLVMGKHSGRHAFIHKLEEMGYKLG-QNQLEDAFVRFKALADRKKDIYDEDIEA
LEU1_RHOPB       GV-KQTSLVMGKHSGRHAFVHKLEEMGYKLG-QNQLEDAFVRFKALADRKKEIYDEDIEA
LEU1_RHOPT       GV-KGTSLVMGKHSGRAGLIHKMEELGYKLS-RNQIEDVFVRFKALADRKKDVYDEDIEA
LEU1_RHOP2       GV-KGTSLVMGKHSGRAGLIHKLEELGYKLS-RNQIEDVFVRFKALADRKKDVYDEDIEA
LEU1_RHOPS       GV-KGTSLVMGKHSGRAGLIHKMEELGYKLS-RNQIEDVFVRFKALADRKKDVYDEDIEA
LEU1_BRADU       GL-KQSSLVLGKHSGRHAFVHKLEEMGYKLG-PNQLEDAFTRMKALADRKKDIYDEDIEA
LEU1_METNO       GV-QKTSLVMGKHSGRAAFRSKLEELGYRLS-DNQFQDAFERFKALADRKKNVYDEDIEA
LEU1_METPB       GL-SKTSLVMGKHSGRAAFKSKLAELGISLS-DNQFQDVFERFKDLADRKKHVYDEDIEA
LEU1_NITHX       GV-KQTSLVMGKHSGRHAFQHKLEELGYKLA-ENQLQDAFVRFKALADRKKDIYDEDIVA
LEU1_NITWN       GV-KQTSLVMGKHSGRHAFQHKLEELGYKLA-ENQLQDAFVRFKALADRKKDIYDEDIIA
LEU1_OLICO       GV-KQTSLVMGKHSGRHAFQHKLRELGYELA-DNQLQDAFVRFKALADRKKDIYDEDIEA
LEU1_CAUVN       GQ-GATNLVMGKHSGRHAFREKLKALGYELG-QNALNDAFGRFKELADKKKHVFDDDIVA
LEU1_CAUSK       GQ-APSSLVMGKHSGSHAFRAKLKDLGYELG-QNALKEAFGRFKDLADRKKHVYDDDIIA
LEU1_DESMR       GR-KGAVVVLGKHSGRHALDAKVKELGYALN-DEELLVVFVAVKQLADRKQRILDEDIEA
LEU1_DESVM       GK-TKTDLVIGKHSGRNAVKNKLDELGYRLE-EAQLVTVFEAVKKLADKKKQIYDEDIEA
LEU1_SYNAS       GI-SDSHIVLGKHSGRHAVSEHLKKLGFNLS-DTELNKIFVRFKELADAKKNVFDEDLEA
LEU1_NITSB       GL-DKNAIVLGKHSGRHAFKKKIEELGFS-LSEEEINKAFERFKMLADKKKEVTDDDIRM
LEU1_WOLSU       GLGEQESIVLGKHSGRHAFKDKIKALGFE-VSYEELNAAFDRFKALCDQKKEIYDEDIRA
LEU1_ARCB4       GVIKDSTLILGKHSGRAAFRDKIVQLGFDKVSDDELNAAFERFKVLADNKKEISDEDVRM
LEU1_CAMFF       GA-EKNSLVLGKHSGRHAFKDKLINLGFD-LDDNEINEAFIKFKELCDKKKEIFDDDIRA
LEU1_CAMC1       GL-EKNSLVLGKHSGRHAFKDKLASLGFD-LDSDALNKAFEKFKDLADKKKEIFDDDIRA
LEU1_CAMHC       GL-EKNSIVLGKHSGSHAFRDKLVSLGYN-LSEDELANVFEKFKILADAKKEIFDDDLRE
LEU1_AQUAE       GF-PMSRIVLGKHSGRHALKRRLEELGFK-FTKEELDRIFEKFKELADRKKEVYDEDLEA
LEU1_METI4       GW-EQSELPLTKHSGRAALENRLKILGFELE-KEEIDNIFSQFKQIGDKKKFIYDDDLVS
LEU1_RHOBA       GF-TKTDLVLGKHSGRAALADRAKQLGMTLT-GEQLQEVFEAFKELADKKKEIYDGDIVA
LEU1_BACVZ       GV-TADALVLGKHSGRHAFKDRLNTLGFQF-DSDEINKYFTMFKELTEKKKEITDDDLIS
LEU1_BACSU       GV-TADALVLGKHSGRHAFKDRLTALGFQF-DSEEINKFFTMFKELTEKKKEITDEDLVS
LEU1_BACLD       GV-KTDALVLGKHSGRHAFKDKLQNLGFQL-GEEEINKFFNIFKELTGKKKEFTDEDLIS
LEU11_BACP2      GV-TTDVLVLGKHSGRHAFKDRMKTLGFKL-TEEEINKFFETFKNLTEKKKEITDDDLIS
LEU1_GEOKA       GV-PSNSMVLGKHSGRHALRNRVEELGYTL-SDEEINQLFVRFKELADKKKDITDDDLIA
LEU1_GEOSE       GV-PSNSMVLGKNSGRHALRYRVEELGYTL-SDEEINQLFVRFKELADKKKDITDDDLIA
LEU1_GEOTN       GV-SSNSMVLGKHSGRHALRNRVEELGYTL-SEEEINQLFVRFKELADKKKDVTDDDLIA
LEU1_GEOSW       GV-QSNSMVLGKHSGRHALRNRVEELGYTL-SDEEVNKLFVRFKELADKKKDITDDDLVA
LEU1_ANOFW       GV-QSNSMVLGKHSGRHAFRTRIQELGYSL-TEEEVNRLFVRFKDLADKKKDITDDDLIA
LEU1_BACHD       GV-SSNSMVLGKHSGRHAFKTKVQELGFTG-TDEQLNNIFKAFKDLADKKKEITEDDLFA
LEU1_BACSK       GA-TS-SLPLGKHSGRHAFKTKLNELGFSG-SDEKLQTIFSAFKQLCDKKKEVTEDDLYA
LEU1_LYSSC       GE-GEIPLVLGKHSGRAAFRDRAETLGFDL-SDEKLNKAFVEFKKLADRKKEITEEDLLT
LEU1_OCEIH       GV-SSNTLFLGKHSGRHAFKDKLKEFGVEL-SEEELKTAFEQFKLLTDQKKEVTDDDLYT
LEU1_BACCQ       GE-SQNLFVLGKHSGRHAFTEKMKELGYEF-TTEERDAVFEAFKKLADRKKEITEEDLRA
LEU1_BACMK       GE-SQNLFVLGKHSGRHAFTEKMKELGYEF-TKEERDVVFEAFKNLADRKKEITEEDLRA
LEU1_BACCN       GE-SQNLFVLGKHSGRHAFTERMKELGYEL-TQKERDAAFEAFKALADRKKEITDEDLRA
LEU1_LACLA       GI-KHNSLPLGKLSGRHAFSEKLTELNIAY-DDESLAILFEKFKKLADKKKEITDADIHA
LEU1_LACLS       GI-KHNSLPLGKLSGRHAFTEKLTELNISY-DAKELPNLFERFKRLADKKKEITDADIHA
LEU1_STRG3       GV-KHNSLPLGKLSGRHAFVEKLKELELAF-EESEIATLFGKFKKLADKKHEITDADIRA
LEU1_STAAR       GV-STTELPLGKLSGKHAFSKKLKALGYDI-DKEAQIDLFKQFKAIADKKKSVSDRDIHA
LEU1_STAHJ       GI-SKNDLPLGKLSGKHAFAEKLKSLGYDI-EPQNQAELFKQFKAIADKKKSVTDRDIHA
LEU1_STAES       GV-NTTELPLGKLSGKHAFAEKLKALGYEI-KLEDQVTLFKQFKEIADKKKNVSDRDIHA
LEU1_STAS1       GV-KTTELPLGKLSGKHAFAEKLTALGYDV-DPEEQKTLFKQFKTVADKKKAVTDRDIHA
LEU1_STACT       GI-KSSELPLGKLSGKHAFAEKLKQLGYDI-TAEKQVELFKQFKSIADKKKNVSDHDVHA
LEU1_LISMO       GV-DKNSLPLGKLSGKHAFNTRMEEMGYTL-TEQEQKDAFKRFKQLADAKKEVTEEDLHA
LEU1_LISIN       GV-DKNSLPLGKLSGKHAFNTRMEEMGYTL-SEQEQKDAFKRFKQLADAKKDVTEEDLHA
LEU1_LISMH       GV-DKNSLPLGKLSGKHAFQTRMEEMGYNL-SEQELKDAFKRFKQLADAKKEVTEDDLHA
LEU1_LISW6       GV-DKNSLPLGKLSGKHAFHTRMEEMGYTL-SEQELKDTFKRFKQLADAKKEVTEEDLHA
LEU1_BREBN       GF-KSNKLVLGKHSGRHAFKEKLVDLGYHL-EQEEVNAAFAAFKVLCDKKKEITDDDILA
LEU1_THEP1       GRSS-ETLVLGRHSGKHALRKKLESYGIKLDE-ETFQKVFEKFTELADRKKEVYDDDLFS
LEU1_THENN       GRSS-ETLVLGRHSGKHALRKKLESYGIKLDD-ETFQKVFEKFTELADRKKEVYDDDLFS
LEU1_SEDSS       GRSS-ETIIMGRHSGKHALEDKLSQYNIKLTR-QQFEDVFARFTAIADKKKEVYDEDLFS
LEU1_GEOS4       GADS-MELILTARSGRHAFKNAVEKLGFETGEGDDFEALFEKFLLLADAKKEVYDHDVFY
LEU1_KLEP3       GLNQ-VQLNLTSRSGRAAVKHRMEEMGYQE-SDYNLDHLYDAFLKLADKKGQVFDYDLEA
LEU1_ENT38       GLNQ-VQLNLTSRSGRAAVKHRMEEMGYKE-TDYNMDHLYDAFLKLADKKGQVFDYDLEA
LEU1_SALNS       GLNQ-IQLNLTSRSGRAAVKHRMEEMGYKD-TDYNIDHLYDAFLKLADKKGQVFDYDLEA
LEU1_SALAR       GLNQ-VQLNLTSRSGRAAVKHRMEEMGYQE-SDYNLDRLYDAFLKLADKKGQVFDYDLEA
LEU1_CITK8       GLNQ-IQLNLTSRSGRAAVKHRMDEMGYKE-SEYNLDNLYDAFLKLADKKGQVFDYDLEA
LEU1_CROS8       GLNQ-VQLNLTSRSGRAAVKHRMEEMGYHE-NDYNLDDLYDAFLKLADKKGQVFDYDLEA
LEU1_ECOLI       GLNQ-IQLNLTSRSGRAAVKHRMDEMGYKE-SEYNLDNLYDAFLKLADKKGQVFDYDLEA
LEU1_ERWT9       GLKQ-VQLNLTSRSGRAAVKHRMEEMGYGE-TEYNMDRLYDAFKALADKKGQVFDYDLEA
LEU1_YERPS       GLKE-VQLNLTSRSGRAAVKHRMEEMGYQD-KDYNLDSLYDAFLKLADKKGQVFDYDLEA
LEU1_YERE8       GLKE-VQLNLTSRSGRAAVKHRMEEMGYQD-KDYNLDSLYDAFLKLADKKGQVFDYDLEA
LEU1_SERP5       GLKD-VQLNLTSRSGRAAVKHRMEGMGYKE-QDYNLDNLYAAFLKLADKKGQVFDYDLEA
LEU1_PECCP       GLKE-VQLNLTSRSGRAAVKHRMEEMGYQD-SDYNLDDLYSAFLKLADKKGQVFDYDLEA
LEU1_SODGM       GLKE-VQLNLTSRSGRAAVKHRMQEMGYQE-SNYSLDELYDAFLKLADKKGQVFDYDLEA
LEU1_EDWI9       GLPQ-TQLNLTSRSGRAAVKHRMEEMGYCEGNDFDLERLYQAFLRLADKKGQVFDYDLEA
LEU1_PHOLL       GLKE-IQLNLTSRSGRAAVKHRMEEMGYQD-KDYDLGSLYEAFLRLADKKGQVFDYDLEA
LEU1_PROMH       GLKE-VQLNLTSRSGRAAVKHRMEEMGYRE-TDYNLDSLYAAFLRLADKKGQVFDYDLEA
LEU1_BLOPB       GLKD-VKLNLTSRSGRAAVKHHMKTMGYQE-SDYDMDKLYDVFLELADKKGQVFDYDLEA
LEU1_BLOFL       GLKK-VQLNLTSRSGRAAVKYHMEKMGYQE-HDYNIDELYKVFLKLADQKGRVFNYELEA
LEU1_BUCAI       GLKE-VKLNLTSRSGRAAVKHYMDEMGYNN-SDYNIDELYTAFLKLADKKGQVFDYDLEA
LEU1_BUCDN       GVKE-VKLNLTSRSGRAAVKYYMDKMGYKD-DDYDIDELYSAFLKLADKKGQVFDYDLEA
LEU1_BUCAP       GLKE-VKLNLTSRSGRAAVKYYMTQMGYKE-CDYNIDELYTSFLKLADKKGQVFDYDLEA
LEU1_BUCRP       GLKE-VKLNLTSRSGRAAVKHYMTEMGYRE-CDYKIDELYASFLKLADKKGQVFDYDLEA
LEU1_BUCUN       GLKK-VKLNLTSRSGRAAVKYYMNEMGYKD-SDYNIDELYVDFLKLADKKGQVFDYDLEA
LEU1_BUCUM       GLKK-VKLNLTSRSGRAAVKHYMNEMGYKE-NDYNIDELYTDFLKLADKKGQVFDYDLEA
LEU1_BUCUE       GLKN-VQLNLTSRSGRAAVKYYMNEMGYKD-SDYNIDELYSDFLKLADKKGQVFDYDLES
LEU1_BUCML       GFKK-LKLNLTSRSGRAAVKYYMSEMGYKD-TDYNIDELYADFLKLADKKGQVFDYDLES
LEU1_BUCCC       GFTDYCSLNLTSRSGRAAVKHHMKKMGYEN-SDYNLNELYIDFLKLADKKGRIFDYDLEA
LEU1_AERHH       GLTQ-NNLNMTSRSGRHVIKHRMESMGYAE-SSYDLDDLYGKFLTLADKKGQVFDYDLEA
LEU1_AERS4       GLPQ-NNLNMTSRSGRHVIKHRMESMGYAE-SSYDLDHLYGKFLTLADKKGQVFDYDLEA
LEU1_TOLAT       GLNQ-NTLNLTSRSGRHVIKHRLALLGYPE-GSYDLDQIYTSFLQLADKKGQVFDYDLEA
LEU1_SHESR       GLNR-NNLNMTSRSGRHVIKHRMEEMGYSE-QNYNLDALYEQFLHLADKKGQVFDYDLEA
LEU1_SHEON       GLNR-NNLNMTSRSGRHVIKHRMEEMGYSS-QDYNLDALYEQFLHLADKKGQVFDYDLEA
LEU1_SHEB8       GLNR-NNLNMTSRSGRHVIKHRMEEMGYSE-HDYNMDALYEEFLKLADKKGQVFDYDLEA
LEU1_SHEAM       GLNR-NNLNMTSRSGRHVIKHRMEEMGYGA-GDYDMDTLYAAFLKLADKKGQVFDYDLEA
LEU1_SHEFN       GLNR-NNLNMTSRSGRHVIKHRMEEMGYKP-TDYDMDSLYEQFLTLADKKGQVFDYDLEA
LEU1_SHEHH       GLNR-NNLNMTSRSGRHVIKHRMSELGYGE-QDYDMDVLYEEFLALADKKGQVFDYDLEA
LEU1_SHEPA       GLNR-NNLNMTSRSGRHVIKHRMSELGYGE-QDYNMDVLYEEFLTLADKKGQVFDYDLEA
LEU1_SHEPW       GLNR-NNLNMTSRSGRHVIKHRMSELGYGD-QDYDMDVLYEDFLVLADKKGQVFDYDLEA
LEU1_SHESH       GLHR-NNLNMTSRSGRHVIKHRMEEMGYGN-KDYDMDTLYEAFLQLADKKGQVFDYDLEA
LEU1_SHEWM       GLPR-NNLNMTSRSGRHVIKHRMEEMGYGE-HDYDMDVLYESFLKLADKKGQVFDYDLEA
LEU1_SHELP       GLNR-NNLNMTSRSGRHVIKHRMEEMGYGE-QDYDMDTLYEAFLKLADKKGQVFDYDLEA
LEU1_SHEDO       GLHR-NNLNMTSRSGRHVIKHRMEEMGYHT-DDFDIDSLYEQFLKLADKKGQVFDYDLEA
LEU1_PSYIN       GIST-NKLNLTSRSGRHVIQHRMQELGYRD-TDYDLEQLYASFVELADKKGQVFDYDLEA
LEU1_ALIFM       GLKN-QALNLTSRSGRAAVKSHMDEMGYKE-DEYNLDTLYADFVKLADRKGQVFDYDLEA
LEU1_ALISL       GLKN-KALNLTSRSGRAAVKSHMDSMGYKA-EEYNLDTLYADFVKLADRKGQVFDYDLEA
LEU1_VIBCM       GLKN-QALNLTSRSGRAAVKSHMDSMGYNE-NEYNLDALYEDFLKLADRKGQVFDYDLEA
LEU1_VIBVU       GLKN-QALNLTSRSGRAAVKSHMDAMGYKE-DEYNLDALYQDFLKLADRKGQVFDYDLEA
LEU1_VIBPA       GLKN-QALNLTSRSGRAAVKSHMDSMGYKE-DEYNLDALYADFLKLADRKGQVFDYDLEA
LEU1_VIBTL       GLKN-KALNLTSRSGRAAVKSHMDAMGYKD-NEYNLDSLYEDFLKLADRKGQVFDYDLEA
LEU1_PHOPR       GLKS-QALNLTSRSGRAAVKNHMDTLGYID-GDYNLDTLYADFLKLADRKGQVFDYDLEA
LEU1_HISS2       GLKK-EKLNLTARSGRAAVKSHMDAMGYQQ-NDYDLDKLYAAFLKLADKKGQVFDYDLEA
LEU1_PASMU       GLKK-EKLNLTARSGRAAVKNHMSEMGYQE-SDYDLDKLYEAFLKLADKKGQVFDYDLEA
LEU1_HAEIE       GLKK-EKLNLTARSGRAAVKGHMADMGYNE-QDYDLDKLYDAFLKLADKKGQVFDYDLEA
LEU1_PSEA6       GINK-NNLNLTSRSGRHVIKHRLEELGYKA-EDYDLDTLYASFVKLADKKGQVFDYDLEA
LEU1_CAMJD       GIHE-NRMLMTARSGRAMIKTCLENLGYDE-NTYNLDDVYERFLRLADKKGQVYDYDLEA
LEU1_OLSUV       GAAG-SEIILSARSGHAALRHRLSELGYSF-PESEFDDVYQRFLEIADQKKEVFDEDLES
LEU1_PARD8       GIDD-NAIVLTARSGRAALKHRLHVLGVDL-EQEKLDKVYDEFLKLADRKKDINDDDVLM
                 *      . :   **   .                    :  .  :   :  .   ::  

LEU1_CROS5       IVNDEIQQAP-------------------ELFRLELVQVS-CGDH-SAPTATVTLRTP--
LEU1_RIPO1       IVNDEMQQAP-------------------ELFRLELVQVS-CGDH-ACPTATVTLRTP--
LEU1_GLOC7       IVNDEIQQAP-------------------EVFRLELVQVS-CGDQ-ARPTATVILRGP--
LEU1_NOSS1       IVNDEIQQAP-------------------DLFRVELVQVS-CGSN-ARPTATVTLRTP--
LEU1_MICAE       IVNDEIDTVP-------------------DHFRLELVQVS-CGNN-ARPTATVTIRTP--
LEU1_MICAN       IVNDEIDTVP-------------------DHFRLELVQVS-CGNS-ARPTATVTIRTP--
LEU1_SYNY3       IVNDEIRQPP-------------------ELFRLERVQVS-CGEP-SVPTATLTIRTP--
LEU1_SYNP2       IVKDETQQPP-------------------ELFRLELVQVS-CGDH-AQPTATITIRTP--
LEU1_TRIEI       IVNAEIQQPP-------------------ELFRLELVQVS-CGDR-SRPTATVIIRTP--
LEU1_THEEB       IAKDETQGIDL------------------QGYQLEFVQVS-CGDH-ARPTATVTVRTP--
LEU1_PROM0       IVSEQVQLPE-------------------AKFQLSLVQVS-CGNA-SKPTATISLLNTE-
LEU1_PROMS       IVSEQVQLPE-------------------AKFQLSLVQVS-CGNA-SKPTATISLLNTE-
LEU1_PROM9       IVSEQVQLPE-------------------AKFQLCLVQVS-CGNA-SKPTATITLLNTA-
LEU1_PROM2       IVSEQVQLPE-------------------AKFQLSLVQVS-CGNA-SKPTATISLINTE-
LEU1_PROM5       IVSEQVQLPE-------------------SRFQLSHVQVS-CGST-SKPTATVTILNTE-
LEU1_PROMP       IVSEQVQLPE-------------------SKFQLSHVQVS-CGST-SKPTATVTLINTE-
LEU1_PROM4       IVSEQVMQPD-------------------ARFQLQLVQVS-CGTT-LKPTATVTLADQ--
LEU1_PROMA       IVSEQVMQPE-------------------ARFKLHLVQVS-CGTA-LRPTATVTIADQ--
LEU1_PROMT       IVSEQVQLPE-------------------ALFQLKLVQVS-CGTS-LMPTATVTVVGE--
LEU1_SYNS9       IVSEQVQQPE-------------------ARFQLKFVQVS-CGST-SRPTATVALMDE--
LEU1_SYNSC       IVSEQVQQPE-------------------ARFQLKLVQVS-CGSS-LRPTATVTLLDE--
LEU1_SYNPX       IVSEQVQQPE-------------------ARYQLQLVQVS-CGTR-LKPTATVALSEE--
LEU1_PROMM       IVSEQVQQSE-------------------ARFQLRLVQVS-CGSS-LRPTATVILAQE--
LEU1_SYNPW       IVSEQVQQPD-------------------ARYQLKLVQVS-CGSS-LQPTATVTLLDE--
LEU1_SYNS3       IVSVQVQQPD-------------------AKYQLKLVQVS-CGSS-LQPTATVTLADE--
LEU1_SYNR3       IVRQNAQQIE-------------------AYYQLAGVQVS-CGRD-LRATATVTLRTS--
LEU1_GLOVI       VISDEIRLIP-------------------EAYRLEQVQVS-CGEP-GLPTATVRLTGP--
LEU1_HUNT2       LIIESAAKAVE------------------EAYVLEKIRVV-SGNI-ETPSAKVVIKDS--
LEU1_UNCTG       LIEEDTSSGK-------------------ETFILNYLSAT-SGTG-TIPTATVKISKSEG
LEU1_DESRM       MVEDEIKHIP-------------------DTYVLKYLHIS-TGTA-VVPTATLGLQMG--
LEU1_PELTS       IIEEEMRLVP-------------------HTYTLEYLHIS-SGTT-VVPTATVGLKRD--
LEU1_DESAP       ILDETIRQVP-------------------ATYELDYLHVF-SGTT-VKPTAVIGLLID--
LEU1_CARHZ       MMEEEIRKVP-------------------ETYTLDYFHIS-TGST-IIPTATVGLIKE--
LEU1_HELMI       LVEDELRAFP-------------------EAYSLEYLHIT-SGTV-LVPTATVRLRRE--
LEU1_CLOK5       LVKNEIFHVP-------------------EVFKLKYYQVF-TGNT-VVSTSTVEIECN--
LEU1_RUMCH       LVDENI-AVP-------------------EIFVIDSFQIN-SGNK-MISTSTVSVRKD--
LEU1_HALOH       LIDNHYHTFD-------------------KVYELDYLSVN-TGNK-VLPTATIKLKKE--
LEU1_DICT6       LVSNQIKLVP-------------------EYYRLVHLQVV-SGIG-IVPTATIIISED--
LEU1_DICTD       LVSNQIRIIP-------------------EYYKLRHLQVV-SGIG-IVPTATIIISEN--
LEU1_PYRAB       IIQEELTKSN-------------------GKLKVEIIHVT-SGK---VSTATVRISMN--
LEU1_PYRFU       IVQEELGKGK-------------------GKYSVEVLHVI-SGK---ISTATVRVQGD--
LEU1_STRM5       LMQ-----GG----------------SNAQGYRLASMTIS-DVG-SRA-NALVELSDPDG
LEU1_STRMK       LMQ-----GG----------------SNAQGYRLASMTIS-DVG-SRA-NALVELSDPDG
LEU1_XANOR       LMQ-----DA----------------TVQEGYRLASMTIS-DVG-SRA-NALVELSDPEG
LEU1_XANCP       LMQ-----DA----------------TVQEGYRLASMTIS-DVG-SRA-NALVELSDPDG
LEU1_XYLFA       LMQ-----DT----------------TVQHGYRLASMTIS-DIG-NRA-NALVELSDPQG
LEU1_ACIFD       IVAEE--LGT----------------TLADRFELVSFRVE-AGT-GRE-AVASATVLVDG
LEU1_SALRM       MMNDFGGDAVAAATGLPDNGVALN--GGTPAYRLDQFSVH-LSS-DDEAKVSVRLQRDD-
LEU1_LEPIN       LFSEE--ARK----------------STGDRFQLEGFTVS-TGTKST-PTAGVRILIDG-
LEU1_DEIRA       LV--D--ARS----------------DVPQTFSLEGFQIT-SGMNMM-PVAFVRLHTPD-
LEU1_CUPNH       IVSNE--AQH----------------DANEHFRFISLSQR-SETGER-PHARVVFSMDG-
LEU1_CUPPJ       IVSNE--AQH----------------DANEHYRFISLSQR-SETGER-PHARVVFNMDG-
LEU1_CUPMC       IVSDE--EQE----------------HANEHYRFISLSQR-SETGER-PHARVVFNIDG-
LEU11_RALSO      IVSNE--AQH----------------AEGEHFRFVSLSQR-SETGER-PHARIVFVADG-
LEU1_BURCM       IVSEE-SAFA----------------QEQEHYKFVSLSQR-SETGEQ-PQAKVVLALDG-
LEU1_BURVG       IVSEE-SALA----------------QEQEHVKFVSLSQH-SETGEQ-PQAKVVFAVEG-
LEU1_BURL3       IVSEE-SALA----------------HEQEHFKFVSLSQH-SETGEQ-PHAKVVFGVEG-
LEU1_BURM1       IVSQE-SALA----------------QEQEHFKFVSLSQH-SETGEQ-PHAKVVFSVDG-
LEU1_BURP6       IVTEEESALA----------------QEHEHYKFVSLAQR-SETGER-PQAKVVFAVDG-
LEU1_PARP8       IVTEE-SAEA----------------QEKEHYKFVSLSQH-SETGER-PHARIVFSVEG-
LEU1_POLNS       IMSDS--AAA----------------EEGEHYKFISLSQH-SETGER-PKSRVTFRMGD-
LEU1_POLAQ       IMSDS--AAA----------------EEGEHYHFISLSQH-SETGER-PKSRVIFRMGD-
LEU1_ACISJ       LVSDE-SVTS----------------EK-EQFGFVSLAQH-SETGER-PEATIVFTVDG-
LEU1_ACIAC       LVSGD-ATAG----------------AG-ERYGFVSLSQR-SETGER-PHAAVVFTVDG-
LEU1_POLNA       LVSDE-SVTH----------------SN-EQYGFVSLSQH-SETGER-PQACVIFTVAG-
LEU1_POLSJ       LVSDE-SITH----------------HDQEQYGFVSLAQH-SETGER-PHAVVVFTVAG-
LEU1_VARPS       LVSAE-EHSN----------------VD-EQFAFVSLSQH-SETGER-PQAKVVFTVQG-
LEU1_RHOFT       LVGSE-SVAR----------------EK-EQYSFVSLSQH-SETGER-PQASIVFTADG-
LEU1_VEREI       LVSDE-SVSG----------------DN-EQYGFVSLFQQ-SETGKQ-PHARIVFTVNG-
LEU1_LEPCP       LVSDE-QSDN----------------QA-EHYRLLALSQH-SEMGER-PHAEVAFAAGD-
LEU1_METPP       LVGDE-SVTH----------------EQ-ETYRLLSLEQQ-SATGER-PHAKVAFAVGE-
LEU1_CHRVO       LVSDE--MVT----------------IEREDYKLVSLKVV-SETGEP-PLASIVFVEHG-
LEU1_THIDA       LVSDE--GYA----------------TEDERFKLLSMKVC-SETGEV-PRAQLVFTDDG-
LEU1_NEIMB       LVSDE--MGS----------------MNAESYKFISQKIS-TETGEE-PRADIVFSIKG-
LEU1_NEIG1       LVSDE--MGN----------------MNAESYKFISQKIS-TETGEE-PRADIVFGIKG-
LEU1_AROAE       LMSDE--VVT----------------PDQEHYRLVASRFH-SETGET-PRADLTLSVDG-
LEU1_DECAR       LVSDD--LVT----------------PDQEYYKLVYSRVC-SETGEM-PRASVILNIGG-
LEU1_NITEC       LVSDE--AQI----------------P-EEHYRLLSLVAH-SETGEI-PFAQVVIATGN-
LEU1_NITEU       LVSDE--AQI----------------P-EEHYRLLSLHAV-SETGEI-PSAQVVIAVGG-
LEU1_NITMU       LVSDD--AAA----------------L-QEHYKLLSLTAH-SETGET-PHASIVIGEEG-
LEU1_METCA       LITEA--GAE----------------AEDERVKLVALRVC-SETGEI-PHAQVTIKVDN-
LEU1_NITOC       LVTDA--NLA----------------AENERFKLSWLKVV-SETGET-AIASVTLSVDS-
LEU1_RUTMC       LVSET-QTEA----------------Y--EAIKLVSLKVC-TETGEK-NTATVVLSIDD-
LEU1_VESOH       LVSET-QTES----------------CD-EAIKLVSLKVC-TETNEK-NTATVVLFIND-
LEU11_HYDCU      LVTDN-NTRR----------------VENETFRLVALKVG-TQTGDA-PTATITLWIDG-
LEU1_BRASB       LIDEG---MV----------------SAHDRIKLLSLSVI-AGTRGP-QRATMKLDVDG-
LEU1_BRASO       LIDEG---MV----------------SAHDRIKLLSLSVI-AGTRGP-QRATMKLDIDG-
LEU1_RHOP5       LVDLE---IA----------------QSHDRIKLVSLTVI-AGTHGP-QRATMKLDVDG-
LEU1_RHOPB       LVDQE---IA----------------QSHDRIKLLSLTVI-AGTHGP-QRATMKLDVEG-
LEU1_RHOPT       LVDEQ---LL----------------HGQDQIKLMSLTVI-AGTHGP-QRATMKLDVDG-
LEU1_RHOP2       LVDEQ---LL----------------HGQDQIKLNSLTVI-AGTHGP-QRATMKLDVDG-
LEU1_RHOPS       LVDEQ---LL----------------HGQDLIRLKSLTVI-AGTHGP-QRATMKIDVDG-
LEU1_BRADU       LVDEE---MA----------------ASHDRIKLTSLTVI-AGTHGP-QRATMKLDVDG-
LEU1_METNO       LVDEN---LA----------------TAHDRIRLLSLTVI-AGTRGP-QRATMRLDIDG-
LEU1_METPB       LVDEK---LA----------------TAHDRIKLLSLSVI-AGTRGP-QRATMKIEMDG-
LEU1_NITHX       LVDEE---MA----------------ASHDRIKLTSLTVI-AGTHGP-QRATMKLTVDG-
LEU1_NITWN       LVDEE---MA----------------ATHDRIKLSSLTVI-AGTHGP-QRATMKLTVSG-
LEU1_OLICO       LVDQE---LA----------------QTHDRLRLVSLTVI-AGTHGP-QRATMKVEVDG-
LEU1_CAUVN       LVDDA---LA----------------RGSEKIRVSRLRVV-AGTDG--QSAELTLDIDG-
LEU1_CAUSK       LVDDA---LA----------------RGSERIRVQRLRVV-AGTDG--QSAELTLEVDG-
LEU1_DESMR       LILEK---VL----------------RRPDRYALQFLSVH-CGNVELAPFAVVEMQVEG-
LEU1_DESVM       LVLEE---VY----------------RLPDLYRLVNLSVQ-CSDTGMPPTAAVVMDVMG-
LEU1_SYNAS       IVYEE---LY----------------RVEDKYKLIYLNVV-SGNVAI-PTATMQMEVDR-
LEU1_NITSB       LITNE-IASA----------------P--EVYKLKKLQ-I-NDCSEGVPSAAVTVEYEG-
LEU1_WOLSU       ILAEE-TSHI----------------P--KVYELVGIQ-L-SDCSMGRPYAAITLKKEG-
LEU1_ARCB4       LITDE-ALNH----------------D--KTYDLIGLQ-I-SDCTNGVPTAAVAIKYKD-
LEU1_CAMFF       LVSHE-IIKI----------------P--EIYSIQTLS-T-SSCNAGHSSAAVSIKFSD-
LEU1_CAMC1       LVAEE-ITKI----------------P--QAYEITDLL-Q-SS-GGSLASASMSIRHND-
LEU1_CAMHC       LMTDE-LVKI----------------P--CAFEIIALS-S-SECNKGHASAALTLKHND-
LEU1_AQUAE       LIYQE-FMKI----------------EDHEPVKVLHFQ-V-QSGDNMIPTATVKLEFKG-
LEU1_METI4       LVEGQ--ISR-----------------IKETYELEYVAVT-VCSGGI-PMATIKLRHGE-
LEU1_RHOBA       LVQQK--ISE----------------TVAPEWTLVDYEVT-SGKNQT-PNVRVTLRRDE-
LEU1_BACVZ       LILEE--KVT-D---------------KKIGYEFLSLQVH-YGTSQVPTATVSLKNQENE
LEU1_BACSU       LILEE--KVT-D---------------RKIGYEFLSLQVH-YGTSQVPTATLSLKNQENA
LEU1_BACLD       LILEE--KTA-D---------------RKIGYDFISLQVH-YGTSQVPTATVSLKDQETD
LEU11_BACP2      IILEE--KVA-D---------------RKIGYEFESLQVH-YGTEQMPTATVSLKNQETQ
LEU1_GEOKA       LIFEE--KFD-H---------------FKDFYQLSSIQVQ-YGTNQIPTAVVVLKDGKG-
LEU1_GEOSE       LIFEE--KFD-H---------------FKDFYQLSSIQVQ-YGTNQIPTAVVVLKYGKG-
LEU1_GEOTN       LIFEE--KFD-H---------------FKDFYQLSSIQVQ-YGTNQIPTAVVVLKDGKG-
LEU1_GEOSW       LIFEE--KFD-H---------------FKDFYQLSSLQVQ-YGTNQIPTAVVVLKDGQG-
LEU1_ANOFW       LILDE--KLD-T---------------YKNFYQLCSIQVQ-YGTNQIPTAVVVLKDGEG-
LEU1_BACHD       LMTEQ--TVG-G---------------ETNHYELQTLQVN-YGSNLTNTATITMKLPSG-
LEU1_BACSK       LIADA--TDD-Q---------------DSTAYELTALQVT-YGMNHVPTATIRLKKQDD-
LEU1_LYSSC       LLTEQ--QIQLE---------------DVPLFELKMVQVQ-YGTENIPTATAIVLTPEG-
LEU1_OCEIH       ILMDI--KTDST---------------VVDKYKLIQFGVS-YDTAATPKANVILESPNG-
LEU1_BACCQ       LMLGE--AAF-----------------AAQQYNITQLQVH-FVSNSTQCATVVLKDEEG-
LEU1_BACMK       LMLGE--AAF-----------------AAQQYSITQLQVH-FVSNSTQCATVVLKDEEG-
LEU1_BACCN       LMLGE--AAL-----------------LTQQYNIKQLQVH-FVSNHIQCATVVLQDGKG-
LEU1_LACLA       LFTGE--TVK-----------------NLAGFILDNVQI------DGHKALVQLKNQEE-
LEU1_LACLS       LFTGE--TVK-----------------NLAGFILNNVQI------DGHKALVELKNQDA-
LEU1_STRG3       LVAGT--EIE-----------------NPEGFHFGDLKLT-SNADDTVTAEVLMVNADG-
LEU1_STAAR       IIQGS--EHE-----------------HQALYKLETLQLQ-YVSSGLQSAVVVIKDKEG-
LEU1_STAHJ       IIQGT--EHE-----------------QNAIYQVDTLQLQ-FVSNGLQSAVVVIKDKNG-
LEU1_STAES       IIHGS--EHE-----------------HNAIFQLDNLQLQ-YVSKGLQSAVVVIKERNG-
LEU1_STAS1       LIQGT--EHE-----------------QNAIYKVETLQLQ-FVSNGLQSAVVVIKDIDG-
LEU1_STACT       LVQGH--SHE-----------------TNAAYQVETLQLQ-FVSEGVQSAVVVLKDHEG-
LEU1_LISMO       LILGQ--SSE-----------------SADDFELKHLQVQ-YVTGGVQGAIVRIEERDG-
LEU1_LISIN       LILGQ--SSE-----------------SHDAFELKHLQVQ-YVTGGVQGAIVRIEERDG-
LEU1_LISMH       LILGQ--SSE-----------------SADDFELKHLQVQ-YVTGGVQGAIVRIAERDG-
LEU1_LISW6       LILGQ--SSE-----------------STDNFELKHLQVQ-YVSGGVQGAIVRIEERDG-
LEU1_BREBN       LVDSK--MVR-----------------GPEAFQLESVQLA-YGNISVPTASVRLVRADG-
LEU1_THEP1       IVSEVLREPI-------------------NGYKLVHFHVH--TGNTLLPTAAVVLQVGD-
LEU1_THENN       IVSEVLKEPL-------------------NGYRLVHFHVH--TGNTLLPTAAVVLQVGN-
LEU1_SEDSS       IVGTVLGGVV-------------------KGFSLLYFHTF--TGNSLIPGATVKVRSEA-
LEU1_GEOS4       LVTQHRTHEE-------------------VSSHLYELDSFQVVTNDMYPTATVKLKKGS-
LEU1_KLEP3       LAFINKQQE------------------EPEHFRLDYFSVQ-SGS-SDIATASIKLVCG--
LEU1_ENT38       IAFINKQQE------------------EPEHFRMDYFSVQ-SGS-SDIATASVKLACG--
LEU1_SALNS       LAFINKQQE------------------EPEHFRLDYFSVQ-SGS-SDIATASVKLACG--
LEU1_SALAR       LAFINKQQE------------------EPEHFRLDYFSVQ-SGS-SDIATASVKLACG--
LEU1_CITK8       LAFINKQQE------------------EPEHFRLDYFSVQ-SGS-NDIATASVKLACG--
LEU1_CROS8       LAFINKQQE------------------EPEHFRLEYFSVQ-SGS-NAMATASVKLACG--
LEU1_ECOLI       LAFIGKQQE------------------EPEHFRLDYFSVQ-SGS-NDIATAAVKLACG--
LEU1_ERWT9       LAFINQQSE------------------EPEYFRLDTFNVQ-SGS-SVIATATVQLRCG--
LEU1_YERPS       LAFINKQQE------------------EPEYYRLDYFSVQ-SGS-SVMATASVKLVCG--
LEU1_YERE8       LAFINKQQE------------------EPEHYRLDYFSVQ-SGS-SVMATASVKLVCG--
LEU1_SERP5       LAFINKQQE------------------EPEHFSLDYFSVQ-SGS-SIMATASVKLICG--
LEU1_PECCP       LAFINRQQE------------------EPEFYHLDYFSVQ-SGS-SVMATASVKLICG--
LEU1_SODGM       LAFINNQQE------------------QSEHFRLEYFSVQ-SSS-ADIATASVKLAFG--
LEU1_EDWI9       LAFIDRQQE------------------EADHFRLEYFSVQ-SGS-SVMATASVRLICG--
LEU1_PHOLL       LAFINLQQQ------------------EPEFFHLDNFNIQ-SGS-NVMATAAVCLVCG--
LEU1_PROMH       LAFMGQQQQ------------------EPDEFVMNYFNTQ-SGS-STVATASVSISRK--
LEU1_BLOPB       LAFINNQQE------------------QSEFFRLKCFHVD-SSS-SEVAHASVKLYCG--
LEU1_BLOFL       LAFTKYSQE------------------YLEYFALESFHIH-STS-SALSNAIINLYCG--
LEU1_BUCAI       LAFINKQQD------------------EWEYFSLKFFSVQ-SIS-NSLSTASVKLLCG--
LEU1_BUCDN       LAIFSKKQE------------------NAEYFYLKFFSVQ-SIS-NGLSTASVKLKCG--
LEU1_BUCAP       LAFINMQQE------------------ESEYFSLSFFSVQ-SIS-NGLSTASVKLLCG--
LEU1_BUCRP       LAFINQQQE------------------ELEHFSLSFFSVQ-SIS-NGLSTASVKLLCG--
LEU1_BUCUN       LAFINKKQD------------------ELEHFCLKFFSVQ-SIS-NNLSTASVTLLCG--
LEU1_BUCUM       LAFINKQQD------------------ESEYFSLKFFSVQ-SIS-NNLSTASVTLLCG--
LEU1_BUCUE       LAFISKQQD------------------ELEYFCLKFFSVQ-SIS-NGLSTASVKLLCG--
LEU1_BUCML       LAFISKHPE------------------ELEHFCLKFFSVQ-SIS-NGLSTASIKLLCG--
LEU1_BUCCC       LAFFKKQQN------------------TEEYYKLEYFDVQ-SKL-SGLSTAYIVLICG--
LEU1_AERHH       LAFFSQIHE------------------EPEHFKLEYLGVQ-SGS-SVMATASVKLKVG--
LEU1_AERS4       LAFFSQIHE------------------EPEHFKLEYLGVQ-SGS-SVLATASVKLKVG--
LEU1_TOLAT       LLFFSQIQE------------------EPEHFKLNYLSVQ-SGG-SIMATASVRMKVG--
LEU1_SHESR       LAFMEAQAA------------------EDNFYQLQQLVVQ-SDSTEGVATATVRIDVG--
LEU1_SHEON       LAFIEAQAA------------------EDNFYQLRQLVVQ-SDSTEGVATATVRIEVG--
LEU1_SHEB8       LAFMEAQAE------------------EDNHYQLQQLVVQ-SDSTEGVATATVRIEVG--
LEU1_SHEAM       LAFMEAQAE------------------DDDHYVMEQLVVQ-SDSTEGKATATVRMRVG--
LEU1_SHEFN       LVFMESQAQ------------------DDDKYQLQHMMVH-SDSTEGVATATVRIAVD--
LEU1_SHEHH       LAFMEAQAE------------------DDDHFELQQLVVH-SDSTEGSATATVKVAVN--
LEU1_SHEPA       LAFMEAQAE------------------TDDHYKLQQLVVH-SDSTEGSATATVKVAVN--
LEU1_SHEPW       LAFMEAQAE------------------DDDHFKLQQLVVH-SDSTEGSATATVKVEVN--
LEU1_SHESH       LAFMEAQVD------------------EEADYKLAQLVVH-SDSTEGNATATVKLEID--
LEU1_SHEWM       LTFMEAQAE------------------EESFYQLKQLVVH-SDSTQGNATATVKIELD--
LEU1_SHELP       LVYVEAQAE------------------DENHYGLQQLVVH-SDSTQGQATATVTLSID--
LEU1_SHEDO       IVFMATQVA------------------EDDHYRLQHLSVH-SDSSEGVATATVRIKVE--
LEU1_PSYIN       LMFFNKVDS------------------DPQHYRLESINVQ-SGS-GLVATATIVMSIGE-
LEU1_ALIFM       LMHFANLRD------------------EDDFYKLNYLSVQ-SGS--VMATTSIKLLCG--
LEU1_ALISL       LMHFANLRD------------------EDDFYKLNYLSVQ-SGS--VMATTSIKLLCG--
LEU1_VIBCM       LMHFSNLRE------------------EDDFYKLNYLSVQ-SGS--VMATTSIKLLCG--
LEU1_VIBVU       LMHFSNLRE------------------EDDYYKLNYLSVQ-SGS--VMATTSIKLLCG--
LEU1_VIBPA       LMHFSNLRE------------------EDDFYKLNYLSVQ-SGS--VMATTSIKMQCG--
LEU1_VIBTL       LMHFANLRD------------------EDDFYKLNYLSVQ-SGS--VMSTTSIKLQCG--
LEU1_PHOPR       LMYFANLRD------------------EDDFFKLNYLSVQ-SGS--IMATTSIKLQCG--
LEU1_HISS2       LAFIDMQQG------------------DEDRLSLDVITSQ-TIS-NLPASAFVQVELD--
LEU1_PASMU       LAFIDMQQG------------------DEDRLTLDVITSQ-CIS-HLPASAFVQVELD--
LEU1_HAEIE       LAFIDMQQG------------------DEDRLVLDKLSAH-STK-EYPATAFVQLKLD--
LEU1_PSEA6       LLFFDKQKP------------------ADEHYKLLYLQAS-SGK-EIIPSATVKLQVG--
LEU1_CAMJD       LMFLSYESE------------------EENEFVLEKLSVI-SGN---IPTACVCMRIK--
LEU1_OLSUV       MVQERQRDV-------------------TAIYALESVQVV-CGD-AAIPTATVHITDEV-
LEU1_PARD8       LVG-KDRTA-------------------THRIKLEYLQVT-SGV-GVQSVASICL-NLS-
                 :                                .                          

LEU1_CROS5       -----EGKELTDAAIG--TGPVDAVYKAINRVVNVPNE--LIEFSVKSVTAGID-AMGEV
LEU1_RIPO1       -----DGQELTDAAIG--TGPVDAVYKAINRVVQVPNE--LIEFSVKSVTAGID-AMGEV
LEU1_GLOC7       -----EGQELMDAAIG--TGPVDAVYKAINRVVNVPNQ--LIEFSVKSVTAGID-AMGEV
LEU1_NOSS1       -----DGEELTDAAIG--TGPVDAVYKAINRVVNVPNQ--LIEFSVQSVTAGID-AIGEV
LEU1_MICAE       -----DGSELSDAAIG--TGPVDALCKAIDRVVQIPNE--LISFSVREVTEGID-ALGEV
LEU1_MICAN       -----DGSELSDAAIG--TGPVDALCKAIDRVVKIPNE--LISFSVREVTEGID-ALGEV
LEU1_SYNY3       -----AGPEETAVAIG--TGPVDAVYKAINQIVQLPNE--LLEYSVTSVTEGID-ALGKV
LEU1_SYNP2       -----GGKELTDAAIG--TGPVDAIYKAINRVVQVPNE--LIEYSVQSVTAGID-AIGEV
LEU1_TRIEI       -----NGEELTDAAIG--TGPVDAVYKAINRVVNVEND--LVEFSVQSVTAGID-AIGEV
LEU1_THEEB       -----SGEELTDAAIG--TGPVDAVYRAINRVVQIPNR--LIEYSVQSVTAGID-AIGEV
LEU1_PROM0       -----DNTEDTAVSIG--TGPVDAVCEALNKLAKVPNE--LIEFSVKSVTEGID-ALGEV
LEU1_PROMS       -----DNTEDTAVSIG--TGPVDAVCEALNKLAKVPNE--LIEFSVKSVTEGID-ALGEV
LEU1_PROM9       -----DNTEDTAVSVG--TGPVDAVCEALNKLAKVPNE--LIEFSVKSVTEGID-ALGEV
LEU1_PROM2       -----DNSEDTAVSIG--TGPVDAVCEALNKLAKVPNE--LIEFSVKSVTEGID-ALGEV
LEU1_PROM5       -----THTEDTSVAIG--TGPVDAVCEAINELAKVPNE--LIEFSVKSVTEGID-ALGEV
LEU1_PROMP       -----DHTEDTAVAIG--TGPVDAVCEALNALTKVPNE--LIEFSVKSVTEGID-ALGEV
LEU1_PROM4       -----DGTEQTAVALG--TGPVDAVCKALDSLAGESNE--LIEFSVKSVTEGID-ALGEV
LEU1_PROMA       -----DGIENTAVALG--TGPVDAVCKALRSLTNEKND--LIEFSVKSVTEGID-ALGEV
LEU1_PROMT       -----DGEEKTAVSLG--TGPVDAVVRALDSLTEEPNE--LIEFSVKSVTEGID-ALGEV
LEU1_SYNS9       -----EGGERTVSAVG--TGPVDAVCRALNCLADVPND--LIEFSVKSVTEGID-AIGEV
LEU1_SYNSC       -----EGSETTGSAVG--TGPVDAVCRALNDLAGVPNE--LIEFSVKSVTEGID-AMGDV
LEU1_SYNPX       -----NGPDQTVSAVG--TGPVDAVCRALNQLAGVPNE--LIEFSVKSVTEGID-AMGEV
LEU1_PROMM       -----DGQEQTAAAVG--TGPVDAVCRALNALAGEPNE--LIEFSVKSVTEGID-AMGEV
LEU1_SYNPW       -----EGQEQSEAAIG--TGPVDAVCRALNALAGEPNE--LVEFSVKSVTEGID-AMGEV
LEU1_SYNS3       -----NGQEQTAASVG--TGPVDAVCRSLNQLAGEPNE--LVEFSVKSVTEGID-AMGDV
LEU1_SYNR3       -----DGEECSQAAIG--TGPVDAVCQALNGLVQVPNE--LVEFSVKSVTEGID-AMGEV
LEU1_GLOVI       -----DGVERVDAAVG--TGPVDAVYKAINRLIELPNE--LIEFSVQSVTAGID-AMGEV
LEU1_HUNT2       -----KGNLLEAEQTG--NGPVDAVFKAINSVIKETENLTLYKYSVSAVTEEME-SLGEV
LEU1_UNCTG       NKKT-KSITLQAAACG--SGPVDATYKAIDKIINMDIK--LTDFSLRSVSSGED-ALGEV
LEU1_DESRM       -----DEL-KEEAACG--DGPVDAIYKTVDKITGIS--CTLVNYAINAITGGKD-ALGDV
LEU1_PELTS       -----GQL-MEEAACG--NGPVDAICKAIDKITGLN--CTMTSWGINAVTAGKD-ALGDV
LEU1_DESAP       -----GQF-VQEAACG--NGPVDATYKAIEKATGRK--YSLVSYVIDAVTGGTD-ALANV
LEU1_CARHZ       -----GEK-LEDAATG--DGPVDAIYKAINKITGLT--PVLEQYSINAVTSGED-ALGEV
LEU1_HELMI       -----EEN-FEEASCG--DGPVDAAYKAIEKITGTG--ARLASYAISATTAGED-SQGEV
LEU1_CLOK5       -----GKK-LSEASCG--DGPVDATFKAIEKATGID--VTLNDYFIKAVGSGKD-AMGEV
LEU1_RUMCH       -----EEI-ITEAATG--DGPVDAAFNAVERATGVN--AELVHYRIKAVTEGKD-ALGEV
LEU1_HALOH       -----NNIIEKAACSG--DGPVDAIFQAINEIVGIDD-IKLISYHINAVTEGKD-ALGEV
LEU1_DICT6       -----GEE-IKTVEIG--NGPVDAVYKAIAKAIKIP--HSLEDFSLKSVTGGTD-ALGEA
LEU1_DICTD       -----GEE-IKTVEIG--NGPVDAVYKAITKAVKVP--HSLEDFSLKSVTGGTD-ALGEA
LEU1_PYRAB       -----GEERIEVAWFK--NGPIDALFSAINKALGEE--FKLREYRVSSVTSGKD-SLGEV
LEU1_PYRFU       -----GIDKIESAWSS--NGPIDALFAAINRALGID--CKLKEYRVSSVTSGRD-ALGEV
LEU1_STRM5       -------NRVAETAQG--DGPVDALFGALSAATGVQ--LMLDSYHVHSVGIGAD-ARGEA
LEU1_STRMK       -------NRVAETAQG--DGPVDALFGALSAATGVQ--LMLDSYHVHSVGIGAD-ARGEA
LEU1_XANOR       -------NRVAETAQG--NGPVDALFGALASATGVK--LELDSYQVHSVGIGAD-ARGEA
LEU1_XANCP       -------NRVAETAQG--NGPVDALFGALASATGVK--LELDSYQVHSVGIGAD-ARGEA
LEU1_XYLFA       -------QRVAETAQG--NGPVDALFGALAAATGVK--LELDSYQVHSVGIGAD-ARGEA
LEU1_ACIFD       -------TPVEASASG--NGMVDALGRVLAEATALE--ARLTGFSVTSVTGGAD-ALGSV
LEU1_SALRM       ------GSAREEQATG--EGPVDALYRALDHAVD-AP-HTLVDYSIRSISEGAD-AQGEV
LEU1_LEPIN       -------HVREESATG--DGPVDAIYKAIQKTTGMD--PEVSRLVISPVTEGQD-AMAEA
LEU1_DEIRA       -------GPVDATAHG--DGPVEAAFQAISKITGIS--PTLESYRIQSVTRGDD-ALGEV
LEU1_CUPNH       -------QEQSGEGEG--NGPVDATLHAIESRVSSG--AEMVLYSVNAITGGTE-AQGEV
LEU1_CUPPJ       -------QEHSGEGEG--NGPVDATLHAIESQVNSG--AEMVLYSVNAITGGTE-AQGEV
LEU1_CUPMC       -------SEQTGEAEG--NGPVDATLHAIEGKVNSG--AELVLYSVNAITAGTQ-AQGEV
LEU11_RALSO      -------KEVTGEAEG--NGPVDATLNAIESKVASG--AEQLLYSVNAITTGTQ-AQGEV
LEU1_BURCM       -------KEVTGEARG--NGPVDATFNAIEGEVGSG--SELLLYSVNAITTGTQ-AQGEV
LEU1_BURVG       -------SEVTGEARG--NGPVDATFNAIEGEVGSG--SELLLYSVNAITTGTQ-AQGEV
LEU1_BURL3       -------KEVTGEARG--NGPVDATFNAIESEVGSG--SELLLYSVNAITTGTQ-AQGEV
LEU1_BURM1       -------KEVTGEARG--NGPVDATLNAIESEVGSG--SELLLYSVNAITTGTQ-AQGEV
LEU1_BURP6       -------DEVAGEASG--NGPVDATFNAIETEVGSG--AELLLYSVNAITTGTQ-AQGEV
LEU1_PARP8       -------KEVVGEANG--NGPVDATLNAIETEVGSG--SELLLYSVNAITTGTQ-AQGEV
LEU1_POLNS       -------REISSEAEG--NGPVDASLNAIEGIAKSG--AEQLLYSVNAITSGTQ-SQGEV
LEU1_POLAQ       -------KEVSSEAEG--NGPVDASLNAIEEIAKSG--AEQLLYSVNAITSGTQ-SQGEV
LEU1_ACISJ       -------KEVRSSSEG--NGPVDASMKAIEAHVRSG--AEMVLYSVNAI-SGSTESQGEV
LEU1_ACIAC       -------KEVHGASEG--NGPVDASLKAIESHVHSG--AEMVLYSVNAI-SGSTESQGEV
LEU1_POLNA       -------KEVKGESDG--NGPVDASLKAIETHVKSG--AEMVLYSVNAI-SGSTESQGEV
LEU1_POLSJ       -------KEIRGESDG--NGPVDASLKAIETHVKSG--AEMVLYSVNAI-SGSTESQGEV
LEU1_VARPS       -------KEVTGESDG--NGPVDASLKAIESHVKSG--AEMVLYSVNAI-SGSTESQGEV
LEU1_RHOFT       -------KEVKSSSDG--DGPVDASLKAIEAQVKSG--AEMVLYSVNAI-SGSTESQGEV
LEU1_VEREI       -------QNVHAEAQG--NGPVDASLKAIEAHVHSG--AEMVLYSVNAI-SGSTESQGEV
LEU1_LEPCP       -------VEHHARSDG--NGPVDASIKAIESKVGTG--AELLLYSVNAITSGSTESQGEV
LEU1_METPP       -------TEFHAESEG--NGPVDASLKAIESKLKSG--AEMLLYSVNAITSGSTESQGEV
LEU1_CHRVO       -------QEQHGESSG--SGPVDAAFKAIEKVVGSG--AELELYSVNAITKGTE-SQGEV
LEU1_THIDA       -------AEKQASGEG--SGPVDATFKALESVVHSG--ADLLLYSVNNITSGTD-AQGEV
LEU1_NEIMB       -------EEKRASATG--SGPVDAIFKAIESVAQSG--AALQIYSVNAVTQGTE-SQGET
LEU1_NEIG1       -------EEKRASATG--SGPVDAIFKAIESVAQSG--ATLQIYSVNAVTQGTE-SQGET
LEU1_AROAE       -------QETRTSAEG--SGPVDAAFKAIEAIAGSG--TELLLYSVNAITTGTD-AQGEV
LEU1_DECAR       -------VEHKAEADG--GGPVDATFKAIESIAGSG--AELLLYSVNAITTGTD-AQGEV
LEU1_NITEC       -------NEQQAESEG--SGPVDATFRAIEKILNSK--AELQLFSVNNITSGTD-ALGEV
LEU1_NITEU       -------SEKQAVSEG--SGPVDATFRAIEKILDSK--VELQLFSVNNITSGTD-AQGEV
LEU1_NITMU       -------RESRAESDG--SGPVDATFRAIEKILNSG--VELQLYSVNAITSGTD-SQGEV
LEU1_METCA       -------EERTGTSSG--GGAVDASLKAIESLLHTD--TALTLYSVNNITSGTD-AQGEV
LEU1_NITOC       -------IERQASAPG--SGPVDAAYKAIDSILQSN--TELLLYSVNSITSGTD-AQGEV
LEU1_RUTMC       -------KEQTATANT--SGAVDATFIAISSLTGIK--INLQLYSVSNVTQGTD-ALGEV
LEU1_VESOH       -------KKKTATANT--SGAVDATFSAINSLASIK--INLQLYSVSNVTQGTD-ALGEV
LEU11_HYDCU      -------EEKTASSEG--GGVVDATFKAIEKLVDSG--ATLELYSVSNVTNGTD-SLGET
LEU1_BRASB       -------VTKIEESEG--NGPVDAVFNCIKSLVPHE--AKLELYQVHAVTEGTD-AQAEV
LEU1_BRASO       -------VTRIEESEG--NGPVDAVFNCIKSLVPHE--AKLELYQVHAVTEGTD-AQAEV
LEU1_RHOP5       -------QTKIEEAEG--NGPVDAVFNCIKALVPHV--AKLELYQVHAVTEGTD-AQAEV
LEU1_RHOPB       -------QTRIEEAEG--NGPVDAVFNCIKALVPHV--AKLELYQVHAVTQGTD-AQAEV
LEU1_RHOPT       -------QIRIEEAEG--NGPVDAVFNCIKALVPHD--AKLELYQVHAVTEGTD-AQAEV
LEU1_RHOP2       -------QIRIEEAEG--NGPVDAVFNCIKALVPHD--AKLELYQVHAVTEGTD-AQAEV
LEU1_RHOPS       -------QLRIEEAEG--NGPVDAVFNCIKALVPHD--AKLELYQVHAVTEGTD-AQAEV
LEU1_BRADU       -------QIKIEEAEG--NGPVDAVFNCIKRLVPHE--AKLELYQVHAVTEGTD-AQAEV
LEU1_METNO       -------RQATEEADG--NGPVDAVFNAIHALVPHE--AKLELYDVHAVTEGTD-AQAEV
LEU1_METPB       -------RTFTEEADG--NGPVDAVFNAIHEIVPHD--AVLELYQVHAVTEGTD-AQAEV
LEU1_NITHX       -------QTRIEEAEG--NGPVDAVFNCIKRLVPHE--AKLDLYQVHAVTHGTD-AQAEV
LEU1_NITWN       -------QTRIEEAEG--NGPVDAVFNCIKRLVPHE--AKLELYQVHAVTQGTD-AQAEV
LEU1_OLICO       -------KVRIDEAEG--NGPVDAVFNAVKTLVPHE--AKLELYQVHAVTAGTD-AQAEV
LEU1_CAUVN       -------VASTAEATG--DGPVDAVFNAIHKIVPHS--AALRLFQVHAVTEGTD-AQAQV
LEU1_CAUSK       -------EVKTSEASG--DGPVDAVFNAIQQIVPHD--AALRLFQVHAVTEGTD-AQAQV
LEU1_DESMR       -------QTVRHYSAG--SGPVDAVFNAVCQAVGRK--PDLEEYQINAITGGTD-AQGEV
LEU1_DESVM       -------EVKRAAGFG--VGPIDAVFNVIGEIVGRA--PVLERYSVTAITGGTD-AQGEV
LEU1_SYNAS       -------EIVQDAGFG--VGPVDATFDAIRKITGTN--YDLLRYVVNAISGGTD-AQGEV
LEU1_NITSB       -------KEITDAGIG--DGTIDAIFKTIDRITGVQ--GKLNDYQVIAVSKGKD-ALAKV
LEU1_WOLSU       ------SEEIVDAAIG--NGSVDALFKTIDRISQIK--GELKDYKVEAVTQGKD-ALAKV
LEU1_ARCB4       -------EIIKDAAIG--DGTMDAIFKTIDRITGFS--GELKDYKVISVTEGKD-ALAKV
LEU1_CAMFF       -------NIISDAALG--NGTADAIFKVIDRISGIS--GELKDYKVNAVSQGKD-ALAKI
LEU1_CAMC1       -------EIVSDSALG--NGTADAIFKVVDRISGIN--GTLKDYKVTAVSQGKD-ALAKV
LEU1_CAMHC       -------EILKDSALG--NGVVDAIFKTIDRISGIK--GNLKDYQVRAVSQGKD-AQAKV
LEU1_AQUAE       -------EEREASSTG--NGPVDATIKAIQKALGIE--PKLLDYSIKALTPNTD-AQAEA
LEU1_METI4       -------EVLVDASTG--DGAVDAAMKAVDRITGQH--GHLVEYEVKSVTEGKD-AIGEV
LEU1_RHOBA       ------QDITEQVAQG--DGPIDAAFWAVEKITGIQ--VVCKDFRVRSATLGRD-AIGEV
LEU1_BACVZ       -------QLMQEAATG--AGSVEAVYNTLGRCIDKN--IELTDYRIQSNRKGED-ALAQV
LEU1_BACSU       -------QLIQEAATG--AGSVEAIYNTLERCIDKD--VELLDYRIQSNRKGED-AFAQV
LEU1_BACLD       -------QVIQEAATG--AGSVEAVYNTLKRCMDKE--VQLLDYRIQSNRKGQD-AFAQV
LEU11_BACP2      -------EVIQEAATG--AGSVEAVYNTLERCMEER--IHLLDYRIQSNGKGRD-ALAEV
LEU1_GEOKA       -------NEIQEAATG--AGSVEALYNTLERCFQTP--VTLLDYRIESVGGGRD-ALAQV
LEU1_GEOSE       -------NEIQEAATG--SGSVYALYNTLERCFQTE--VTLLDYRIESVGGGRD-ALAQV
LEU1_GEOTN       -------NTIQEAATG--AGSVEALYNTLERCFQTA--VTLLDYRIESVGGGRD-ALAQV
LEU1_GEOSW       -------NEIQEAATG--AGSVEALYNTLERCFKTS--VTLLDYRIESVSGGRD-ALAQV
LEU1_ANOFW       -------NDIQEAATG--AGSVEALYNALEKALQLP--VTLLDYRIESVGSGRD-ALAQV
LEU1_BACHD       -------EVAEEAATG--SGSVEAIYNTLERLLDAP--VKLLDYRIQSITGGRD-ALADV
LEU1_BACSK       -------REIEEAGTG--SGSVEAIYNTLAKMTGGN--YSLADYRIQSVNGGED-ALAEV
LEU1_LYSSC       -------LEKTVVATG--AGSVEAIFNTLEQLVPNA--VHVIDYRVTSVGKGRD-ALGEA
LEU1_OCEIH       -------SLIEATQQG--NGSVEALYKTINYLIAEN--ITLVDYQINSVGGGKD-ALAES
LEU1_BACCQ       -------NVFEDAATG--SGSIEAIYNAIQRILGLE--CELADYRIQSITQGQD-ALAHV
LEU1_BACMK       -------NMYEDAATG--SGSIEAIYNAIQRILGLE--CDLADYRIQSITQGQD-ALAHV
LEU1_BACCN       -------NKYEDAATG--AGSIEAIYHAIQRILEME--CKLVDYRIQSITQGQD-ALAHV
LEU1_LACLA       -------EIYVSQGEG--SGSVDAIFKAIDKVFNHQ--LKLISYSVDAVTDGID-AQATT
LEU1_LACLS       -------EIYVSQGEG--SGSVDAIFQAIDKVFNYQ--LKLISYSVDAVTNGID-AQATT
LEU1_STRG3       -------EEVEVIANG--KGSVEAIYNAVDKFFNQT--VRLLSYTMDAVTDGID-SQARV
LEU1_STAAR       -------HIYQDSSIG--TGSIVAIYNAVDRIFQKE--TELIDYRINSVTEGTD-AQAEV
LEU1_STAHJ       -------NIYQDSSIG--TGSIVAIYNAVDRIFKHK--SELIDYRIDSVTEGTD-AQAEV
LEU1_STAES       -------QVKQDSSIG--TGSIVAIYNAVDRIFKKD--AELIDYRIDSVTEGTD-AQAEV
LEU1_STAS1       -------NTYQDSSIG--TGSIVSVYNAVDRIFDRK--TELIEYRIDSVTEGTD-AQAEV
LEU1_STACT       -------KEYPSAAIG--TGSIVAVYNAVDQIFKAP--SELLNYQITSVTEGSD-AQAQV
LEU1_LISMO       -------ALVEDAATG--SGSIEAIYNTINRLMKQD--IELTDYRIQAITAGQD-AQAEV
LEU1_LISIN       -------ALIEDAATG--SGSIEAIYNTINRLMKQD--IELTDYRIQAITAGQD-AQAEV
LEU1_LISMH       -------TLIEDAATG--SGSIEAIYNTINRLMKQN--IELTNYHIQAITAGQD-AQAEV
LEU1_LISW6       -------ALIEDAATG--SGSIEAIYNTINRLMKQD--IELIDYRIQAITAGQD-AQAEV
LEU1_BREBN       -------SVCEEAACG--NGSVDSIYKAIDRATGEE--VSLVDYKILSVTHGQD-ALGEV
LEU1_THEP1       -------EKKEAAEAG--NGPVDAIFKAIDKALGIQ--PKLEEYIIQAVGTGKN-AQGEV
LEU1_THENN       -------EKKEAAETG--NGPVDAIFKAIDKALGLQ--PKLEEYIIQAVGTGKN-AQGEV
LEU1_SEDSS       -------GEKVASATG--DGPVDAVFNAIDECVGIN--ARLKEYIIHAIGSGKD-AQGEV
LEU1_GEOS4       -------ETFRDSMVG--DGPIDALYSAIKALVGLD--VQLKDYKINSLSRGKE-AIGRV
LEU1_KLEP3       ------DEIKTEAANG--NGPVDAIYQAINRVTNYN--IDLVKYGLSAKGHGKD-ALGQV
LEU1_ENT38       ------DEIKAEAANG--NGPVDAIYQAINRVTGYD--VELVKYDLSAKGHGKD-ALGQV
LEU1_SALNS       ------EEIKAEAANG--NGPVDAIYQAINRITGYD--VELVKYDLNAKGQGKD-ALGQV
LEU1_SALAR       ------EETKAEAANG--NGPVDAIYQAINRITGYD--VELVKYDLNAKGQGKD-ALGQV
LEU1_CITK8       ------DDIKAEAANG--NGPVDAIYQAINRITDYN--IELVKYSLSAKGHGKD-ALGQV
LEU1_CROS8       ------EEIKAEAANG--NGPVDAVYQAINRITDYD--IELVKYQLGAKGHGKN-ALGQV
LEU1_ECOLI       ------EEVKAEAANG--NGPVDAVYQAINRITEYN--VELVKYSLTAKGHGKD-ALGQV
LEU1_ERWT9       ------DEQKTEAATG--NGPVDAVYQAINRLTEFD--AELVSYQLTAKGHGKD-ALGQV
LEU1_YERPS       ------EEIKSEAATG--NGPVDAVYQAINRITDYP--IELVKYQLSAKGQGKD-ALGQV
LEU1_YERE8       ------EEIKSEAATG--NGPVDAVYQAINRITDYP--IELVKYQLSANGQGKD-ALGQV
LEU1_SERP5       ------EEEKAEAATG--NGPVDAVYQAINRITGYP--IELVKYQLTAKGQGRD-ALGQV
LEU1_PECCP       ------EETQSEAATG--NGPVDAVYQAINRITGYQ--VSLVKYQLTAKGQGRD-ALGQV
LEU1_SODGM       ------DEVHAEAATG--NGPVDAVYEALNRITQLP--IQLEKYQLTAKGHGRD-ALGQV
LEU1_EDWI9       ------AETRAEAATG--NGPVDAVYQAISRITDIS--VDIVKYQLSAKGQGRD-ALGQV
LEU1_PHOLL       ------KELKSEAATG--NGPVDAVYQAISRITEYP--IELVSYQLSGKGQGKN-ALGQV
LEU1_PROMH       ------NEEITEAATG--NGPVDAVYQAISRATGYP--LKLVTYQLTAKGEGRD-ALGQV
LEU1_BLOPB       ------NNTYTHSSS--GNGPIDAIYEALTHISKLS--INLERYQLNAKGHGRN-ALGQV
LEU1_BLOFL       ------KEKKIHSCSTTGRGPIDAAYKALTLISKLP--IKLEKYQLHSKKYEYN-ILGQV
LEU1_BUCAI       ------KKTYTESSTT-SNGPVDAIYQALNRIACFP--IILQKFQLVAKGKGKD-ALGQV
LEU1_BUCDN       ------KKVYTESSTT-SNGPVDATYQALNKIINFP--ITLQKFQLVAKGKGKD-ALGQV
LEU1_BUCAP       ------KKVSIESATT-SNGPIDAIYQALNRITNFP--ITLQKYQLVAKGKGRD-ALGQV
LEU1_BUCRP       ------KKTFIESATT-SNGPIDAIYQALNRITHFP--IILQKYQLIAKGKGKD-ALGQV
LEU1_BUCUN       ------DKIYTESSTT-SNGPVXAIYQALNRITHFP--IILQKFQLIAKGQGKD-ALGQV
LEU1_BUCUM       ------KKIYTEASTT-SNGPVDAIYQALNRITHFP--IVLQKFQLVAKGKGKD-ALGQV
LEU1_BUCUE       ------KKVYTESSTT-SNGPVDAIYQALNRITHFP--ITLQKFQLIAKGKGKD-ALGQV
LEU1_BUCML       ------QKLYIESSTT-SNGPVDAIYQALNKITNFP--IILQKFQLIAKGKGKD-ALGQV
LEU1_BUCCC       ------SQTNIQKATT-YNGPVDAIYQALNKATLYS--IVLKKFHLEANGEGKD-ALGKV
LEU1_AERHH       ------QEIVSEAATG--NGPVDAVYQCINRITGYE--ISIDKYELKGKGEGKN-ALGQV
LEU1_AERS4       ------QDLVCEAATG--NGPVDAVYQCINRITGYE--IRIDKYALKAKGEGKN-ALGQV
LEU1_TOLAT       ------DEEVTEAATG--NGPVDAVYQCINRITGYE--INISKYDLKSKGIGKD-ALGQV
LEU1_SHESR       ------GEIKTEAATG--NGPVDAAYNAIARATDRR--IDIISYKLSAKGEGQN-ALGQV
LEU1_SHEON       ------GEIKTEAATG--NGPVDAAYNAIARATDRR--IDIISYKLGAKGVGQD-ALGQV
LEU1_SHEB8       ------GEIKTEAATG--NGPVDAAYNAIARATDRR--IDIISYKLGAKGVGQN-ALGQV
LEU1_SHEAM       ------DEVITEAATG--NGPVDAAYNAIARATHRT--INISSYKLGAKGEGQN-ALGQV
LEU1_SHEFN       ------GKDITEAATG--NGPVDAAYNAIARATDRK--INITNYKLSAKGEGQN-ALGQV
LEU1_SHEHH       ------GETITEAATG--NGPVDAAYKAVARASGCK--TNITSYQLSAKGEGHN-ALGQV
LEU1_SHEPA       ------GETITEAATG--NGPVDAAYKAVARASGCE--INISSYQLSAKGEGQN-ALGQV
LEU1_SHEPW       ------GETVTEAAIG--NGPVDAAYKAVARASGCE--IDITSYQLGAKGEGQN-ALGQV
LEU1_SHESH       ------GKTVTEAATG--NGPVDAAYNAIARASQCE--VNITSYKLSAKGEGQN-ALGQV
LEU1_SHEWM       ------GEVVTEAATG--NGPVDAAYNAIARASKCE--INITSYKLSAKGEGQD-ALGQV
LEU1_SHELP       ------GKAVTEAATG--NGPVDAAYKAIARASGCE--INISSYQLSAKGQGQD-ALGQV
LEU1_SHEDO       ------GEDLTEAAIG--NGPVDAAYKAIARASGRE--VEISSYKLSAKGQGQD-ALGQV
LEU1_PSYIN       ------DKKVVEAATG--NGPIDAAYQCLMRISGLD--INMDDYHINAKGAGKD-ALGQV
LEU1_ALIFM       ------DEEKCEAAVG--NGPVDALYQCIYKLTGYD--IVLDKFDLTAKGEGED-GLGQA
LEU1_ALISL       ------DEEKCEAAVG--NGPVDALYQCIYKLTGYE--IVLDKFDLTAKGEGED-GLGQA
LEU1_VIBCM       ------GEEKCEAAVG--NGPVDALYQCIYRITGYE--IVLDKFDLTAKGEGED-GLGQA
LEU1_VIBVU       ------DEEKCEAAVG--NGPVDALYQCIYRLTGYD--IVLDKFDLTAKGEGED-GLGQA
LEU1_VIBPA       ------DAEMCEAAVG--NGPVDALYQCIYRVTGYE--IVLDKFDLTAKGEGED-GLGQA
LEU1_VIBTL       ------DEEKCEAAVG--NGPVDALYQCIYRLTGYE--IALDKFDLTAKGEGED-GLGQA
LEU1_PHOPR       ------DEEKCEAAVG--NGPVDALYQCIYRLTGYE--IALDKFDLTAKGEGED-GLGQA
LEU1_HISS2       ------GKKISQVSNG-GNGPVDAVYNAILAITDMD--ITMLHYNLTAKGEGAE-ALGQV
LEU1_PASMU       ------GKKMSQVSNG-GNGPVDAVYNAILAITGLE--MKMLNYNLTAKGEGAE-ALGQV
LEU1_HAEIE       ------GNKLITSSIG-GNGPVDAVYNAILNLTGLE--IKMSHYNLTAKGEGAE-ALGQV
LEU1_PSEA6       ------EEEIIESCTG--NGPVDAAYKAIIKVLGHEQ-LEIVDFKLDSKGEGAD-ALAQV
LEU1_CAMJD       ------EELKTEACTG--NGPVEAVFNCIARITNLK--PVLKAYSINAKSSGVD-AQGQV
LEU1_OLSUV       ------GGEHVVACTG--TGPVDAAYKAIDKVVS-VH-GDLQEFAVKAITRGID-AIGEV
LEU1_PARD8       ------GVRRYEAAAG--NGPVDAGIKAVKKAISNSD-MTIQEFLIQAINKGSD-DTGKV
                                    *   :    :                :           .  

LEU1_CROS5       TIRLRH---EG----RIYSGYAANTDIITASARAYISALNRLYGAIQEQTKVHPSEPVLT
LEU1_RIPO1       TIRLRY---ED----KIYSGYAANTDIITASARAYISALNRLYGSIQDQSATEVTKSEVA
LEU1_GLOC7       TIRLKY---EN----RIFSGHAANTDIIVASARAYISALNRLYAAIE-QEKAEKEKAAVT
LEU1_NOSS1       TIRLRY---ES----RVFSGHAANTDIIVASAQAYVNALNRLYASLQTQDKQ----TEVT
LEU1_MICAE       TIRLRY---AG----RTYSARAADTDIIVASARAYVSALNRLHVALQQKEKTPEMLQV--
LEU1_MICAN       TIRLRY---EG----RTYSAHAADTDIIVASARAYVSALNRLHVALQQKEKTPEMLQV--
LEU1_SYNY3       SVRLRH---NG----VIYTGYAANTDIIVASARAYLGALNRLYAALEKSREHPPVVASL-
LEU1_SYNP2       TIRLRH---EG----RIYSGHAANTDIVVASARAYISALNRLYAALQEDVSANPAKASL-
LEU1_TRIEI       TIRVRH---EG----RVYSGHAANTDIIVASAEAYLSALNRLYAVLQRGVEKINLPKDQP
LEU1_THEEB       TIRLQH---QD----RIYSGHAANTDIIVASAQAYMNALNRLYRGLEQRALHPQA-----
LEU1_PROM0       TIRIRR---DN----KIYSGHSADTDVVVAAANAYINALNRLVFSEKKNSIHPQFDNLEN
LEU1_PROMS       TIRIRR---DN----KIYSGHSADTDVVVAAANAYVNALNRLVFSEKKNSIHPQFDSLEN
LEU1_PROM9       TIRIRR---DN----KIYSGHSADTDVVVAAANAYVNALNRLVFSEKKNSIHPQFDNLEN
LEU1_PROM2       TIRIRR---DN----KIYSGHSADTDVVVAAANAYVNALNRLVFSEKKSSIHPQFDNLEN
LEU1_PROM5       TIRIRN---KN----KIYSGHSADTDVVVAAANAFLNALNRLIFSEKKECIHPQFDNLEN
LEU1_PROMP       TIRIRN---KN----KIYSGHSADTDVVVAAANAFVNALNRLVFSEKKNSIHPQFDDLEN
LEU1_PROM4       TIRLRR---EG----KIFSGHSADTDVVVAAAQAYVNALNRLIYFEKKNPIHPQHDLIKA
LEU1_PROMA       TIRLRR---DG----KIFSGHSADTDVVVAAAQAYINALNRLVYSLKKSSLHPQHDVVKA
LEU1_PROMT       TIRIRR---DG----NLFSGHSADTDVVVAAAQAYINALNRLVAAHGRKSIHPQHDLAKV
LEU1_SYNS9       TIRLRR---DG----SLYSGHAADTDVVVAAAMAFVNALNRLVAGQERQSLHPQKDPVVL
LEU1_SYNSC       TIRLRR---NG----ALYSGHAADTDVVVAAGMAFVNALNRLVAGEERQSLHPQKDPVVL
LEU1_SYNPX       TIRLRR---DG----SLYSGHAADTDVVVAAAMAFINALNRLVAAQEHQPLHPQRDAVVL
LEU1_PROMM       TIRLRR---DG----QLFSGHSADTDVVVAAAQAFVNALNRLVAGCGRQSLHPQHDAVLA
LEU1_SYNPW       TIRLRR---DG----QLFSGHAADTDVVVAAAQAFVNALNRLVAGSLNPTLHPQRDATPL
LEU1_SYNS3       TIRLRR---DG----QLYSGHSAHTDVVVAAAEAFVNALNRLVAGTAGPTIHPQLDMAQL
LEU1_SYNR3       TIRLRQ---DG----RLYSGHAADTDVVVAAAQAFVNALNRLVSGQKHSPLHPQRAPLPA
LEU1_GLOVI       TIRVRQ---DG----RTFSGHAANTDIIVASARAYLNALNKLHFALAHPTHSGGALAHPD
LEU1_HUNT2       SVTLRE---KE----KLYTGIGTHTDIITSSAIAYIDAINKAIAANARAQKN--------
LEU1_UNCTG       VLKAEY---KG----TIYSGKGTSTDIIEASAKAYIQAINKAKLFYDNKKGK--------
LEU1_DESRM       TVKIRC---EEK--EKVYIGRGVSTDILEASAKAYVNAINKLIHDMQ-------------
LEU1_PELTS       SLKVTA---DG---EKVYVGRGISTDVLEASAKAYVNAVNKLIWDSQK------------
LEU1_DESAP       TLKMRD---DD---HRVYTGRGVSADVLEASARAYVNIMNKIVYDERTRKHE--------
LEU1_CARHZ       VVKLKN---GL---GKIVTGRGVSTDILEASAKAYLNGINKLLFDYQAKGEKQ-------
LEU1_HELMI       SVKLER---EG----RFYTGRGVDTDIIVASAKAYLNAVNKIVFDGLPKAKTERAV----
LEU1_CLOK5       TVRI-E---KE---GKIFSAKGISTDIVEASGIAFINAVNKLYYETYSKDLQKISAN---
LEU1_RUMCH       TVKI-S---NN---NSIFMGKGVSTDIIEASVKAYLNAINRSISEIGESIISQ-------
LEU1_HALOH       IVKT-K---IE---DNTYTGHSAMTDITEASALAYLETINKFLTSEQTRQTTSAQEGI--
LEU1_DICT6       MVKLSD---KD---GNIYVGRATSTDIVEASALAYLRALNQLVMLKGKG-----------
LEU1_DICTD       MVKLSD---KD---GNIYVGRATSTDVIEASALAYLRALNQLVMLKGKD-----------
LEU1_PYRAB       LVRV-E---VN---GEIFVGRGLSTDIIEASA----------------------------
LEU1_PYRFU       LVRV-E---YN---GEIYVGRGLSTDIIEASAQAYLSALNRIRR----------------
LEU1_STRM5       NLSVRH---EGV----EYDGTGTSKDIIEASALAWLDVANRLLRQRQANAASTTEAPAPA
LEU1_STRMK       NLSVRH---EGV----EYDGTGTSKDIIEASALAWLDVANRLLRQRQATAHNSTDVPTPA
LEU1_XANOR       SLSVRH---DGV----EYEGTGTSKDIIEASALAWLDVANRLLRQRERGVIAGKTAAVA-
LEU1_XANCP       SLSVRH---DGV----EYEGTGTSKDIIEASALAWLDVANRLLRQRERGVVAGKTAAVA-
LEU1_XYLFA       NLSVRH---NDT----QYEGTGTSKDIIEASALAWLDVANRLLRNPE-NMQNKQNTALA-
LEU1_ACIFD       AVTVDV---GGH----EVSGRGVSTDIVEASARALLNALNRAARVREKASNRETP-----
LEU1_SALRM       EVTIRY--GENQ-----FAGTARNTDVIRASAEAYVDALNRLVAAQEHAESVEFVQNGIM
LEU1_LEPIN       SVTLEY---KGD----RVVGKGSSTDIIEACSRAYISALNRL------------------
LEU1_DEIRA       SIHVRH----GET---QLNGTGVATDIVEASARAWIRVMNMIVAGMGKNKAITQMTP---
LEU1_CUPNH       TVRLSK---AGR----IVNGVGTDPDIVAASAKAYLAALNKLH--DKAVQKINPQI----
LEU1_CUPPJ       TVRLSK---AGR----IVNGVGTDPDIVAASAKAYLAALNKLH--DKAVQKINPQI----
LEU1_CUPMC       TVRLSK---AGR----IVNGVGTDPDIVAASAKAYLAALNKLH--DKAVQKINPQI----
LEU11_RALSO      TVRLSK---SGR----IVNGVGTDPDIVAASAKAYLAALNKLQ--DKSSEKLNPQI----
LEU1_BURCM       TVRLSK---SGR----IVNGVGTDPDIVAASAKAYIAALNKLH--SKD-DKLNPQRS---
LEU1_BURVG       TVRLSK---NGR----IVNGVGTDPDIVAASAKAYIAALNKLH--SKD-DKLNPQRA---
LEU1_BURL3       TVRLSK---SGR----IVNGVGTDPDIVAASAKAYISALNKLH--SKD-DKVNPQRS---
LEU1_BURM1       TVRLSK---SGR----IVNGVGTDPDIVAASAKAYIAALNKLH--SKD-DKLNPQRS---
LEU1_BURP6       TVRLSK---SGR----IVNGVGTDPDIVAASAKAYIAALNKLY--SNA-DKLNPQRA---
LEU1_PARP8       TVRLSK---AGR----IVNGVGTDPDIVAASAKAYISALNRLY--AGA-DKLNPQRADI-
LEU1_POLNS       TVRLAK---GGR----IVNGVGTDPDIIAASAKAYLSALNKLH--DPSQAKLNAQMTP--
LEU1_POLAQ       TVRLSK---GGR----IVNGVGTDPDIIAASAKAYLSALNKLH--DPSQAKLNAQMAP--
LEU1_ACISJ       TVRLQS---AGR----VVNGVGADPDIVVASAKAYLSALNKLQ--SKA-ERVAAQG----
LEU1_ACIAC       TVRLQD---SGR----VVNGVGADPDIVVASAKAYLSALNKLQ--SKA-ERVAAQG----
LEU1_POLNA       TVRLQN---SGR----VVNGVGSDPDIVVASAKAYLSALNKLQ--SKA-DRVAAQG----
LEU1_POLSJ       TVRLQN---NGR----VVNGVGADPDIVVASAKAYLSALNKLQ--SKA-DRVAAQG----
LEU1_VARPS       TVRLQN---AGR----VVNGVGADPDIVVASAKAYLSALNKLQ--SQA-EKVAAQG----
LEU1_RHOFT       TVRLQH---GGR----VVNGVGADPDIIVASAKAYLSALSKLH--SKA-DRVAAQG----
LEU1_VEREI       TVRLQN---SGR----IVNGVGADPDIVVASAKAYFSALNKLQ--NKA-DRVAAQG----
LEU1_LEPCP       TVRLQL---GGR----IVNGVGADPDIVVASAKAYLAALNKLH--SKA-ERVAAQG----
LEU1_METPP       TVRLQH---GGR----VVNGVGADPDIVVASAKAYLSALNKLH--SKN-ERVAAQG----
LEU1_CHRVO       TVRLSR---EGR----IVNGQGADTDIIVASAKAYLSALNKLT--IEE-KMNAQAAA---
LEU1_THIDA       TVRLAQ---DGR----VVNGQGADTDIVVASAKAYLHALNKLH--SKR-ERAHPQV----
LEU1_NEIMB       SVRLAR---GNR----VVNGQGADTDVLVATAKAYLSALSKLE--FSA-AKPKAQGSGTI
LEU1_NEIG1       SVRLAR---GNR----VVNGQGADTDILAATAKAYLSALSKLE--FSA-AKPKAQGSGTI
LEU1_AROAE       TVRLAR---EDK----VVNGQGADTDIIVASAKAYLNALNKLH--SKL-ERLNPQL----
LEU1_DECAR       TTRLSK---GDR----IVNGNGADTDIVIASARSYLNALNKLH--STL-DKVKAQGGV--
LEU1_NITEC       TVRLQK---VGR----IVNGHGADTDIIAASAKAYLNACNKLH--SSL-ERTHPQV----
LEU1_NITEU       TVRLQK---AGR----IVNGHGADTDIIAASAKAYLSACNKLH--SSL-ERTHPQI----
LEU1_NITMU       TVRLQK---SGR----IVNGNGADTDIVVASAKAYLSALNKLH--SKL-ERAHPQV----
LEU1_METCA       TVRLEK---GGR----IVNGQGADTDIVIASAKAYVNAVNKLL--APIQRT-HPQVGDV-
LEU1_NITOC       TVRLKK---NGR----IANGQGADTDIVMASAKAYVNALNKIL--YPVERA-YPQV----
LEU1_RUTMC       NVRLEC---NGR----IVNGQGVDTDIITASAKAYVHGLNKVL--AATNKAQHPQI----
LEU1_VESOH       NVRLEY---NGR----IVNGQGVDTDIITASAKAYVHGLNKVL--TVTNKA-HPQI----
LEU11_HYDCU      TVRMEK---AGR----IVNGQGADTDIVTASAKAYINALNKLI--DTGSKE-HPQAHV--
LEU1_BRASB       SVRLSQ---DGR----SMTARAADPDTLVASAKAYLGALNKLV--MKRQRDVAQGAAAAA
LEU1_BRASO       SVRLSQ---DGR----SMTARAADPDTLVASAKAYLGALNKLV--MKRQRDVAPGHGASA
LEU1_RHOP5       SVRLSH---EGR----SVTSRASDPDTLVASAKAYLGALNKIV--MKRQRDMAAPAAAAS
LEU1_RHOPB       SVRLAH---EGR----SMTARAADPDTLVASAKAYLSALNKIV--MKRERDLPVPEAAAS
LEU1_RHOPT       SVRLSH---EGR----SMTARAADPDTLVASAKAYLGALNKIV--AKRQRSVREDAPTVA
LEU1_RHOP2       SVRLSH---EGR----SMTARAADPDTLVASAKAYLGALNKIV--AKRQRDVREAVPAVA
LEU1_RHOPS       SVRLSH---EGR----SMTARAADPDTLVASAKAYLGALNKIV--AKRQRDVRQDAPAVA
LEU1_BRADU       SVRLSH---DGR----SMTARAADPDTLVASAKAYLGALNKIV--MKRQRDTVTTAAAS-
LEU1_METNO       SVRLRQ---GER----SVTARGADPDTLVASAKAYLAALNKLL--AGANRLHAQHAAAE-
LEU1_METPB       SVRLKA---GER----SVTARGADPDTLVASAKAYLSALNKLS--AASVRLHAQHAAVV-
LEU1_NITHX       SVRLSQ---DGR----AMTSKAADPDTLVASAKAYLGALNKIV--MKHQRDVPSAAAAS-
LEU1_NITWN       SVRLSQ---DGR----AMTSKAADPDTLVASAKAYLGALNKIV--MKHQRDVPAAAAS--
LEU1_OLICO       SVRLSQ---DGR----SVTARSSDPDTLVASAKAYLSALNKII--SRQQREAPVAAAS--
LEU1_CAUVN       SVRLEE---DGR----IATGAAADTDTLTASAKAYVNALNNLF--ARKEKSRPEAAIASG
LEU1_CAUSK       SVRLEE---DGR----IATGQAADTDTLTASAKAYVNALNNLM--ARKEKSRPEAAIASG
LEU1_DESMR       TVRIKD----GTA---TTVGRGVHDDVIMASTLAFINALNRLA--KKEEERTCPQL----
LEU1_DESVM       TVRLRQ---NGS----SAVGRGSDPDIILASARAYVNALNRLA--KKEEEQEKEGI----
LEU1_SYNAS       TVQLKF---NGR----SVVGHGADLDVIVASARAYINALNRLEFLKRDAGKIKSEYE---
LEU1_NITSB       VVKVVF---DENK--PAVIGHGLSIDTMIASAKAYVGALNSYISMKDMLRTKRDEEI---
LEU1_WOLSU       VVKVEF---EENK--PAIIGHGLHIDTMLATAKAYVGALNSYLSMRELMGKKKCEEERI-
LEU1_ARCB4       TTRVSF---DETS--PAFVGHGLSIDTMLATAKAYIGALNSYLSQKKRLSKSSEHQV---
LEU1_CAMFF       TVKVVF---EGSS--CATIGHGLDIDTMMASAKAYVSALNSYLSMKNR------------
LEU1_CAMC1       DVKVEF---EGK---TAVMGHGLDIDTMMASAKAYVGALNSYLRIHKN------------
LEU1_CAMHC       TVKVLF---ENS---STIIGHGLDTDTLMATAKAYIGALNSYISMKQ-------------
LEU1_AQUAE       RVVLEL---DGV----KASGRGVDTDIIKASVKAFTDALNRAIVRKEYIIQRQEIREEGT
LEU1_METI4       TVKVNF--DSKK----LVTAKAASTDVIEASIKAYLNAVNKALL----------------
LEU1_RHOBA       NLEVEH--EGK-----TYRGTGVSTDSVESTILAMLNAINRIVAGIASDPGELPQP----
LEU1_BACVZ       FVRVTVN--GKE-----SSGRGIAQDVLEASAKAYLNAVNRQLVLDCNLDGLKRQTAVGS
LEU1_BACSU       YVRVLVN--GKE-----SAGRGIAQDVLEASAKAYLNAVNRQLVFQSNMSGLKNHTAVGS
LEU1_BACLD       YVRVMID--GKE-----SGGRGVAQDVLEASAKAYLNAVNRYLVLKTNTEGLSKQAAVGS
LEU11_BACP2      YVTVSIE--GKE-----TAGRGVAQDVLEASAKAYVNAVNRHLIFKSNLIEIEKHHAIS-
LEU1_GEOKA       FVKVRAH--DIE-----TSGRGTAQDVLEASAKAYINAINRVFMIEAMRGENEKVATP--
LEU1_GEOSE       FVKVRVR--DVE-----TSGRGTAQDVLEASAKAYINAMNRVFMIEAMRAENEKVATS--
LEU1_GEOTN       FVKVRVN--DVE-----TSGRGTAQDVLEASAKAYINAMNRMFMIEAMRAENEKVTTP--
LEU1_GEOSW       FVKVRVN--DIE-----TSGRGTAQDVLEASAKAYINAVNRVFMIETMRAENQKVAMQ--
LEU1_ANOFW       YVKVSLD--RKE-----ASGRGTAQDVLEASAKAYIHAVNRMFVIEKMKEEQALAAQ---
LEU1_BACHD       YVQMDYQ--GVV-----SSGRGTAHDVLEASAKAYLNAVNRTINRKKYAEVYGSKVEV--
LEU1_BACSK       HVRIQAD--DFE-----QSGRGVAHDVLEASAKAYLHAVNRVIARKHYAKREMAKVES--
LEU1_LYSSC       VVNIRYD--HVS-----TTGRNSSQDVLEASAKAYLNAINRHLIKESLRAHPV-------
LEU1_OCEIH       HVQIIIN--GET-----INGRGSAQDVLQASAVAFIQAVNRYYVQKKANLTRLVYES---
LEU1_BACCQ       HVELKEG--THQ-----VSGFGVAQDVLEASARAYVHAAGKLKSFIQLVK----------
LEU1_BACMK       HVELKEG--THQ-----VSGFGVAQDVLEASARAYVHAAGKLKSFITLVK----------
LEU1_BACCN       HVELKEG--PHQ-----VSGFGVAQDVLEASARAYVHAAGKLKALLTLVK----------
LEU1_LACLA       LVSVENLSTGTI-----FNAKGVDYDVLKGSAIAYMNANVLVQKENLQGKVEQISAHDGI
LEU1_LACLS       VVSVENLATGTI-----FNAKGVDYDVLKGSAIAYMNANVLVQKENSQGKVEQISAHDGI
LEU1_STRG3       SVSIENVDTGTI-----FNASGIDFDVLKAGAIAYVNANAFVQKENAGEIGKAVSFRDVP
LEU1_STAAR       HVNLLIE--GKT-----VNGFGIDHDILQASCKAYVEAHAKFAAENVEKVGN--------
LEU1_STAHJ       HVSLTIE--GQP-----VNGIGIDHDVLYASCKAYVEAHAKYASEINKKEGNH-------
LEU1_STAES       HVRIIIN--HIE-----VTGIGIDHDILKASCKAYIDAHAKYISEYELKEGIRT------
LEU1_STAS1       HVQIKID--DQI-----VTGVGIDHDILLASCKSYVEAHAKYVANTKVEEGIHS------
LEU1_STACT       NVEIRID--GKT-----YYGIGVDHDVLLASCKAYVEANSNHLADTARKDGVVS------
LEU1_LISMO       HVVIKND-KGAE-----FHGIGIDFDVLTASAKAYLQASGKSKTASKQADFEEVK-----
LEU1_LISIN       HVVIKDD-NGTE-----FHGIGIDFDVLTASAKAYLQASGKSKSTSKQADFEEVK-----
LEU1_LISMH       HVVIKDK-SGAE-----FHGIGIDFDVLTASAKAYLQASAKSKTGSKQADFEEVK-----
LEU1_LISW6       HVVIKDN-NETE-----FHGIGIDFDVLTASAKAYLQASGKSKSTTKQVDFEEVK-----
LEU1_BREBN       FVRLQQD--DLI-----VTGRGVSTDVLEASAIAYVRAVNKIMERRGEPTPVSATI----
LEU1_THEP1       KLTLRI---NGEL----YSGRGVSTDIVEASAIAYINAINKYLIAKGLLRKNGGAE----
LEU1_THENN       KLTLKI---DGEL----YSGRGVSTDIVEASAIAYINAINKYLIAKGLLRKNGGVE----
LEU1_SEDSS       KLEVEI---EGAT----YGGKASSTDIIEASAMAYLNAVNRFELRKR-------------
LEU1_GEOS4       NIRIEY---QGKI----YSGRAMDTDIIKASALAFLNGINAVLLDAGHDSQAPVSAR---
LEU1_KLEP3       DIVVDY---NGRR----FHGVGLATDIVESSAKAMVHVLNNIWRAAEVEKELQRKAQN--
LEU1_ENT38       DIVVTY---NGRR----FHGVGLATDIVESSAKAMVHVLNNIWRAAEVEKELQRKAQN--
LEU1_SALNS       DIVVNH---HGRR----FHGVGLATDIVESSAKAMVHVLNNIWRAAEVEKELQRKAQN--
LEU1_SALAR       DIVVNH---HGRR----FHGVGLATDIVESSAKAMVHVLNNIWRAAEVEKELQRKAHN--
LEU1_CITK8       DIVANY---NGRR----FHGVGLATDIVESSAKAMVHVLNNIWRAAEVEKELQRKAQN--
LEU1_CROS8       DIVVSY---NGRH----FHGVGLTTDIVESSARAMINVLNNIWRAGEVEKELQRKAQN--
LEU1_ECOLI       DIVANY---NGRR----FHGVGLATDIVESSAKAMVHVLNNIWRAAEVEKELQRKAQH--
LEU1_ERWT9       DIVVQY---NGRK----FHGVGLATDIVESSAKAMVNALNTIWRARQVEQELQRKSQV--
LEU1_YERPS       DIVVDH---KGRR----FHGVGLATDIVESSAKALVHVLNNIWRAHQVEKEKQRLQQ---
LEU1_YERE8       DIVVDH---KGRR----FHGVGLATDIVESSAKALVHVLNNIWRAHQVEIEKQRLQQ---
LEU1_SERP5       DIVVSY---NGRR----FHGVGLATDIVESSAKAMVHVLNNIWRSQQVEKEKQRLQQS--
LEU1_PECCP       DIVADY---QGRR----FHGVGLATDIVESSAQAMVNVLNNIKRAQQVEKEIQRLQQHNN
LEU1_SODGM       DIVVEY---EGRR----FHGVGLATDIIESSALAMVNSMNTIWRARQVGIELRRLHQHN-
LEU1_EDWI9       DIVAEH---QGRR----FHGVGLTTDIVESSAQALIHVLNHIWRARQVEQERQRLHSPV-
LEU1_PHOLL       NIVVEC---FGRR----FHGMGLETDIVESSAKAMVHALNCVWRTEQVKKEKQRIQQN--
LEU1_PROMH       DIVVEY---QGRK----FHGMGLETDIVGSSANAMMHVINSIWRSEQVEIEK-RKHHT--
LEU1_BLOPB       DIVVSY---EGRN----FHGVGLDTDVIKSSVKAMIHVLNNIWRAKQVIIQRKYIKKN--
LEU1_BLOFL       NIIVSY---QGRH----FHGIGSNIDIIKASIIAMIQALNNIWQTKQITINHKNTQHI--
LEU1_BUCAI       DILVEH---KKRK----FHGVGLATDIIEASAQAMINVLNNIWKAKQVNKKLKILKDF--
LEU1_BUCDN       DILVKY---ENRQ----FHGIGLATDIIESSAQAMINVLNNIWKSQQVNKKLKNLKKY--
LEU1_BUCAP       DILVEY---KKRK----FHGVGLATDIIESSAQAMVNVLNNIWKANQVNEKLKTLKKV--
LEU1_BUCRP       DILVEH---KKRK----FHGMGLATDIIESSAQAMVNVLNNIWKANQVNEKLKKLKKI--
LEU1_BUCUN       DILVKY---KKRQ----FHGVGLATDIIESSAQAMINVLNNIWKVKQVNKNLKNLKK---
LEU1_BUCUM       DILVEY---KKRK----FHGVGLATDIMESSAKAMVNVLNNIWKAKQVNKNLKNLKKQ--
LEU1_BUCUE       DILVEY---KKRK----FHGVGLATDIIESSAKAMINVLNNIWKAKQVNKKLKILKKK--
LEU1_BUCML       NILIEY---KKRK----FHGIGLATDFIESSAKAMVNVLNNIWQAEQVNKKLQELKK---
LEU1_BUCCC       NIIVQY---KLRN----FHGVGLATDIIEASAQAMVNVLNYIWKSQQVNKELERLQK---
LEU1_AERHH       DIVAQY---KGRK----FHGMGLATDIIESSAQALIHVINSIWRADQVAEQMERNVAKTD
LEU1_AERS4       DIVAEY---KGRK----FHGMGLATDIIESSAQALIHVINSIWRADQVAEQMERNVTKTD
LEU1_TOLAT       DIVAEF---KGRK----FHGMGLATDIVESSAQALVHVINNIYRALQVAEHKERFAQKTV
LEU1_SHESR       DITAVY---HEQN----FHGVGLATDVVEASARALVHVMNLTCRADKVADYKQNMHKNR-
LEU1_SHEON       DITAVY---HEQN----FHGVGLATDVVEASARALVHVMNLTCRADKVADYKQNMHKNR-
LEU1_SHEB8       DITAVY---HEQN----FHGVGLATDVVEASARALVHVMNLTCRADKVADYKQSMQKNR-
LEU1_SHEAM       DITARY---DDRN----FHGVGLATDVVEASAQALVHVMNLTWRADKVAYCKQQMQQTR-
LEU1_SHEFN       DITAKY---NEQM----FHGVGLATDVVEASAQALVHVMNLVYRADKVADFKQQIHKER-
LEU1_SHEHH       DITAKY---REQN----FHGVGLATDVVEASAKALIHVMNLTWRADKVADCKQRIQQNKQ
LEU1_SHEPA       DITAKY---REQN----FHGVGLATDVVEASAKALVHVMNLTWRADKVADCKQRIQQNKR
LEU1_SHEPW       DITASY---RNQN----FHGVGLATDVVEASVKALVHVMNLTWRADKVADCKQKIQQEKQ
LEU1_SHESH       DIEANY---NEQS----FHGVGLATDVVEASVQALVHVMNLTSRADKVADCKEKIQKDRS
LEU1_SHEWM       DIEASY---QQQS----FHGVGLATDVVEASVQALIHVMNLTWRADKVADCKQKIQQKAR
LEU1_SHELP       DITAKY---HDQS----FHGVGLATDVVEASAAALIHVMNLTWRADKVAENKHKLKQART
LEU1_SHEDO       DITAKY---QGRT----FHGVGLATDVVEASAQALVHVMNLICRADKVADIKSQIQFNR-
LEU1_PSYIN       DIVATY---NGQK----FHGLGLSTDIIESSTKAMVHVMNHIHLAKAVAIEKEQLIHIDQ
LEU1_ALIFM       DIIANY---KGRK----YHGTGLATDIIEASGQALLHVINSIHRADQIAEIKQKK-VETV
LEU1_ALISL       DIIANY---KGRK----YHGTGLATDIIEASGQALLHVINSIHRADQIAEIKQNK-ITTV
LEU1_VIBCM       DIIANY---KGRK----YHGTGVSTDIVEASGQALLHVINSIHRADQIAQIKQKKSVATV
LEU1_VIBVU       DIIANY---KGRK----YHGTGISTDIVEASGQALLHVINSIHRADEIAEMKQKK-IATV
LEU1_VIBPA       DIIANY---KGRK----YHGTGVSTDIVEASGQALLHVINSIHRADTIAEMKQKK-IATV
LEU1_VIBTL       DIIANY---KGRK----YHGTGVSTDIVEASGQALLHVINSIQRADTIAEMKQQK-FATV
LEU1_PHOPR       DIIANY---KGRK----YHGTGLATDIVEASGQALLHVINSIYRADQIAEIKERI--ATV
LEU1_HISS2       DIVVEH---KGRR----FHGVGLATDIVESSARALIHAINAIYRANKVADLKSHKISQ--
LEU1_PASMU       DIVVEH---EGRR----FHGVGLATDIVESSARALIHAINAIYRSQKVADLKLHKIAGV-
LEU1_HAEIE       DIVVEH---KGRK----FHGVGLATDIVESSALALVHAINAIYRAHKVADIKNHKHH---
LEU1_PSEA6       SVIVEY---NGRR----FNGIGLATDIVESGVKALIHVLNNTHLADQIDHQKKQQTQTAG
LEU1_CAMJD       DVDLEF---KGRK----FHGKGLSTDVIEASAQAFVSAYNAIYRSLKVEERKMA------
LEU1_OLSUV       TVRIVAG--DGRL----YTGRGSDTDIVVSSAKAYVNAINRMIQTTRSKQGK--------
LEU1_PARD8       HMQVEY---NGAT----YYGFSANTDIIAASVEAFVDAINKFIVD---------------
                                    .     *   .                              

LEU1_CROS5       SKN--------------------
LEU1_RIPO1       AI---------------------
LEU1_GLOC7       SAS--------------------
LEU1_NOSS1       A----------------------
LEU1_MICAE       -----------------------
LEU1_MICAN       -----------------------
LEU1_SYNY3       -----------------------
LEU1_SYNP2       -----------------------
LEU1_TRIEI       TEVVAGS----------------
LEU1_THEEB       -----------------------
LEU1_PROM0       SNNTYISNPAN------------
LEU1_PROMS       STNTFLSNNAN------------
LEU1_PROM9       SNKTFLSNPAN------------
LEU1_PROM2       ADKTLLSNPGK------------
LEU1_PROM5       SEKKVFSNPKN------------
LEU1_PROMP       PKNKVLSNPKK------------
LEU1_PROM4       NL---------------------
LEU1_PROMA       NL---------------------
LEU1_PROMT       EKKGI------------------
LEU1_SYNS9       DARPTL-----------------
LEU1_SYNSC       ESRPTL-----------------
LEU1_SYNPX       DARPTL-----------------
LEU1_PROMM       DLRSGI-----------------
LEU1_SYNPW       DASPTL-----------------
LEU1_SYNS3       DSSPVH-----------------
LEU1_SYNR3       PAL--------------------
LEU1_GLOVI       AAAQKL-----------------
LEU1_HUNT2       -----------------------
LEU1_UNCTG       -----------------------
LEU1_DESRM       -----------------------
LEU1_PELTS       -----------------------
LEU1_DESAP       -----------------------
LEU1_CARHZ       -----------------------
LEU1_HELMI       -----------------------
LEU1_CLOK5       -----------------------
LEU1_RUMCH       -----------------------
LEU1_HALOH       -----------------------
LEU1_DICT6       -----------------------
LEU1_DICTD       -----------------------
LEU1_PYRAB       -----------------------
LEU1_PYRFU       -----------------------
LEU1_STRM5       TA---------------------
LEU1_STRMK       TA---------------------
LEU1_XANOR       -----------------------
LEU1_XANCP       -----------------------
LEU1_XYLFA       -----------------------
LEU1_ACIFD       -----------------------
LEU1_SALRM       HTYGE------------------
LEU1_LEPIN       -----------------------
LEU1_DEIRA       -----------------------
LEU1_CUPNH       -----------------------
LEU1_CUPPJ       -----------------------
LEU1_CUPMC       -----------------------
LEU11_RALSO      -----------------------
LEU1_BURCM       -----------------------
LEU1_BURVG       -----------------------
LEU1_BURL3       -----------------------
LEU1_BURM1       -----------------------
LEU1_BURP6       -----------------------
LEU1_PARP8       -----------------------
LEU1_POLNS       -----------------------
LEU1_POLAQ       -----------------------
LEU1_ACISJ       -----------------------
LEU1_ACIAC       -----------------------
LEU1_POLNA       -----------------------
LEU1_POLSJ       -----------------------
LEU1_VARPS       -----------------------
LEU1_RHOFT       -----------------------
LEU1_VEREI       -----------------------
LEU1_LEPCP       -----------------------
LEU1_METPP       -----------------------
LEU1_CHRVO       -----------------------
LEU1_THIDA       -----------------------
LEU1_NEIMB       -----------------------
LEU1_NEIG1       -----------------------
LEU1_AROAE       -----------------------
LEU1_DECAR       -----------------------
LEU1_NITEC       -----------------------
LEU1_NITEU       -----------------------
LEU1_NITMU       -----------------------
LEU1_METCA       -----------------------
LEU1_NITOC       -----------------------
LEU1_RUTMC       -----------------------
LEU1_VESOH       -----------------------
LEU11_HYDCU      -----------------------
LEU1_BRASB       AS---------------------
LEU1_BRASO       AAAS-------------------
LEU1_RHOP5       -----------------------
LEU1_RHOPB       -----------------------
LEU1_RHOPT       VAG--------------------
LEU1_RHOP2       AAG--------------------
LEU1_RHOPS       VAG--------------------
LEU1_BRADU       -----------------------
LEU1_METNO       -----------------------
LEU1_METPB       -----------------------
LEU1_NITHX       -----------------------
LEU1_NITWN       -----------------------
LEU1_OLICO       -----------------------
LEU1_CAUVN       F----------------------
LEU1_CAUSK       F----------------------
LEU1_DESMR       -----------------------
LEU1_DESVM       -----------------------
LEU1_SYNAS       -----------------------
LEU1_NITSB       -----------------------
LEU1_WOLSU       -----------------------
LEU1_ARCB4       -----------------------
LEU1_CAMFF       -----------------------
LEU1_CAMC1       -----------------------
LEU1_CAMHC       -----------------------
LEU1_AQUAE       V----------------------
LEU1_METI4       -----------------------
LEU1_RHOBA       -----------------------
LEU1_BACVZ       -----------------------
LEU1_BACSU       -----------------------
LEU1_BACLD       -----------------------
LEU11_BACP2      -----------------------
LEU1_GEOKA       -----------------------
LEU1_GEOSE       -----------------------
LEU1_GEOTN       -----------------------
LEU1_GEOSW       -----------------------
LEU1_ANOFW       -----------------------
LEU1_BACHD       -----------------------
LEU1_BACSK       -----------------------
LEU1_LYSSC       -----------------------
LEU1_OCEIH       -----------------------
LEU1_BACCQ       -----------------------
LEU1_BACMK       -----------------------
LEU1_BACCN       -----------------------
LEU1_LACLA       -----------------------
LEU1_LACLS       -----------------------
LEU1_STRG3       TN---------------------
LEU1_STAAR       -----------------------
LEU1_STAHJ       -----------------------
LEU1_STAES       -----------------------
LEU1_STAS1       -----------------------
LEU1_STACT       -----------------------
LEU1_LISMO       -----------------------
LEU1_LISIN       -----------------------
LEU1_LISMH       -----------------------
LEU1_LISW6       -----------------------
LEU1_BREBN       -----------------------
LEU1_THEP1       -----------------------
LEU1_THENN       -----------------------
LEU1_SEDSS       -----------------------
LEU1_GEOS4       -----------------------
LEU1_KLEP3       -------KENNKETV--------
LEU1_ENT38       -------KENNKETV--------
LEU1_SALNS       -------KENNKETV--------
LEU1_SALAR       -------KENNKEIV--------
LEU1_CITK8       -------KENNKETV--------
LEU1_CROS8       -------KEHNQETV--------
LEU1_ECOLI       -------NENNKETV--------
LEU1_ERWT9       -------KDQ-KETV--------
LEU1_YERPS       ---------NNQEMV--------
LEU1_YERE8       ---------NNQEMV--------
LEU1_SERP5       ------KHQNNQETV--------
LEU1_PECCP       QQQNDSKQQNSQETV--------
LEU1_SODGM       ------NSQDMQETV--------
LEU1_EDWI9       ------PSISTSSTH--------
LEU1_PHOLL       ----------TKEMV--------
LEU1_PROMH       ----------TQEAV--------
LEU1_BLOPB       ----------NN-----------
LEU1_BLOFL       ----------KK-----------
LEU1_BUCAI       ----------KKK----------
LEU1_BUCDN       -----------------------
LEU1_BUCAP       ----------NN-----------
LEU1_BUCRP       ----------NN-----------
LEU1_BUCUN       -----------------------
LEU1_BUCUM       -----------------------
LEU1_BUCUE       -----------------------
LEU1_BUCML       -----------------------
LEU1_BUCCC       -----------------------
LEU1_AERHH       ----------KINTESV------
LEU1_AERS4       ----------KINTESV------
LEU1_TOLAT       -------------METL------
LEU1_SHESR       ------------ELGGV------
LEU1_SHEON       ------------ELGGV------
LEU1_SHEB8       ------------ELGGV------
LEU1_SHEAM       ------------ELGGV------
LEU1_SHEFN       ------------ELGGV------
LEU1_SHEHH       ------------EFGSV------
LEU1_SHEPA       ------------ELGGV------
LEU1_SHEPW       ------------VLGGV------
LEU1_SHESH       ------------ELGGV------
LEU1_SHEWM       ------------SLGGV------
LEU1_SHELP       ------------ELGGV------
LEU1_SHEDO       ------------EHAGV------
LEU1_PSYIN       ----------------V------
LEU1_ALIFM       -----------------------
LEU1_ALISL       -----------------------
LEU1_VIBCM       -----------------------
LEU1_VIBVU       -----------------------
LEU1_VIBPA       -----------------------
LEU1_VIBTL       -----------------------
LEU1_PHOPR       -----------------------
LEU1_HISS2       -----------------------
LEU1_PASMU       -----------------------
LEU1_HAEIE       -----------------------
LEU1_PSEA6       ----------V------------
LEU1_CAMJD       -----------------------
LEU1_OLSUV       -----------------------
LEU1_PARD8       -----------------------